CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	0 crisprs	NA	0	0
NZ_LR723671	Rhizobium flavum strain YW14 plasmid 2	0 crisprs	DEDDh,RT	0	1
NZ_LR723673	Rhizobium flavum strain YW14 plasmid 4	0 crisprs	NA	0	1
NZ_LR723670	Rhizobium flavum strain YW14 chromosome 1	1 crisprs	DEDDh,csa3,WYL,RT	2	5
NZ_LR723672	Rhizobium flavum strain YW14 plasmid 3	0 crisprs	csa3	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 70758

Salmonella_phage(18.18%)

transposase,integrase

attL 49506:49525|attR 69073:69092

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152338480.1\|0_1781_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	5.6e-137	43.6
WP_077548363.1\|1818_2127_+	hypothetical protein	NA	NA	NA	NA
WP_152338481.1\|2132_3806_-\|transposase	transposase	NA	NA	NA	NA
WP_139346263.1\|5018_5279_-	hypothetical protein	NA	NA	NA	NA
WP_077548649.1\|6841_7186_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	7.7e-35	58.5
WP_077548650.1\|7233_8886_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	3.0e-100	42.3
WP_139346264.1\|9578_10292_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.3e-12	34.1
WP_077548653.1\|10996_12367_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_077548654.1\|12431_14093_-	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_077548655.1\|14239_16894_+	2-oxoglutarate dehydrogenase E1 component	NA	NA	NA	NA
WP_139346265.1\|16980_17772_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_077548657.1\|17778_18867_-	NADH:flavin oxidoreductase/NADH oxidase	NA	NA	NA	NA
WP_172977913.1\|18893_20129_-	CoA transferase	NA	NA	NA	NA
WP_172977914.1\|20290_21067_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_077548660.1\|21077_22232_+	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_172977915.1\|22260_24357_+	CoA transferase	NA	NA	NA	NA
WP_077548662.1\|24395_25151_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_077548663.1\|25507_26302_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_077548664.1\|26392_27337_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	4.7e-18	27.6
WP_077548665.1\|27341_28541_+	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_077548666.1\|28557_29694_+	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_077548667.1\|29725_30508_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_077548668.1\|30519_31311_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_077548677.1\|31399_32620_+	CoA transferase	NA	NA	NA	NA
WP_077548669.1\|32849_34079_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_077548678.1\|34135_35020_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_172977916.1\|35016_36027_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_172977932.1\|36032_36755_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-12	30.5
WP_077548672.1\|36794_37526_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.2e-18	27.6
WP_077548679.1\|37539_38409_+	MaoC family dehydratase N-terminal domain-containing protein	NA	NA	NA	NA
WP_077548673.1\|38405_39194_+	CoA ester lyase	NA	NA	NA	NA
WP_077548674.1\|39214_39964_+	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_077548675.1\|39991_40921_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_152338482.1\|40926_42591_+	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_172977917.1\|42705_43938_+	MFS transporter	NA	NA	NA	NA
WP_152338483.1\|44109_47583_+	pyruvate carboxylase	NA	NA	NA	NA
WP_077546960.1\|47965_48610_+	RraA family protein	NA	NA	NA	NA
49506:49525	attL	NA	NA	NA	NA
WP_077546959.1\|49655_50120_+	hypothetical protein	NA	NA	NA	NA
WP_077546958.1\|50091_53061_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	6.2e-189	39.3
WP_077546957.1\|53075_53681_-	recombinase family protein	A0A0F7LA37	Escherichia_phage	2.8e-40	53.1
WP_077546956.1\|53822_55373_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_077546955.1\|55359_56520_-	HlyD family secretion protein	NA	NA	NA	NA
WP_077546954.1\|56512_56968_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_077546953.1\|57065_57533_+	universal stress protein	NA	NA	NA	NA
WP_139346155.1\|57662_59351_-	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_077547855.1\|59692_60058_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_077546952.1\|61670_62429_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	8.4e-42	41.4
WP_172977918.1\|63687_64734_-\|integrase	site-specific integrase	A0A076YL28	Mesorhizobium_phage	8.4e-32	39.0
WP_152338485.1\|64814_65888_-	porin	NA	NA	NA	NA
WP_139346332.1\|66761_67154_+	oxidoreductase	NA	NA	NA	NA
WP_077549415.1\|67343_69023_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_152338494.1\|69177_70758_+\|transposase	ISL3-like element ISRsp8 family transposase	NA	NA	NA	NA
69073:69092	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_LR723673

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8419 : 66295

Corynebacterium_phage(21.43%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172977944.1\|8419_9362_+\|transposase	IS630 family transposase	A0A2P0VP61	Tetraselmis_virus	1.1e-14	27.3
WP_077548354.1\|9552_11118_+	acyl--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	5.6e-32	26.4
WP_077548355.1\|11181_12618_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_077548356.1\|13251_13617_-	WGR domain-containing protein	NA	NA	NA	NA
WP_036588671.1\|13999_14485_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003537140.1\|15118_15316_-	hypothetical protein	NA	NA	NA	NA
WP_077548608.1\|15548_16262_-	ParA family protein	A0A2H4JGZ2	uncultured_Caudovirales_phage	1.6e-10	28.9
WP_077548358.1\|16943_17345_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_077548359.1\|17348_20264_+	conjugal transfer protein TraA	NA	NA	NA	NA
WP_077548360.1\|20270_20480_+	hypothetical protein	NA	NA	NA	NA
WP_152338517.1\|20959_23935_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.1e-188	37.8
WP_152338518.1\|24014_24695_+	hypothetical protein	NA	NA	NA	NA
WP_077548365.1\|24691_26212_+	AMP-binding protein	A0A1V0SBX8	Catovirus	7.7e-18	27.5
WP_152338409.1\|26605_27802_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	4.7e-95	47.5
WP_139346112.1\|28038_28272_-	hypothetical protein	NA	NA	NA	NA
WP_139346111.1\|28453_28909_-	hypothetical protein	NA	NA	NA	NA
WP_077546346.1\|30579_31704_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	8.7e-11	41.4
WP_152338409.1\|31767_32964_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	4.7e-95	47.5
WP_172977945.1\|33800_34727_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.6e-10	31.9
WP_077549895.1\|35327_36011_+	CerR family C-terminal domain-containing protein	NA	NA	NA	NA
WP_077549896.1\|36117_36438_+	hypothetical protein	NA	NA	NA	NA
WP_139346391.1\|36897_37206_+	hypothetical protein	NA	NA	NA	NA
WP_077549898.1\|37304_38921_+	AarF/ABC1/UbiB kinase family protein	A0A0P0CRP3	Ostreococcus_lucimarinus_virus	3.9e-36	28.5
WP_172977946.1\|38873_39317_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_077549904.1\|39872_40934_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_152338519.1\|41177_41996_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_077549901.1\|41992_42979_-	aldo/keto reductase	NA	NA	NA	NA
WP_139346392.1\|43292_43469_+	DUF2934 domain-containing protein	NA	NA	NA	NA
WP_077549903.1\|44188_44773_-	acyloxyacyl hydrolase	NA	NA	NA	NA
WP_077548973.1\|48446_49373_+	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	5.4e-75	47.3
WP_077548975.1\|49518_49761_+	type II toxin-antitoxin system VapB family antitoxin	NA	NA	NA	NA
WP_077548976.1\|49760_50165_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_172977947.1\|50521_50668_+	hypothetical protein	NA	NA	NA	NA
WP_064334949.1\|50965_51283_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_172977948.1\|51601_51772_+	hypothetical protein	NA	NA	NA	NA
WP_077548978.1\|51810_52089_-	HU family DNA-binding protein	B5TA87	Burkholderia_phage	4.8e-11	43.7
WP_077549026.1\|52229_52487_-	WGR domain-containing protein	NA	NA	NA	NA
WP_077548979.1\|52736_54659_-	Ti-type conjugative transfer system protein TraG	NA	NA	NA	NA
WP_077548980.1\|54651_54867_-	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_003501352.1\|54871_55168_-	TraC family protein	NA	NA	NA	NA
WP_077548981.1\|55416_58719_+	Ti-type conjugative transfer relaxase TraA	V5UQN3	Mycobacterium_phage	1.8e-16	27.8
WP_003501349.1\|58715_59246_+	conjugative transfer signal peptidase TraF	NA	NA	NA	NA
WP_077548982.1\|59166_60414_+	conjugal transfer protein TraB	NA	NA	NA	NA
WP_077548983.1\|60427_61057_+	conjugal transfer protein TraH	NA	NA	NA	NA
WP_077548984.1\|61377_61686_+	transcriptional regulator	NA	NA	NA	NA
WP_077548985.1\|61689_62394_-	transcriptional regulator TraR	NA	NA	NA	NA
WP_152338409.1\|62555_63752_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	4.7e-95	47.5
WP_077546249.1\|64130_64868_+	hypothetical protein	NA	NA	NA	NA
WP_077546248.1\|64873_66295_-\|transposase	ISNCY family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_LR723670

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LR723670_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LR723670_1

662684-662884

Orphan

Consensus_repeat	Method
GTCGTTGCCAGCGCCGCCATTGAT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_LR723670_1

>merge|NZ_LR723670|1|662684-662884|CRISPRCasFinder
GTCATCCCCAGCGCCACCGGTGAGAGCGTCACCGTTCGCACCACCACGGATTACGTCGTTGCCAGCGCCGCCATTGATGACGTCACGACCAGCACCGCCAGTGATGAGGTCGTTGCCAGCGCCGCCGTTGATCGTGGCAACCACAGTGCCGGATGATACGCTTGCTGCACTCAGGACGTCGTTACCCGAACCACCAGTGAT

>NZ_LR723670|1|1|662684-662884|CRISPRCasFinder
GTCATCCCCAGCGCCACCGGTGAG	AGCGTCACCGTTCGCACCACCACGGATTAC
GTCGTTGCCAGCGCCGCCATTGAT	GACGTCACGACCAGCACCGCCAGTGATGAG
GTCGTTGCCAGCGCCGCCGTTGAT	CGTGGCAACCACAGTGCCGGATGATACGCTTGCTGCACTCAGGAC
GTCGTTACCCGAACCACCAGTGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LR723670.1\|WP_152338409.1\|672153_673350_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_LR723670.1\|WP_172977807.1\|665299_665512_-\|MucR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|368446
NZ_LR723670.1\|WP_077546944.1\|654604_655045_+\|PIN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350313
NZ_LR723670.1\|WP_077546937.1\|658863_659265_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR723670.1\|WP_077546942.1\|654338_654581_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|376852
NZ_LR723670.1\|WP_077546938.1\|658513_658867_+\|DUF2958-domain-containing-protein	unknown	unknown	gnl\|CDD\|371405
NZ_LR723670.1\|WP_077546934.1\|660266_661448_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271177
NZ_LR723670.1\|WP_139346151.1\|655829_656894_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR723670.1\|WP_077546931.1\|664529_664886_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_LR723670.1\|WP_077546941.1\|655281_655596_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR723670.1\|WP_077546936.1\|659307_659832_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR723670.1\|WP_077546930.1\|665100_665373_-\|MucR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227293
NZ_LR723670.1\|WP_077546928.1\|668209_669256_+\|ATP-dependent-DNA-ligase	unknown	unknown	gnl\|CDD\|274295
NZ_LR723670.1\|WP_172977808.1\|666668_666836_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR723670.1\|WP_077546925.1\|671932_672112_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR723670.1\|WP_077546939.1\|657338_658436_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR723670.1\|WP_077546935.1\|659842_660100_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LR723670.1\|WP_077546929.1\|666980_667793_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
NZ_LR723670.1\|WP_077546926.1\|671336_671711_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LR723670.1\|WP_152338408.1\|669554_670820_+\|FecR-domain-containing-protein	unknown	unknown	gnl\|CDD\|377406

Protein	Function_ID	Function_description	E-value
NZ_LR723670.1\|WP_152338409.1\|672153_673350_-\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	4.69364e-142
NZ_LR723670.1\|WP_077546931.1\|664529_664886_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	7.40114e-09
NZ_LR723670.1\|WP_172977807.1\|665299_665512_-\|MucR-family-transcriptional-regulator	gnl\|CDD\|368446	pfam05443, ROS_MUCR, ROS/MUCR transcriptional regulator protein. This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti. This gene encodes a 15.5-kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid and is necessary for succinoglycan production. Sinorhizobium meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of alfalfa nodules. MucR from Sinorhizobium meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan.	4.17856e-09
NZ_LR723670.1\|WP_077546944.1\|654604_655045_+\|PIN-domain-containing-protein	gnl\|CDD\|350313	cd18746, PIN_VapC4-5_FitB-like, uncharacterized subgroup of the PIN_VapC4-5_FitB-like subfamily of the PIN domain superfamily. The PIN_VapC4-5_FitB-like subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC4 and VapC5 ribonuclease toxins of the VapBC toxin/antitoxin (TA) system, and Neisseria gonorrhoeae FitB toxin of the FitAB TA system. This subfamily belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	7.62013e-34
NZ_LR723670.1\|WP_077546930.1\|665100_665373_-\|MucR-family-transcriptional-regulator	gnl\|CDD\|227293	COG4957, COG4957, Predicted transcriptional regulator [Transcription].	6.78727e-36
NZ_LR723670.1\|WP_077546928.1\|668209_669256_+\|ATP-dependent-DNA-ligase	gnl\|CDD\|274295	TIGR02779, NHEJ_ligase_lig, DNA ligase D, ligase domain. DNA repair of double-stranded breaks by non-homologous end joining (NHEJ) is accomplished by a two-protein system that is present in a minority of prokaryotes. One component is the Ku protein (see TIGR02772), which binds DNA ends. The other is a DNA ligase, a protein that is a multidomain polypeptide in most of those bacteria that have NHEJ, a permuted polypeptide in Mycobacterium tuberculosis and a few other species, and the product of tandem genes in some other bacteria. This model represents the ligase domain.	1.2462e-114
NZ_LR723670.1\|WP_077546942.1\|654338_654581_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	5.52313e-09
NZ_LR723670.1\|WP_077546929.1\|666980_667793_+\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	2.04375e-24
NZ_LR723670.1\|WP_077546938.1\|658513_658867_+\|DUF2958-domain-containing-protein	gnl\|CDD\|371405	pfam11171, DUF2958, Protein of unknown function (DUF2958). Some members are annotated as lipoproteins however this cannot be confirmed. This family of proteins has no known function.	2.66741e-53
NZ_LR723670.1\|WP_077546934.1\|660266_661448_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	4.97738e-40
NZ_LR723670.1\|WP_152338408.1\|669554_670820_+\|FecR-domain-containing-protein	gnl\|CDD\|377406	pfam04773, FecR, FecR protein. FecR is involved in regulation of iron dicitrate transport. In the absence of citrate FecR inactivates FecI. FecR is probably a sensor that recognizes iron dicitrate in the periplasm.	4.17054e-06

>NZ_LR723670.1|WP_077546934.1|660266_661448_+|tyrosine-type-recombinase/integrase
MPVINLTQNIVRTATCPAGKRKIEYSDAKQRGFYLEVLHTGTKTYRQRYTDDHGKKNHYKIGAANVLTLDQARQKARSILAQVHLGEDPQAKRQEKREIPSLSEFVRSRYLPHAQEKKRSWKTDETMLRVHILPALGSKPMDTITPEQIAALVQRMKGKGYAPGTVNRAVILLRFMFNLARRWKIAGIIENPTADLALAPTQHRQRFLSKDELRSLLLSIQEDENQVAAQAILLLLLTGARRNEVTHAKWEYINWQSNTLWVPLSKSGKERFVSLNKQAIALLRSLQRTPGNPYIFPSTVTGEPSPSLHYPWVRIRDRAGLKDMRVHDLRHSFASFLVNEGVSLYVVQNLLGHTQVRTTQRYAHIADGTKSDAAQLAGQVIEAMTLPALSLTP
>NZ_LR723670.1|WP_077546935.1|659842_660100_+|hypothetical-protein
MLGQITDHRPDPRAEDCDAVFEPSIHDDPHVGGEWSYEAVTAHADYFHVTALYETAVTHAIRHAETAWPFPVNIYLYPKGSAPLG
>NZ_LR723670.1|WP_077546936.1|659307_659832_+|hypothetical-protein
MNLQLLQSWRGALLIAAIVTLGMTAYKAVFGPDPATRIAESRMARLLPGGQPSQDMLNRQIAAARPYISIQITLGQLANYMRGLNYEITWEVVDVNAFVMMATGDDPLTRQSEEYAIQFIVLDGPVRDGRVIGTFEGPAVGIDSMAYNRETVTDEEIVQFLLHIISELSPLPLQ
>NZ_LR723670.1|WP_077546937.1|658863_659265_+|hypothetical-protein
MTDPSRSPPDWLRLVRAGQFNSMPDPFTWDISHDFAHLINGYTLSQQAGLRRLGFLANACFDEAQETGHWSGTALELWCCLFFEHRRYRHMGEGEPTGSDLELLNRLCTRLRLELQTLTDEERQTLLIALPQR
>NZ_LR723670.1|WP_077546938.1|658513_658867_+|DUF2958-domain-containing-protein
MPRPTLLNAALRRQLLQNGHKSRSQPDFDPVPVAKLFTPDASATWLLTELNPDNPDLAFGLCDLGLGSPELGYVSLAEIARIRGRLRLPVERDRWFWTTEPLSVHLQCARQSGRIAA
>NZ_LR723670.1|WP_077546939.1|657338_658436_+|hypothetical-protein
MPKATAKPAPVIEDDVNETIPLIPEDILRQHHCLEPDASRFTAAARLLQSLWRQDQNLPVGRHRSPSGETRQIGSRLTMSAGRAGANFLDPAIASLVRRELVYREIGALIDADRLFRNLLSSMPLVFNLFGPLKRDLELATRVMRLVLPGFTGTVTKIQFEHSPGRGNPAFSADYTAADALVRYRTEDGRRGYVFVEQKYTETMGETTQPTRPHLDRLSEQSGLFKDANAASLRSSPCQQLWREHLLAASMIQRGNYDEGYFIVIAPRLNWHAQNGIAAYARHLKKPDPGHPVFTGIFLERFIEAIGTAGEPDYAQRLHQRYADFARIDQLIDAYLDAEDQAGIELLTTPEDVSARSETEAMAAA
>NZ_LR723670.1|WP_139346151.1|655829_656894_-|hypothetical-protein
MMNANHFRPGDNWGGGRLYRSVLPGGQLTISPDWEVSGPKVVVMKPVNCRTHRMGQSDEGHFGVAPGVYEVDFDNFDPSVGLLPFRHWQRKKSPQPLKPRLTVLERETPKLFNAASFLIWSTGKHFNTMITVSAKELGFSDNAEFMKLMPVWHKEMARWMMNGTDRFRRRASRKCLPEASQPHYWISVAEYAREQGFHVHVLCVLPKGLKKAFVAKAWDWWVRHAKQVPTKAALDFECRWPKQQRTQYARHVHLLRYVLKTTADVPKLDRHGRQWSLRRAVWAKPNDCTPVWVMVPQLAGICRALNAKAQEEEGFVSTFDERDFSFVYENWEYGMWEARMEQKRMGLLLKSLVI
>NZ_LR723670.1|WP_077546941.1|655281_655596_+|hypothetical-protein
MPAKRRTDPSQAMAEAEAALTRAGVKFTQKTDFHLKVQALNYWPSTGNVRHDGDHKPAQPLGLAVFIRLLREAGLATAQPLDLVDDPAAFIVQRPPQEPGFETY
>NZ_LR723670.1|WP_077546944.1|654604_655045_+|PIN-domain-containing-protein
MISLLAPKKDGGPRISSELAAWIRKNTDSLFLSAITVAEIRAGISKLRRSGGEARSDDLELWLNNLISNYGDRLLPVEVHAATMAGDLADHATATGRNPGLADILVAATAQRHHLCLLTANTKHFEHLALSIRVENPLDHLPSSQV
>NZ_LR723670.1|WP_077546942.1|654338_654581_+|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MKTLNLRDAKATFSAVVEAAAQGEPTVVTKHGRPAVMIVPIEEGRRIFPDTKPSFADLLLSMPHELQIERDQTPMREVDL
>NZ_LR723670.1|WP_077546931.1|664529_664886_+|helix-turn-helix-transcriptional-regulator
MRPVPSEAAKQQIEELRASVGKWLRDKRIEAGLNQKELAARAGFEYYTFISQMETGRGRVPAERYEGYAKALGIDPKEFAMRMLYAYENSTYHLLFPKEQVTDLERRLAALEMAVANK
>NZ_LR723670.1|WP_077546930.1|665100_665373_-|MucR-family-transcriptional-regulator
MESEAPPDPKRTSRAKNVKKTVNREAITCLECGKHFKSLRRHLAVHHNLSPEAYRHKWALEPDHPMVAPAYAERRSQLAKDMGLGGTSRR
>NZ_LR723670.1|WP_172977807.1|665299_665512_-|MucR-family-transcriptional-regulator
MHNHDHKEHLAELTAGIVSAYLNKNVVSPAALVSLIESVRETLSRLDGVRSPSGPEKNVSSEKREEDGEP
>NZ_LR723670.1|WP_172977808.1|666668_666836_-|hypothetical-protein
MNWINIAVSLGILSIVITAALLLLIRGGARREGLDQRFLDEEQAKAIREWNDNHS
>NZ_LR723670.1|WP_077546929.1|666980_667793_+|IS5-family-transposase
MWTPATRRQHNRESLRYETDLTDREWNLLAPMMPVAAKTGRPRKWTLREIMNAIFYVMCGGIGWRLLPSDFPPRSTVFRWFCRFRDECLFEKINHRLLTLDRERCGREASPTASIIDSQSVKTCESGGPCGYDAGKKIKGRKRHVLVDTDGRALVLFPHPASIQDRDGAGPVLQASRRPFPFVRKVFADAGYQGPRVAEATSIAVEIVKRKPDQVGFAVQPRRWVVERFFAWIGRNRRLWKDAEATIESATAFLYAAAVMILVRRIARQS
>NZ_LR723670.1|WP_077546928.1|668209_669256_+|ATP-dependent-DNA-ligase
MAKGPRKTTAPLLIEDDLPLKSGRVRKRDPKQPELPFDPMPERVDPCLAKLVQKPPHGDEWSYELKWDGYRLAVHIEAGGVRILTRNGHDWTHRFPGIEEEARGFAPSTMILDGEAVVFNAQGIPDFGLLQNSLGGRGGKLPSRNSVLMAFDLLYLDGHDLTKMEYGARRHLLEDVLADKQGAIRLSEEFHEDPDELLRHAREHDLEGIIAKHRDRPYRSGRSGDWLKIKCVQSDTFTIVGYEPSTAVPGAIGSLLLAARYRDGWKYVGSVGTGFKHDEARRLKKQLDKLKTDIPAVSVPSKKVVMTGPSLFAEIEYRAWTHTGTLRHPSFKGLREPEDWAEVYRLPD
>NZ_LR723670.1|WP_152338408.1|669554_670820_+|FecR-domain-containing-protein
MPRIFRSIPFAALMMLCFSAAGSLASEWLVSRTTQQVSFTVDKKTWVPVVGGMTIPNRSWISTGPRGRVQLERGVEKVSFGPKTLAAIITENGLFSRKTEVVQQKGEIALNIEKRSRPHTYVHTPFLAAVVKGTTFTVTVSEKAASVSVDEGLVQVSSFTGGQSTNVGPGQQVTVDHAQSMSVAGITETPAVFSVEPTQAFVPAVGQPAPVGAGLGLGTFSDQGSTGPSSNGGSIGVNGESSGGGNSLEQPMVDNNGNVGGSGNGNDGKGPGGKGPDDKGPGGKGPGDKGPGGKGPGDKGPGGKGPDDKGPGGKGPGDKGPGGKGPDDKGPGGKGPDDKGPGGKGPGDKVPGGKGPDDKGPGGKGPDDKGPGGKGPDDKGPGGKGNDGNSGGKGNDGKGPGGKGNNEQGRGGKGNSGKDDD
>NZ_LR723670.1|WP_077546926.1|671336_671711_-|hypothetical-protein
MSTRGGRRGGGRDRQRGRQRAYRERLKRERRPGRDDVARIALHWLIVKTANLAVRTSNPARMHVVEDALLDGLVAQGFNARASEEVLDELIDKYVDGGWNFRRKLHLQEEPPASARILLDRDAD
>NZ_LR723670.1|WP_077546925.1|671932_672112_+|hypothetical-protein
MKTSTAPAALPGCAETEMLGGCDIAVESDGIRRDADREFNAPENKMAYPVTAIVSPGVV
>NZ_LR723670.1|WP_152338409.1|672153_673350_-|IS256-family-transposase
MTDDMMNLRSLVEKSADADLLREMIGFAAEKLMALEVSTKTGAGYGEKNSFRLAQRNGYRDRDWETRAGTVELRIPKLRTGSYFPSFLEPRRMAEKALTAVIQEAYIQGVSTRSVDDLVKAMGMSGISKSQVSRLCEEIDEKVKAFLDRPIEGEWPYLWIDATYLKVRRGGRIVSVAVIIAVGVNTDGRREVLGMEIGTSEAEAIWTEFLRKLTRRGLCGVKLVVSDAHEGIKAAVSKVLSATWQRCRVHFMRNALAHAGKSGRRVVSAFIATAFAQDTSEAASTQWRNVADQIRPKVPKLASLMDSAEQDVLAYMTFPKQHWAKLHSTNPIERLNGEIKRRTEVVGIFPNDDAIVRLVGALLLEQNDEWAVQRSRYMTLETIATMSDDPLISLPAAS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LR723670_1	1.2\|662762\|30\|NZ_LR723670\|CRISPRCasFinder	662762-662791	30	NZ_CP020540	Sphingobium herbicidovorans strain MH plasmid pSHV1, complete sequence	291069-291098	6	0.8
NZ_LR723670_1	1.2\|662762\|30\|NZ_LR723670\|CRISPRCasFinder	662762-662791	30	NZ_CP009112	Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence	461380-461409	7	0.767
NZ_LR723670_1	1.2\|662762\|30\|NZ_LR723670\|CRISPRCasFinder	662762-662791	30	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	852447-852476	7	0.767
NZ_LR723670_1	1.2\|662762\|30\|NZ_LR723670\|CRISPRCasFinder	662762-662791	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1924571-1924600	9	0.7
NZ_LR723670_1	1.1\|662708\|30\|NZ_LR723670\|CRISPRCasFinder	662708-662737	30	MN478375	Bacteriophage Titan-X, complete genome	41808-41837	10	0.667

1. spacer 1.2|662762|30|NZ_LR723670|CRISPRCasFinder matches to NZ_CP020540 (Sphingobium herbicidovorans strain MH plasmid pSHV1, complete sequence) position: , mismatch: 6, identity: 0.8

gacgtcacgaccagcaccgccagtgatgag	CRISPR spacer
gtcgtcgcgaccagcaccgccagccctgat	Protospacer
* ****.****************.  ***

2. spacer 1.2|662762|30|NZ_LR723670|CRISPRCasFinder matches to NZ_CP009112 (Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcacgaccagcaccgccagtgatgag	CRISPR spacer
gtcgccaccaccagcaccgccagtgccgcc	Protospacer
* **.*** **************** .*

3. spacer 1.2|662762|30|NZ_LR723670|CRISPRCasFinder matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gacgtcacgaccagcaccgccagtgatgag	CRISPR spacer
gatgtcacgaacagcaccgccagcaacgcc	Protospacer
**.******* ************..*.*

4. spacer 1.2|662762|30|NZ_LR723670|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.7

gacgtcacgaccagcaccgccagtgatgag	CRISPR spacer
acggtcacggccagcaccaccagtgacacc	Protospacer
.  ******.********.*******..

5. spacer 1.1|662708|30|NZ_LR723670|CRISPRCasFinder matches to MN478375 (Bacteriophage Titan-X, complete genome) position: , mismatch: 10, identity: 0.667

agcgtcaccgttcgcaccaccacggattac	CRISPR spacer
ctcgtctccgttcgcaccaccacctgccgg	Protospacer
  **** ****************  ....

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

624667 : 661448

EBPR_siphovirus(20.0%)

integrase,transposase

attL 626453:626471|attR 665695:665713

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152338401.1\|624667_625864_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-93	46.5
626453:626471	attL	NA	NA	NA	NA
WP_077548631.1\|626643_627066_+	MucR family transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	8.3e-15	41.5
WP_152338402.1\|627070_628195_-	DUF4214 domain-containing protein	NA	NA	NA	NA
WP_077548633.1\|628324_628621_-	hypothetical protein	NA	NA	NA	NA
WP_077548634.1\|628724_629813_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.8e-14	35.3
WP_077548635.1\|630213_631089_+	lysozyme	F8TV87	EBPR_siphovirus	4.7e-36	44.6
WP_172977803.1\|631585_632104_+	hypothetical protein	NA	NA	NA	NA
WP_152338403.1\|632317_633283_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_172977804.1\|634737_635193_-	hypothetical protein	K4I0S3	Escherichia_phage	2.8e-08	32.1
WP_172977805.1\|635524_637603_+	DUF4214 domain-containing protein	F8TV35	EBPR_siphovirus	1.3e-07	33.9
WP_152338473.1\|640032_640647_-	plasmid pRiA4b ORF-3 family protein	NA	NA	NA	NA
WP_152338404.1\|641572_642943_-\|transposase	transposase	NA	NA	NA	NA
WP_142523325.1\|643917_644265_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	2.2e-37	61.7
WP_152338405.1\|644261_644672_-\|transposase	transposase	NA	NA	NA	NA
WP_139346153.1\|647919_649446_-	hypothetical protein	NA	NA	NA	NA
WP_077546946.1\|649636_650587_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	1.3e-71	48.0
WP_077546945.1\|650583_650970_+	GtrA family protein	NA	NA	NA	NA
WP_172977806.1\|651225_651507_-	hypothetical protein	NA	NA	NA	NA
WP_152338403.1\|651716_652682_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_152338406.1\|652760_653927_-	hypothetical protein	NA	NA	NA	NA
WP_077546942.1\|654338_654581_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_077546944.1\|654604_655045_+	PIN domain-containing protein	NA	NA	NA	NA
WP_077546941.1\|655281_655596_+	hypothetical protein	NA	NA	NA	NA
WP_139346151.1\|655829_656894_-	hypothetical protein	NA	NA	NA	NA
WP_077546939.1\|657338_658436_+	hypothetical protein	NA	NA	NA	NA
WP_077546938.1\|658513_658867_+	DUF2958 domain-containing protein	A0A1W6DX76	Sphingobium_phage	9.0e-31	61.6
WP_077546937.1\|658863_659265_+	hypothetical protein	NA	NA	NA	NA
WP_077546936.1\|659307_659832_+	hypothetical protein	NA	NA	NA	NA
WP_077546935.1\|659842_660100_+	hypothetical protein	NA	NA	NA	NA
WP_077546934.1\|660266_661448_+\|integrase	tyrosine-type recombinase/integrase	A0A221SAN4	Ralstonia_phage	7.5e-37	32.8
665695:665713	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1038645 : 1084495

Hokovirus(10.0%)

portal,protease,capsid,tail,transposase,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139346193.1\|1038645_1039065_+\|transposase	transposase	NA	NA	NA	NA
WP_077547711.1\|1039054_1039855_+	hypothetical protein	NA	NA	NA	NA
WP_077547712.1\|1039858_1040281_-	SufE family protein	NA	NA	NA	NA
WP_077547713.1\|1040464_1040893_-	DUF5330 domain-containing protein	NA	NA	NA	NA
WP_077547714.1\|1041382_1042906_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	5.3e-27	33.6
WP_077547715.1\|1042874_1043843_+	peptidoglycan-binding protein	NA	NA	NA	NA
WP_152338417.1\|1043898_1044246_+	DUF1491 family protein	NA	NA	NA	NA
WP_172977817.1\|1044250_1045267_-	DUF2336 domain-containing protein	NA	NA	NA	NA
WP_077547717.1\|1045746_1045935_+	hypothetical protein	NA	NA	NA	NA
WP_077547718.1\|1045959_1046523_-	DUF1254 domain-containing protein	NA	NA	NA	NA
WP_077547719.1\|1046515_1047103_-	DUF1214 domain-containing protein	NA	NA	NA	NA
WP_077547720.1\|1047170_1049396_-	penicillin-binding protein	NA	NA	NA	NA
WP_077547721.1\|1049543_1050008_+	YcgN family cysteine cluster protein	NA	NA	NA	NA
WP_077547722.1\|1050014_1050680_-	hypothetical protein	NA	NA	NA	NA
WP_077547723.1\|1050798_1051458_-	dihydrofolate reductase	NA	NA	NA	NA
WP_077547724.1\|1051604_1053986_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	6.5e-80	31.7
WP_077547725.1\|1053997_1054420_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_052637563.1\|1054474_1054672_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_077547726.1\|1054748_1055153_-	response regulator	NA	NA	NA	NA
WP_077547727.1\|1055515_1056232_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_077547728.1\|1056295_1056547_+	hypothetical protein	NA	NA	NA	NA
WP_077547729.1\|1056550_1057264_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_077547730.1\|1057555_1057810_+	hypothetical protein	NA	NA	NA	NA
WP_077547731.1\|1057879_1058164_+	acylphosphatase	NA	NA	NA	NA
WP_077547732.1\|1058317_1058992_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_077547733.1\|1058998_1060786_-	flagellin	NA	NA	NA	NA
WP_077547734.1\|1061025_1061664_-	porin family protein	NA	NA	NA	NA
WP_077547735.1\|1061986_1063471_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	4.3e-50	34.5
WP_077547736.1\|1063471_1064086_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_077547737.1\|1064178_1065498_-	pyrimidine utilization transport protein G	Q9KX94	Enterobacteria_phage	1.2e-136	62.6
WP_077547738.1\|1065723_1066629_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_077547739.1\|1066809_1067292_+	VOC family protein	NA	NA	NA	NA
WP_077547740.1\|1067288_1067504_+	DUF4287 domain-containing protein	NA	NA	NA	NA
WP_077547979.1\|1067799_1068066_+	hypothetical protein	NA	NA	NA	NA
WP_077547741.1\|1068344_1068614_-	hypothetical protein	NA	NA	NA	NA
WP_077547980.1\|1068812_1071065_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	A0A0P0I429	Acinetobacter_phage	7.1e-36	25.2
WP_077547742.1\|1071076_1072093_-	xanthine dehydrogenase family protein subunit M	NA	NA	NA	NA
WP_077547743.1\|1072089_1072611_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_077547744.1\|1072830_1073067_+	hypothetical protein	NA	NA	NA	NA
WP_077547745.1\|1073092_1074073_-	glutaminase A	NA	NA	NA	NA
WP_077547746.1\|1074383_1075088_+	hypothetical protein	NA	NA	NA	NA
WP_172977894.1\|1075167_1076574_+	DNA-packaging protein	A0A1V0DY66	Dinoroseobacter_phage	5.0e-72	40.4
WP_172972334.1\|1076575_1076716_-	hypothetical protein	NA	NA	NA	NA
WP_077547747.1\|1076871_1077504_+	hypothetical protein	R9U4A9	Rhizobium_phage	1.8e-42	47.1
WP_077547748.1\|1077575_1078190_+	hypothetical protein	NA	NA	NA	NA
WP_077547749.1\|1078268_1079444_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	6.2e-60	36.5
WP_077547750.1\|1079513_1079777_+	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_077547751.1\|1079776_1080076_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_077547752.1\|1080256_1080574_+	hypothetical protein	NA	NA	NA	NA
WP_077547753.1\|1080621_1081239_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	7.9e-30	47.9
WP_077547754.1\|1081235_1082507_+\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	5.7e-83	45.9
WP_077547755.1\|1083300_1083633_+\|head	phage head closure protein	NA	NA	NA	NA
WP_077547757.1\|1083629_1084049_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_077547759.1\|1084087_1084495_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA

DBSCAN-SWA_3

1156331 : 1211239

Corynebacterium_phage(33.33%)

integrase,transposase

attL 1180672:1180731|attR 1209813:1211328

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152338409.1\|1156331_1157528_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	4.7e-95	47.5
WP_077546339.1\|1157617_1158349_+	hypothetical protein	NA	NA	NA	NA
WP_077546338.1\|1158836_1159166_+	hypothetical protein	NA	NA	NA	NA
WP_172977820.1\|1159319_1161416_-	ATP-dependent helicase	NA	NA	NA	NA
WP_077546336.1\|1161418_1162423_-	hypothetical protein	NA	NA	NA	NA
WP_172977821.1\|1162531_1163164_-	DUF262 domain-containing protein	NA	NA	NA	NA
WP_172977822.1\|1163225_1163381_-	DUF4357 domain-containing protein	NA	NA	NA	NA
WP_077546333.1\|1163592_1166691_-	site-specific DNA-methyltransferase	A0A222ZMD5	Mycobacterium_phage	9.8e-20	25.4
WP_077546332.1\|1166692_1167298_-	hypothetical protein	NA	NA	NA	NA
WP_172977823.1\|1167305_1168106_-	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_077546330.1\|1168102_1171189_-	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_077546329.1\|1171481_1171799_+	hypothetical protein	NA	NA	NA	NA
WP_077546328.1\|1172094_1172484_-	hypothetical protein	NA	NA	NA	NA
WP_077546327.1\|1173766_1174957_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.1e-14	30.6
WP_139346110.1\|1175451_1175655_+	hypothetical protein	NA	NA	NA	NA
WP_077546325.1\|1175707_1176997_+	DUF1513 domain-containing protein	NA	NA	NA	NA
WP_077546324.1\|1177307_1177583_-	hypothetical protein	NA	NA	NA	NA
WP_152338409.1\|1178086_1179283_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	4.7e-95	47.5
WP_139346218.1\|1179599_1180694_+	hypothetical protein	NA	NA	NA	NA
1180672:1180731	attL	NA	NA	NA	NA
WP_152338390.1\|1180746_1182098_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_077546341.1\|1183717_1185949_+	EAL domain-containing protein	NA	NA	NA	NA
WP_172977824.1\|1186162_1187053_+	hypothetical protein	NA	NA	NA	NA
WP_052820534.1\|1187344_1187812_-	Hsp20 family protein	A0A2H4N7P1	Lake_Baikal_phage	2.3e-18	37.1
WP_152338424.1\|1188185_1188494_+	DUF982 domain-containing protein	NA	NA	NA	NA
WP_152338409.1\|1188574_1189771_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	4.7e-95	47.5
WP_152338425.1\|1190642_1192130_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_077549028.1\|1192143_1194372_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.8e-85	35.6
WP_077549029.1\|1194368_1194554_+	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_077549030.1\|1194550_1195054_+	polyketide cyclase	NA	NA	NA	NA
WP_142523899.1\|1195184_1196258_+	nitrite reductase, copper-containing	NA	NA	NA	NA
WP_077549032.1\|1196351_1196855_-	hypothetical protein	NA	NA	NA	NA
WP_052821107.1\|1196854_1197310_-	DUF305 domain-containing protein	NA	NA	NA	NA
WP_052821108.1\|1197532_1197865_-	four-helix bundle copper-binding protein	NA	NA	NA	NA
WP_077549033.1\|1197869_1198352_-	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	3.2e-10	37.2
WP_077549034.1\|1198928_1199315_+	hypothetical protein	NA	NA	NA	NA
WP_062654123.1\|1199400_1199622_+	hypothetical protein	NA	NA	NA	NA
WP_077549042.1\|1199621_1201082_+	TolC family protein	NA	NA	NA	NA
WP_062654122.1\|1201093_1202452_+	copper oxidase	NA	NA	NA	NA
WP_062654121.1\|1202482_1202959_+	copper oxidase	NA	NA	NA	NA
WP_062654119.1\|1202979_1203264_+	copper-binding protein	NA	NA	NA	NA
WP_077549035.1\|1203317_1203767_+	DUF411 domain-containing protein	NA	NA	NA	NA
WP_077549036.1\|1203831_1204236_-	MerR family DNA-binding protein	NA	NA	NA	NA
WP_077549037.1\|1204290_1205079_+	glutaredoxin family protein	NA	NA	NA	NA
WP_139346304.1\|1205237_1205807_-	hypothetical protein	NA	NA	NA	NA
WP_077549039.1\|1205861_1206401_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_077549040.1\|1206662_1207283_+\|integrase	tyrosine-type recombinase/integrase	A0A0A8WF93	Clostridium_phage	8.5e-08	29.4
WP_152338426.1\|1207775_1209026_-	FecR domain-containing protein	NA	NA	NA	NA
WP_152338390.1\|1209887_1211239_-\|transposase	IS3 family transposase	NA	NA	NA	NA
1209813:1211328	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1616717 : 1625587

uncultured_Mediterranean_phage(75.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152338476.1\|1616717_1617524_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.8e-35	34.8
WP_077547303.1\|1617513_1618230_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.1e-38	45.8
WP_152338432.1\|1618280_1619390_+	ATP-binding cassette domain-containing protein	Q6GZ03	Mycoplasma_phage	8.6e-11	27.7
WP_052638204.1\|1619420_1619627_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	1.1e-07	56.9
WP_077547305.1\|1619659_1620322_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_052638206.1\|1620318_1621143_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.2e-44	40.7
WP_077547306.1\|1621197_1622481_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	5.9e-96	46.0
WP_077547307.1\|1622480_1623257_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.5e-27	31.7
WP_052638209.1\|1623253_1623907_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	NA	NA	NA	NA
WP_172977900.1\|1624087_1625587_+	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	3.6e-12	31.7

DBSCAN-SWA_5

1839781 : 1849541

uncultured_Mediterranean_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_077546284.1\|1839781_1840297_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	1.3e-46	60.0
WP_077546254.1\|1840344_1840911_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	5.5e-46	54.9
WP_077546255.1\|1840932_1841427_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.8e-24	35.9
WP_052638394.1\|1841652_1841832_+	hypothetical protein	NA	NA	NA	NA
WP_077546256.1\|1842108_1844922_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.3e-95	33.3
WP_077546257.1\|1845147_1845780_+	MarC family protein	NA	NA	NA	NA
WP_077546258.1\|1845821_1846367_-	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	1.4e-46	76.3
WP_077546259.1\|1846619_1849541_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	61.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_LR723672

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

27946 : 88995

Escherichia_phage(18.18%)

transposase,integrase

attL 24217:24233|attR 69368:69384

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
24217:24233	attL	NA	NA	NA	NA
WP_077549417.1\|27946_29104_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_077549226.1\|29184_29463_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_077549225.1\|29449_29881_+	plasmid maintenance toxin (PemK-like)	NA	NA	NA	NA
WP_152338497.1\|30088_31267_+	DUF1612 domain-containing protein	NA	NA	NA	NA
WP_152338498.1\|33124_33583_-	hypothetical protein	NA	NA	NA	NA
WP_152338427.1\|33575_34649_+	porin	NA	NA	NA	NA
WP_172977826.1\|34729_35776_+\|integrase	site-specific integrase	A0A076YL28	Mesorhizobium_phage	1.4e-31	38.2
WP_172977934.1\|36075_36213_-	hypothetical protein	NA	NA	NA	NA
WP_152338499.1\|36823_38041_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_152338500.1\|38055_41202_+	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	5.8e-44	21.3
WP_152338501.1\|41198_41810_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_052642687.1\|42008_42722_-\|transposase	IS6-like element ISRsp9 family transposase	A0A077SL39	Escherichia_phage	2.7e-18	34.9
WP_152338502.1\|42731_43931_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_077549194.1\|44957_45953_+	c-type cytochrome	NA	NA	NA	NA
WP_077549195.1\|45949_48496_+	cytochrome c oxidase subunit I	NA	NA	NA	NA
WP_077549196.1\|48503_48881_+	hypothetical protein	NA	NA	NA	NA
WP_077549197.1\|48912_50271_+	c-type cytochrome	NA	NA	NA	NA
WP_077549198.1\|50543_51290_+	peptidoglycan-binding protein	NA	NA	NA	NA
WP_152338503.1\|51408_53961_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.3e-131	38.3
WP_152338504.1\|54031_54538_+	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_077549200.1\|54757_56092_-	DUF882 domain-containing protein	NA	NA	NA	NA
WP_077549201.1\|56353_57472_-	cell wall hydrolase	A0A218MLD1	uncultured_virus	9.9e-23	44.3
WP_077549202.1\|58347_58944_+	hypothetical protein	NA	NA	NA	NA
WP_077549203.1\|59223_60555_+	Nramp family divalent metal transporter	NA	NA	NA	NA
WP_077549204.1\|60574_60991_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_172977935.1\|61029_61242_-	hypothetical protein	NA	NA	NA	NA
WP_139346330.1\|61808_62846_+	murein L,D-transpeptidase	NA	NA	NA	NA
WP_172977936.1\|62847_63015_+	hypothetical protein	NA	NA	NA	NA
WP_152338505.1\|63017_64112_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_077549206.1\|64325_65144_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
WP_077549208.1\|65815_66286_-	signal peptidase II	NA	NA	NA	NA
WP_077549209.1\|66503_67052_+	hypothetical protein	NA	NA	NA	NA
WP_139346331.1\|67414_67930_+	transglutaminase-like cysteine peptidase	NA	NA	NA	NA
WP_139346328.1\|67933_68890_-	cation diffusion facilitator family transporter	A0A1V0SED0	Indivirus	4.5e-08	27.7
WP_077549212.1\|68905_69562_-	DsbA family protein	NA	NA	NA	NA
69368:69384	attR	NA	NA	NA	NA
WP_077549213.1\|69558_69996_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_077549214.1\|70200_70821_+	SCO family protein	NA	NA	NA	NA
WP_077549215.1\|70960_71644_+	L,D-transpeptidase	NA	NA	NA	NA
WP_077549216.1\|71640_72378_+	DUF1624 domain-containing protein	NA	NA	NA	NA
WP_077549222.1\|72814_74575_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_172977937.1\|75204_75834_+	hypothetical protein	NA	NA	NA	NA
WP_077549218.1\|75982_76501_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_077549223.1\|77826_78681_+	hypothetical protein	A0A2K9V3V9	Faecalibacterium_phage	1.7e-19	29.8
WP_077549220.1\|79226_79532_+	hypothetical protein	NA	NA	NA	NA
WP_152338409.1\|79919_81116_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	4.7e-95	47.5
WP_052642687.1\|81727_82441_-\|transposase	IS6-like element ISRsp9 family transposase	A0A077SL39	Escherichia_phage	2.7e-18	34.9
WP_077546293.1\|82633_83023_+	MerR family DNA-binding protein	NA	NA	NA	NA
WP_077546312.1\|83811_84516_+	pyridine nucleotide-disulfide oxidoreductase	NA	NA	NA	NA
WP_077546291.1\|84528_85023_+	metal-binding protein	NA	NA	NA	NA
WP_077546290.1\|85155_85638_+	cytochrome c	NA	NA	NA	NA
WP_172977938.1\|85679_87023_+	HAD-IC family P-type ATPase	E4ZFI9	Streptococcus_phage	1.4e-44	34.9
WP_077546288.1\|87321_88146_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_152338506.1\|88584_88995_+\|transposase	transposase	A0A1B0YZU7	Pseudomonas_phage	3.4e-05	54.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LR723671

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_LR723673

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_LR723670

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_LR723672

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection