CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_LT630287	Lactobacillus acidipiscis strain ACA-DC 1533 chromosome I	2 crisprs	PrimPol,RT,csa3,DinG,cas3,DEDDh	0	0	17	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LT630287_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LT630287_1

695514-695621

Orphan

Consensus_repeat	Method
GAAGTAAGTCTCACATTTACGTTTGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LT630287_1

>merge|NZ_LT630287|1|695514-695621|CRISPRCasFinder
GAAGTAAGCTTTACATTTACGTTTGTAACACAAAGTAGATCGAAGTAAGTCTCACATTTACGTTTGTAACGCAAAGTAGGGCGAAGTAGGTCTTACATTCTCGTTTGT

>NZ_LT630287|1|1|695514-695621|CRISPRCasFinder
GAAGTAAGCTTTACATTTACGTTTGT	AACACAAAGTAGATCGAAGTAAGTCTCACATTTACGTTTGTAACGCAAAGTAGGGC
GAAGTAGGTCTTACATTCTCGTTTGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LT630287.1\|WP_079578812.1\|699937_701380_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|372253
NZ_LT630287.1\|WP_010497420.1\|685986_687012_+\|M48-family-metalloprotease	unknown	unknown	gnl\|CDD\|320699
NZ_LT630287.1\|WP_079578806.1\|682164_683673_+\|YfcC-family-protein	unknown	unknown	gnl\|CDD\|224207
NZ_LT630287.1\|WP_056972372.1\|680150_681887_-\|N-6-DNA-methylase	unknown	unknown	gnl\|CDD\|378996
NZ_LT630287.1\|WP_010497418.1\|685413_685971_+\|LemA-family-protein	unknown	unknown	gnl\|CDD\|377192
NZ_LT630287.1\|WP_010499134.1\|702979_703783_+\|deoxyribose-phosphate-aldolase	unknown	unknown	gnl\|CDD\|234784
NZ_LT630287.1\|WP_079578814.1\|705534_705822_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|185696
NZ_LT630287.1\|WP_079578588.1\|690152_691463_-\|IS1380-family-transposase	unknown	unknown	gnl\|CDD\|379340
NZ_LT630287.1\|WP_079578808.1\|697348_697861_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_LT630287.1\|WP_010499128.1\|693058_695290_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|350691
NZ_LT630287.1\|WP_079578752.1\|695966_696995_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_LT630287.1\|WP_010499958.1\|703972_705352_+\|transposase	unknown	unknown	gnl\|CDD\|379252
NZ_LT630287.1\|WP_010497414.1\|683685_684843_+\|ArgE/DapE-family-deacylase	unknown	unknown	gnl\|CDD\|181490
NZ_LT630287.1\|WP_056972017.1\|691684_692740_+\|DUF871-domain-containing-protein	unknown	unknown	gnl\|CDD\|377567
NZ_LT630287.1\|WP_154022008.1\|701451_701607_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LT630287.1\|WP_079578816.1\|705895_706774_+\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_LT630287.1\|WP_010499133.1\|701974_702838_+\|glycosyltransferase-family-8-protein	unknown	unknown	gnl\|CDD\|133037
NZ_LT630287.1\|WP_079578810.1\|699043_699937_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_LT630287.1\|WP_154022052.1\|688628_689813_+\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_LT630287.1\|WP_079578804.1\|678893_679898_+\|NERD-domain-containing-protein	unknown	unknown	gnl\|CDD\|377990

Protein	Function_ID	Function_description	E-value
NZ_LT630287.1\|WP_079578812.1\|699937_701380_+\|ABC-transporter-permease-subunit	gnl\|CDD\|372253	pfam12679, ABC2_membrane_2, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family.	4.33333e-06
NZ_LT630287.1\|WP_010497420.1\|685986_687012_+\|M48-family-metalloprotease	gnl\|CDD\|320699	cd07340, M48B_Htpx_like, Peptidase M48 subfamily B HtpX-like membrane-bound metallopeptidase. This HtpX family of peptidase M48 subfamily B includes uncharacterized HtpX homologs and consists of proteins smaller than Ste24p, with homology restricted to the C-terminal half of Ste24p. HtpX expression is controlled by the Cpx stress response system, which senses abnormal membrane proteins. HtpX participates in the proteolytic quality control of these misfolded proteins by undergoing self-degradation and collaborating with FtsH, a membrane-bound and ATP-dependent protease, to eliminate them. HtpX, a zinc metalloprotease with an active site motif HEXXH, has an FtsH-like topology, and is capable of introducing endoproteolytic cleavages into SecY (also an FtsH substrate). However, HtpX does not have an ATPase activity and will only act against cytoplasmic regions of a target membrane protein. Thus, HtpX and FtsH have overlapping and/or complementary functions, which are especially important at high temperature; in E. coli and Xylella fastidiosa, HtpX is heat-inducible, while in Streptococcus gordonii it is not.	2.57478e-102
NZ_LT630287.1\|WP_079578806.1\|682164_683673_+\|YfcC-family-protein	gnl\|CDD\|224207	COG1288, COG1288, Predicted membrane protein [Function unknown].	2.67458e-144
NZ_LT630287.1\|WP_056972372.1\|680150_681887_-\|N-6-DNA-methylase	gnl\|CDD\|378996	pfam12950, TaqI_C, TaqI-like C-terminal specificity domain. This domain is found at the C-terminus of the TaqI protein and is involved in DNA-binding and substrate recognition.	1.78916e-19
NZ_LT630287.1\|WP_010497418.1\|685413_685971_+\|LemA-family-protein	gnl\|CDD\|377192	pfam04011, LemA, LemA family. The members of this family are related to the LemA protein. LemA contains an amino terminal predicted transmembrane helix. It has been predicted that the small amino terminus is extracellular. The exact molecular function of this protein is uncertain.	3.87833e-75
NZ_LT630287.1\|WP_010499134.1\|702979_703783_+\|deoxyribose-phosphate-aldolase	gnl\|CDD\|234784	PRK00507, PRK00507, deoxyribose-phosphate aldolase; Provisional.	1.24287e-95
NZ_LT630287.1\|WP_079578814.1\|705534_705822_+\|hypothetical-protein	gnl\|CDD\|185696	cd09019, galactose_mutarotase_like, galactose mutarotase_like. Galactose mutarotase catalyzes the conversion of beta-D-galactose to alpha-D-galactose. Beta-D-galactose is produced by the degradation of lactose, a disaccharide composed of beta-D-glucose and beta-D-galactose. This epimerization reaction is the first step in the four-step Leloir pathway, which converts galactose into metabolically important glucose. This epimerization step is followed by the phosophorylation of alpha-D-galactose by galactokinase, an enzyme which can only act on the alpha anomer. A glutamate and a histidine residue of the galactose mutarotase have been shown to be critical for catalysis, the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen. Galactose mutarotase is a member of the aldose-1-epimerase superfamily.	0.000148979
NZ_LT630287.1\|WP_079578588.1\|690152_691463_-\|IS1380-family-transposase	gnl\|CDD\|379340	pfam13701, DDE_Tnp_1_4, Transposase DDE domain group 1. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	7.03905e-136
NZ_LT630287.1\|WP_079578808.1\|697348_697861_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.31885e-07
NZ_LT630287.1\|WP_010499128.1\|693058_695290_+\|AAA-family-ATPase	gnl\|CDD\|350691	cd17933, DEXSc_RecD-like, DEXS-box helicase domain of RecD and similar proteins. RecD is a member of the RecBCD (EC 3.1.11.5, Exonuclease V) complex. It is the alpha chain of the complex and functions as a 3'-5' helicase. The RecBCD enzyme is both a helicase that unwinds, or separates the strands of DNA, and a nuclease that makes single-stranded nicks in DNA. RecD is a member of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	1.18594e-22
NZ_LT630287.1\|WP_079578752.1\|695966_696995_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	2.9376e-74
NZ_LT630287.1\|WP_010499958.1\|703972_705352_+\|transposase	gnl\|CDD\|379252	pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.3066e-17
NZ_LT630287.1\|WP_010497414.1\|683685_684843_+\|ArgE/DapE-family-deacylase	gnl\|CDD\|181490	PRK08588, PRK08588, succinyl-diaminopimelate desuccinylase; Reviewed.	1.98631e-126
NZ_LT630287.1\|WP_056972017.1\|691684_692740_+\|DUF871-domain-containing-protein	gnl\|CDD\|377567	pfam05913, DUF871, Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.	2.02353e-127
NZ_LT630287.1\|WP_079578816.1\|705895_706774_+\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	5.95704e-16
NZ_LT630287.1\|WP_010499133.1\|701974_702838_+\|glycosyltransferase-family-8-protein	gnl\|CDD\|133037	cd04194, GT8_A4GalT_like, A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.	4.24755e-67
NZ_LT630287.1\|WP_079578810.1\|699043_699937_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.17706e-72
NZ_LT630287.1\|WP_154022052.1\|688628_689813_+\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	1.27885e-114
NZ_LT630287.1\|WP_079578804.1\|678893_679898_+\|NERD-domain-containing-protein	gnl\|CDD\|377990	pfam08378, NERD, Nuclease-related domain. The nuclease-related domain (NERD) is found in a range of bacterial as well as archaeal and plant proteins. It has distant similarity to endonucleases (hence its name) and its predicted secondary structure is helix - sheet - sheet - sheet - sheet - weak sheet/long loop - helix - sheet - sheet. The majority of NERD-containing proteins are single-domain, but in several cases proteins containing NERD have additional domains which in 75% of cases are involved in DNA processing.	2.48765e-10

>NZ_LT630287.1|WP_010499128.1|693058_695290_+|AAA-family-ATPase
MKKEEMEQTYQAAVEMIKDHRADDARPLLTRIYHQKDDYKSVSYYLGKACYRLKQYEDADRYLHLFLDLKKKTNHSQAYRLLARTAIGQKKPDEAKEYMEAAQQAGMPAQKLAGVKKAVTKLEEQLAAAEKKRQELRERGYAQMQFRFIKLAKNGTPIAETDSDKYRHSYFFINGMTVKKLHGFKDGEWHELDVTVPKTADFPGYYVVSLTDLRTYYKDIIPNLTELRYRSALNDWMEDDPFFEQRWEKSRVFSLLLLPLFDKEEIERLLIEYNLLDAKAQEHLQSCDDLIMLKTQGETLPLSQKRLIHNLDLLRDFGYICPDNCHNTLHLREKCEGERYLVEMLTEDHCHRHHLKATFGKFKPTVEQKKFISWLKKSDRRVDALLGVGGSGKTYTLGKIFNTSKVLALAPTHKARINLILNGFTKAQTIQKLGFDIDNGMDDSEIYKEYGDFDTVIIDEISMVTQDILVKLMKTLGHGVRYLFLGDDRQLPPVTNDTEALAVSGNVMELLKSQGHSFYFSDNIRCKDVRTRAFIAQCRAKKWDGHSDAPRYFHESLKEMLRYKKEHIDISECMILAFRNYNVAQINQAFFKVLAQDKQNVIPFEIENNKGRGGFFVGAQVVFYENGWAGKNYTNSEFGVVTAVSLPNNHSKGQIKVRTDLNEYELPLWKAKKDLLLAYAITIHKAQGSGADKVYVVETGNYGLAYTAVSRSKGKLSFVNMSEQQLLESLDKPATVKNNVYQY
>NZ_LT630287.1|WP_056972017.1|691684_692740_+|DUF871-domain-containing-protein
MFGFSVYLSAPITACTKNRVARLAKSGFEGVFTSLNLPEDDPSVLLQRLTDLGSECRGLRLELTVDISTVALERLGISLDKVNELTHIGVTQLRIDDGILMLSVAKLSQQMGIALNASTISKQDIELLKDSQANFNNLEACHNYYPRKNTGLEEKWFNQQNAWLKKNGFTVIAFAPGDSDLRGPVFATLPTLESGRYQHPLAAALNLLNNNVNKVYIGDADLQVETAAQFDSYFRFNTLLLHATTEIDLPEYLTAGDLVFHQRPDVARDAVRLREGRSLKEKTIKPANIKERVRGAITLDNKLARRYEGELQLIKRNLPADPTVNVLGYISQNDLDLLEACGANQAIQLVF
>NZ_LT630287.1|WP_079578588.1|690152_691463_-|IS1380-family-transposase
MSTLHHEKLLFNDQINISNDGGELANDAGTLLIAEFLHQIHFDQLLEDNLHFKDDRKYCTFPLNNLFKQLLLQLLAGYCQDQSANTLSHAVDFKLVLSQAVASQPTLSRFINHISASGLFSVKSLLGSVAHFVLGQLNQHQLILDLDSTHADTFGDQEKSAYNGHYQTNGYHPLLAFDALSGCLLNAQLRPGNRYTSQGATKFLLRSLRAYDGSSLDVLVRGDSGFAAPGIYHACDKKQAKFVIRLKANYQLQSRAENLIQVGDQDFTEAEVQWHVLRDYCPQSWSRPYRVIIKSTRPAGNFLFDHEFIVTNLEELSGPQVFALYHQRGSMEDLIKEVKRGFHFDKTDSSSFEANEFRMLVAGVAYNILQAMKNLVLPTKLKHAQVGTIRFKLLHVAAKVTHHARQIWVHLSQTNVFDKLFWQTLFKIQNLKIYPL
>NZ_LT630287.1|WP_154022052.1|688628_689813_+|IS256-family-transposase
MPHGSVYKNLTKTLLSNGDVKELFRQQLETAINHILQAELTALLGYDPYDRSGFNTGNSRNGQYYRLIDSEYGKLKIAVPRDRKGHFHNHLLPAYSRRQDALETTIIQLYSKGVTTREIADLIEKMYGSYYSPSTVSNITAQVTKQIEAFHQRTIKANYVCLFLDATYLPLRRDSVQREAVYIALGITSVGIKEVLDYRIAPSENTGVWSEMAEDLKKRGLEQVQLIIADGMVGLQPALLHAFPKAKFQRCLVHVMRNIGSHVRLKDREAILNDFKELHSATDVTAAHKILNDFYGAWGKSYSNLIQQLKSIENELLAFLSFPPAIRPTIYSTNILESLNKRIKRKTKPKEQFPNEKSLDNFIGVQVISYNEKYFNRSHRGFGQVKDTLESLFD
>NZ_LT630287.1|WP_010497420.1|685986_687012_+|M48-family-metalloprotease
MTIEEQIAKNKRNSTFVMIGFSSLVTVIGLFIGYLAGWMTSDDAGGIWTITLIVAGAFLVAALGYSLYIYYNTTSVFMGSVNGRKLEPENASLAEKQLLNVIDELQITAEIPLPEVYLVEDQEANAFATGRDPEHAAIGVNTGLLEMMNREELKSVLAHEMSHIKNYDIRSGSITVALTSFIAGAGYFLVELGEDTLWFGDSGRSNRKKDDDKSSAMIGLVMLIGGWLIQLIGVPIATLMQLALSRQRESLADISGVDMTQDPQGLIDALTKLKGDQVPSEYATSKAATLCFRTPLSKKDLQEMKDNDLEEPKKRKFNLTNLLDTHPPLDDRIEQLKKLIE
>NZ_LT630287.1|WP_010497418.1|685413_685971_+|LemA-family-protein
MVWIIIIVIVAIIAIYLWSSYNKLQRATNSINTAEKQIDIQLKYRADLIPNVVETVKGYATHEQETFTKLTEMRSKVADSSLDVNERSKADQQMSHTLGNLFAVAENYPDLKASTNFLNLQEQLTTIENKVAAARQMYNKHILFYNNAVTTFPSNLVAKMFNFSTKPNLEVITDEAQREAPQVKF
>NZ_LT630287.1|WP_010497414.1|683685_684843_+|ArgE/DapE-family-deacylase
MDKQRQIKLLQDLIKIETIDDHEKQVVDYLEKLFVSYGERVRFTRVPYQEDRQSVVISIGPQNGSFTLGFSGHMDVVNLGDRSAWKDDPFSGKLYDNDSKMYGRGTTDMKSGLAGMIGTFLTLLDENVVLKGELRLLATVGEETGMWGSKKLTEQGYVNDLDVLVIGEDTTNLNVVYASNGDIDYTITSYGKVEISSQAGAGINSLDNMLDFIQLANEKLRHLPKIHETLGPVVHNVTMISGGDQVNSIPGKITARGNIRINPLYSVAEIQRILENVVAQVNQMPQHKFELQYDYLGEAVDGDLQGEYVTTAKTMLTDILGHSVKIVGEPGATDASNFVKSPTAPTMIVVGPGNDSVHQIDEYVDVDEYLAAAEFYERFAKKYLS
>NZ_LT630287.1|WP_079578806.1|682164_683673_+|YfcC-family-protein
MSEKNKRRRFSMPSAFSILFLLIVAIEILTWIIPAGKYNIDQAGNVISHSYHSVANKPQGLWDVLMAPVIGMVGNAKTTGAISISLFILVIGGFLGVVNQTGALNDGIKVLVHKYSKQKKMLIPLLTVLFALGGSTFGMSEETMAFYPLLIPIMQAMGLDSLVAVAIPLVGTQVGNLASTVNPFATGVASQTLHISMGDGLISRLVLLALTLVFSIWYIYHYAAKIENDPTKSLLYANKDASELQSYEEEIEDIPKLSKGQKHVLWLFGLTFVIMIIGLVPWQTINPNWTFFETFLKWLRNVPFLGALIGKDTVAFGSWYFNEITMLFLGMSILIKFVYHIPEQKFVDYFMDGVKDFASVAIVVALARGIQVVMDAGMITDTVLHWGELALQGSNKIMYTLATYVFYLPMTFLIPSTSGLAAATMGIIGPMGHFAGVDSNIVVSIYQAASGLINMLTPTSAVVVGAMQIAHINISTWWKWAWKMALGLLLISCTYLVILAVL
>NZ_LT630287.1|WP_056972372.1|680150_681887_-|N-6-DNA-methylase
MKRTVSNATLANWQRLGSNNKKLLHRANKTDSLRKIFPDKYIINKDNKKQILDIADYIAENKLAPTRFICQLAVHEVTFSANICPANKTRFCQEALALVPNLAQLPDSKLFKVDLQEPDFLGALYQTLQAEGARNKNGLYYTPADVADKLLGQMSFSSDQDFFDPAVGTGIFLIELIKKFAIPVANLHGRDIDPIAVLLATANILLQAPANDDSYPDIKVGDYLKTPVVQKYTNIIGNPPWGAKKVTEAAFSKFKKADSFAYFIEKSLQTLNMNGSLAFVLPVSILNITRHQPIRQLILTKGLLKSITYLPKLFQGVVSDVVLLVLRKGEPANNTVTFINGPQQIELAQEAFKSLPHQNLLPVRSCDRKILQNVWHTAHADLSNSIWGLGIVTGNNHEFVLHEKTQGTEPLITGKEVQPFVLRQPQSYLEFQPAKFQQTAAESIYRSPEKLIYKFINNHLVFAYDNQKRLTLNSANILVPKVSTHSTKTVMAFLNSQLFQYLNQILFASPKVLRGNLEELPIAILSDKERKSLEKLVTRQLAGQDLRKEINKFIFAKYGLTQFQIERVKQVLAANIFE
>NZ_LT630287.1|WP_079578804.1|678893_679898_+|NERD-domain-containing-protein
MRKQTFEHQYLQVLAERTQLNANEKNNLQRLVQGYLGECNLDKIVDTFFNQSELVLNNLNLAYNKEVIQVDKLIVIGNIAYLIDVKNYRGSYTYQNNSWYRGERILINNIFRQIDRASDILQKIFSAKRLHMEIRRVLIFMDLAVKVEIKQPIVQTVLRVEEVAAWLMKLKEEVQLYPKLSPDLWRDAITDSLLPPYCPLNDFSSQVGRTLQLGICCPKCKKFTWTSHRYYLYCDHCGFCQSKELAYVKTICDYGVLFSNSNLERKELKKFLGEVGNEYYLRYQLKKHFELVGPNGSQKGYRNLGSKFEYWFENEQEYFKALQKRCNWKTNDKK
>NZ_LT630287.1|WP_079578752.1|695966_696995_+|IS30-family-transposase
MTQTKNIMPKHYQQLQSFERGQIESLTRLGFGVRQIASRLHRSPSTISRELKRGLTTQIDSQKHRSYQSYFAERGAAYYREQRAKCHPKGLLQRAAVFFKSLPKALKAKPRVFSVDTYVHYFKAHYPGFPCPSTATVYRYIEAGKLPELHNYDLPMKLRRRVKRPNHRHARLNKKRLGQSIEDRPAVVRKRQELGHWEGDLVKAKRVESEPALMTLTERVSRMEIIVKLPDYRAETCRQALQDTIDDYGAENFRTITFDNGSEFASLNQVQGTEIYFAHPYSPWERGTNENVNGQLREFFPKGHSFKNLSLVDLQLVQDTLNHRPRRCLSYSCPADVMPQLV
>NZ_LT630287.1|WP_079578808.1|697348_697861_-|TetR/AcrR-family-transcriptional-regulator
MDKFTVNELCKRAQVRRPTFYKHFNDKYDFIKFVIHTIQKETLQDIDSTADTKQPLDYLLTCFKKVIELLEKYQQVLLHFKIDSLDEFPFEIIDDYLEMQLEKKLTYFLEQNPQLPQDPDFTCQILLGMYRQIALWWMKNKKTTTKEEVTAKMKQFLLLLFPAKNNVDPF
>NZ_LT630287.1|WP_079578810.1|699043_699937_+|ABC-transporter-ATP-binding-protein
MACIEINNLTKDYGQDRGIFDISLSVDQGEVFGFAGINGAGKTTTIRNLMGFIKPDSGHATINGLDCTKKSAQVKQKVAYIPGEINFPGNDSGEVFLKRQMEMIGRGNWEHCKKICDKLQLDATANIKSMSKGMKQKTAIAAAFSAESDILIMDEPTTGLDPLMRDNFIELLAEQKKMGKTIFMSSHIFKEMEETCDRVALIKNGKIVDIVSMDDIRYNKNKRFKLEFKNDVSFKRFSELSYHCINIQPDDLQVTVEINDKDINELMNDLLQYDVLFFKEIKQTFEDYFNQTFKEEA
>NZ_LT630287.1|WP_079578812.1|699937_701380_+|ABC-transporter-permease-subunit
MFSKPIFKQSVRSNGALWLVITLVASALFSNFIIRFDPADFGALSSAAEGTAFGSVLSGFGTILGTLETFYKMIAIMLGLVYIIFSANNLVVNEVDSGSMAYTLSTPIRRSTVIFTKMAYMIGSIVLMFGILTGVGLGVSELAHHNVSGSPMTEDVEAAADAMDRKPSYVRKHLYMIKDDKYAMQAGAEARKMDKTAYGEYLDQAILRDSYKAAATKLTDNRQDKYSDSDKDKDEIEITEQELAKKPQLMMKDNDALEAGAKVTGQSVNGYRNSVNDQIKNSKNNQQKEALSKLAADPTVILSTATTAGAKAIHTSESNIKGNMSLLKDDKAIKAASKATKVPEGQLKALIDSSEVNAALKSDKSLEFDISTFVWLNVGACLLILGMGSISFFASTLFNRSNQAMVLGAGLPFAFFLISMVIQQSDSLENLKYFSLTTLYKTDEILSNGDFGIPLLILGGIAAVLYGMSAVIFYKKDLPL
>NZ_LT630287.1|WP_154022008.1|701451_701607_-|hypothetical-protein
MAKEKEREQSIHVNTSQETRKLLLNLSRRLDLSQAETIERALELLDQNNPQ
>NZ_LT630287.1|WP_010499133.1|701974_702838_+|glycosyltransferase-family-8-protein
MINIASTTDSDFADNLLTFYVSILEHNLDEPFHFYIIDDKLSKADRKYLSQLKDIYGNCKEITFLEGDFNYYKQANTDSPDSAIKENTYYRLELPELVDCDRILYLDSDMICKGSIVDLWNEALDGNVIGAVEDQGYVDRLEEMNVPHTKNVYFNGGLLLFDTKKWRQENITAKVRQYIADHPDNLIYQDQDALNAVLVGKWKILHPKYNVQSKLARHDFVNPDPEAEKLAVEARRDPLLIHFSGWSKPWVHVGKWVHPWRDEFYRYKLISTQRLREHAETLQNENK
>NZ_LT630287.1|WP_010499134.1|702979_703783_+|deoxyribose-phosphate-aldolase
MKYKLADFSQMIDHTNLYADVSFGDMVKLCNEAQQYHFKMVAINQTQTASCAKLLKGSEVHTGAAISFPLGQTTLRAKTFEVHDAIEKGADEIDYVVNLTAVKNGDFDYVKNEMQTIVQLCHDQGVLCKVIFENCYLTKDEIKKLALIAKDVKPDFIKTSTGFGSGGAKIVDVKLMKETVGDGVKVKAAGGIRNTDDFLAMIEAGADRIGTSSGVKIINALSKRFAQDHINSLELRADGKETPKVDVGTPDNHETESEYDLWSDLYE
>NZ_LT630287.1|WP_010499958.1|703972_705352_+|transposase
MSTSSIQQSTQNKTTLMARFHKFLQVIDFAQVLRQSNAYRVRGIKLTKLVSWILLTLFQRLTLNRSATPTAFSKKTVRNFLNDRHINWQRLVSLAGRNQIAELSPFIDLRRKAALIIDDTLFKRAHSKKTELLANVYDHAAPQGQPRYVKGFRGLTIGWSDGNTFLPLNFALMSSDKAKNRIGREPQTTDQRTLAAQRYAQAKRHMNEVAVELVAQVLKTGVKASYVLFDSWYAYPKAFKQFQELGLAAVGRLKNTSKTYFKYRGRRYSVPMLFQRFKGSKYRIHDNYLYSTVVETDNEDHLRLKIVFIQNRTDKGHYIALATSKLSLTPEAVIQLYARRWQIECGFKTLKQYLQYDQTQTQSYDGLCGHVALTFLAYDLLAMIQRQENDPKTLGGIFYAANQFLADIPLLQAVKQLLFALAEHCEKTADFFITGLCSRFINSLPNDLQEIFHSNELVS
>NZ_LT630287.1|WP_079578814.1|705534_705822_+|hypothetical-protein
MKKGSWVKAAVASAALCLGVIGAGQVSGCNSVSADDVENGQVNKFDNYKGHQVYEYTIQNKNGLKVSVLSQGGTLHGIYVPKGPKDKRNTCGASL
>NZ_LT630287.1|WP_079578816.1|705895_706774_+|IS982-family-transposase
MLNHLKFKQNRHELQVSFHYFYQLCSLLYQRYCPRSVIERRNVEHTKITDIKLLALLCLQVTLGIQSQRRFYYLMAAFMPRQMVVSRSRFNRRAQQLLAVVNAIRSGITKDYAHSGDLAIIDSLPNPLCAKVRNFRVRIFAGKANIGYNATKKMPFYGFKTHMVVTANGYILNYVITAASVHDAKVAPGLISGCPCPNILADVGYVGKKLKTSFRALGYNLWTPYRSNMKGAKQHNKRQLKALRRTIESRFSILAQQFGIETNLTRSLFGFQLKIELTILVYNLGFFDFMTN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_LT630287_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LT630287_2

2297861-2297969

Orphan

Consensus_repeat	Method
GATTTGTCCTTAATTGGCTAATACTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LT630287_2

>merge|NZ_LT630287|2|2297861-2297969|CRISPRCasFinder
GATTTGTCCTTAATTGGCTAATACTTCTACCAACTTCTAGCCGATTTATCTGAATTGGCTAATACTTCTACCGACTTCTAGCAGATTTGTCCTAATTGGCTAATACTTC

>NZ_LT630287|2|2|2297861-2297969|CRISPRCasFinder
GATTTGTCCTTAATTGGCTAATACTTC	TACCAACTTCTAGCCGATTTATCTGAATTGGCTAATACTTCTACCGACTTCTAGC
AGATTTGTCCTAATTGGCTAATACTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LT630287.1\|WP_010497658.1\|2302401_2302749_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT630287.1\|WP_010497640.1\|2294813_2295470_-\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	unknown	unknown	gnl\|CDD\|223692
NZ_LT630287.1\|WP_079579520.1\|2303554_2304019_-\|Rrf2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224870
NZ_LT630287.1\|WP_056971628.1\|2296908_2297481_-\|ECF-transporter-S-component	unknown	unknown	gnl\|CDD\|227065
NZ_LT630287.1\|WP_010497637.1\|2294093_2294663_-\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|370542
NZ_LT630287.1\|WP_010497670.1\|2304162_2305017_+\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187578
NZ_LT630287.1\|WP_010497642.1\|2295466_2296891_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213192
NZ_LT630287.1\|WP_010497619.1\|2286245_2287139_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NZ_LT630287.1\|WP_010497649.1\|2299513_2299780_-\|ACT-domain-containing-protein	unknown	unknown	gnl\|CDD\|178923
NZ_LT630287.1\|WP_010497652.1\|2301085_2301622_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_LT630287.1\|WP_010497654.1\|2301639_2302140_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT630287.1\|WP_010497621.1\|2287351_2287801_-\|VanZ-family-protein	unknown	unknown	gnl\|CDD\|377417
NZ_LT630287.1\|WP_079579519.1\|2302845_2303526_+\|type-1-glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|153212
NZ_LT630287.1\|WP_010497646.1\|2298148_2299492_-\|PFL-family-protein	unknown	unknown	gnl\|CDD\|180009
NZ_LT630287.1\|WP_010497656.1\|2302139_2302397_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT630287.1\|WP_079579518.1\|2289034_2290276_+\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|225995
NZ_LT630287.1\|WP_079579680.1\|2292232_2293618_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_LT630287.1\|WP_029605403.1\|2287902_2288871_-\|hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240632
NZ_LT630287.1\|WP_148266355.1\|2299797_2300922_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NZ_LT630287.1\|WP_010497629.1\|2290547_2291057_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_LT630287.1\|WP_010497640.1\|2294813_2295470_-\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	gnl\|CDD\|223692	COG0619, CbiQ, ABC-type cobalt transport system, permease component CbiQ and related transporters [Inorganic ion transport and metabolism].	5.00911e-10
NZ_LT630287.1\|WP_010497670.1\|2304162_2305017_+\|NAD(P)H-binding-protein	gnl\|CDD\|187578	cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs. TMR is an atypical NADP-binding protein of the SDR family. It lacks the active site residues of the SDRs but has a glycine rich NAD(P)-binding motif that matches the extended SDRs. Proteins in this subgroup however, are more similar in length to the classical SDRs. TMR was identified as a reducer of triphenylmethane dyes, important environmental pollutants. This subgroup also includes Escherichia coli NADPH-dependent quinine oxidoreductase (QOR2), which catalyzes two-electron reduction of quinone; but is unlikely to play a major role in protecting against quinone cytotoxicity. Atypical SDRs are distinct from classical SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.20539e-67
NZ_LT630287.1\|WP_056971628.1\|2296908_2297481_-\|ECF-transporter-S-component	gnl\|CDD\|227065	COG4721, COG4721, ABC-type cobalt transport system, predicted permease component [Inorganic ion transport and metabolism].	1.65288e-40
NZ_LT630287.1\|WP_010497637.1\|2294093_2294663_-\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|370542	pfam09515, Thia_YuaJ, Thiamine transporter protein (Thia_YuaJ). Members of this protein family have been assigned as thiamine transporters by a phylogenetic analysis of families of genes regulated by the THI element, a broadly conserved RNA secondary structure element through which thiamine pyrophosphate (TPP) levels can regulate transcription of many genes related to thiamine transport, salvage, and de novo biosynthesis. Species with this protein always lack the ThiBPQ ABC transporter. In some species (e.g. Streptococcus mutans and Streptococcus pyogenes), yuaJ is the only THI-regulated gene. Evidence from Bacillus cereus indicates thiamine uptake is coupled to proton translocation.	2.30032e-57
NZ_LT630287.1\|WP_010497642.1\|2295466_2296891_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213192	cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system. Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.	9.53235e-71
NZ_LT630287.1\|WP_010497619.1\|2286245_2287139_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	1.00862e-162
NZ_LT630287.1\|WP_010497649.1\|2299513_2299780_-\|ACT-domain-containing-protein	gnl\|CDD\|178923	PRK00194, PRK00194, ACT domain-containing protein.	7.14738e-43
NZ_LT630287.1\|WP_010497652.1\|2301085_2301622_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	5.27136e-21
NZ_LT630287.1\|WP_010497621.1\|2287351_2287801_-\|VanZ-family-protein	gnl\|CDD\|377417	pfam04892, VanZ, VanZ like family. This family contains several examples of the VanZ protein, but also contains examples of phosphotransbutyrylases.	2.10449e-08
NZ_LT630287.1\|WP_079579519.1\|2302845_2303526_+\|type-1-glutamine-amidotransferase	gnl\|CDD\|153212	cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase.	2.09218e-56
NZ_LT630287.1\|WP_010497646.1\|2298148_2299492_-\|PFL-family-protein	gnl\|CDD\|180009	PRK05313, PRK05313, hypothetical protein; Provisional.	0
NZ_LT630287.1\|WP_079579520.1\|2303554_2304019_-\|Rrf2-family-transcriptional-regulator	gnl\|CDD\|224870	COG1959, COG1959, Predicted transcriptional regulator [Transcription].	3.02114e-23
NZ_LT630287.1\|WP_079579518.1\|2289034_2290276_+\|ISL3-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.07252e-52
NZ_LT630287.1\|WP_079579680.1\|2292232_2293618_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	3.49791e-176
NZ_LT630287.1\|WP_029605403.1\|2287902_2288871_-\|hydroxyacid-dehydrogenase	gnl\|CDD\|240632	cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2-hydroxyacid dehydrogenase family. Phosphoglycerate Dehydrogenase (PGDH) catalyzes the NAD-dependent conversion of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first step in serine biosynthesis. Over-expression of PGDH has been implicated as supporting proliferation of certain breast cancers, while PGDH deficiency is linked to defects in mammalian central nervous system development. PGDH is a member of the 2-hydroxyacid dehydrogenase family, enzymes that catalyze the conversion of a wide variety of D-2-hydroxy acids to their corresponding keto acids. The general mechanism is (R)-lactate + acceptor to pyruvate + reduced acceptor. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-Adenosylhomocysteine Hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann-fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	4.124e-125
NZ_LT630287.1\|WP_148266355.1\|2299797_2300922_-\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.36944e-48

>NZ_LT630287.1|WP_056971628.1|2296908_2297481_-|ECF-transporter-S-component
MHEQKSNAWHLRDVILLTLTAILTGVIYFGVVFLYNGLTALLTPLGLAPFGNDLILGLWTMAAPLAACLLQKVGSATIGEILASAVEAILGGQWGISTLISGFVQGFGSELGFTFTAYKRYDMFSLSLSALTTTIVTFTWDLFREGYAAYHGWMIIALFFTRLLSIWLFGALLVHAVVSLLERSHMLRAE
>NZ_LT630287.1|WP_010497642.1|2295466_2296891_-|ABC-transporter-ATP-binding-protein
MSYIDITDLTFSYTKQGPLVLENQQLSFQQATFNVLTGPSGSGKSTLLRLLCGLFPQYTGHLQNGQILLDGEDIAGMDISKRAQKIAMLFQVPAEQFAMPTPRQELIFTLENMRIAPEQMDQRITQAFDFTGISEFADREFSSLSGGEQQKVALAIILALDADTILLDEPFANVDPEARNFLLRRLKQLVSNRGKTVIIADHDLSDYQQLADYLYVMEPTQKQIHLATEAEMQQRFLSFEQNRHQQISISLPAQTDTAEFKLRDFSTGHQKVLLKQANFELMKHHLTVFTGPNGVGKSTLFNSLTKLQDYQGSLTWENNEIAKLKVKDYSRHVALVFQEPISQFLKVTVAEELELSLHNQYDHAWTKERVRDTLADLGLTGFDDHVVYMLSEGQKRKLQILLMLIMGVPTLLLDEPLTGLDLVSVHKIMQLLQQAVRNEDKTVIMISHQLTDVADYADYHISLHEKELSYEASL
>NZ_LT630287.1|WP_010497640.1|2294813_2295470_-|energy-coupling-factor-transporter-transmembrane-protein-EcfT
MNPTVLLVIVLICGVELSFTRVIAANVLVILVGLVIMLFRRANWRSYLRLFLLPLLPALGVWFSLAYFSVGHDIHFAWVLATRIYAYSFLGAIFTFSTTISETLASLEQNAHIPTTFVYGMLAALNFVPKIRSEVQKIKVSAQMRGITLHFWSPQLLFKGISAALNWSENLAEAMTSHGFAENQPRTHYSVIQIPWWNYLVSILVLAIFQMFIFTGLP
>NZ_LT630287.1|WP_010497637.1|2294093_2294663_-|energy-coupled-thiamine-transporter-ThiT
MSRSRNNTRLLTETAIMSALSIVLSYIVIFRMPQGGSVSLVLLPLIFLSLRRGPIWGCTAGAICGVVQLMFGGYFLNLLQVLFDYVFCFGTVGFAGFFAKPLQGALREKKQGQIFGYTLAASFLGGFMAYLNNVISGIVFYGEYTPKGQSVFAYSTIYNATYMVPEALAAMIIVWLLAARAPKLFIPEK
>NZ_LT630287.1|WP_079579680.1|2292232_2293618_-|group-II-intron-reverse-transcriptase/maturase
MRQSQKTENKADYLRRVTLEGSEQTGARSVVSGEKRTQNGLLREKVLDRNNLNRAFVHVKRNKGAGGIDGMSVEELGPYLKENNVKLIEALRTESYEPQPVKRVEIPKPDGSKRQLGIPTVVDRVVQQALQQQLSPIFEKVFSDNSYGFRPHRSAQSAVKKVVAYYNQGYHYVVDLDLKSYFDNVNHDLLIKFVENYISEPWVLHLIRKFLTSGVMNGRFFEKSAKGTPQGGNISPLLANIYLNELDKELTRRGHKFVRYADDCNIYVKSKRAGERVLKSITQFLEKELKVEVNAEKTQVGSPLRLKFLGFSLGVGRKGAYLRPHQKSKQRVKQELKRITRRNRGVSLDKILKEIKQKMQGWVQYYSIGKMSSFLRNLDAWLRSRIRQYIWKQWKNIGTRFKALVKLGMSHKQAKTYANTRKGYWRNAHSKTLLMTITNKRLAQRGLINLSKLYQSIQAKA
>NZ_LT630287.1|WP_010497629.1|2290547_2291057_-|hypothetical-protein
MNVEKISLALGPEDVLRAKQHKYSDRDLKLLKSVTDEDKFMLLDKSNKKTVFGSGLNYVTQHEIGKENWEGYFEFRYFTLKTDQNKLLESLMQKWENGYEVPVGLRYSLVLHVPRKNLQYLMINVWDSDIDFFDWNTSAKNELNQFGYNENSEPYISHFVIAPEKKEKQ
>NZ_LT630287.1|WP_079579518.1|2289034_2290276_+|ISL3-family-transposase
MMSQTDSILNLLNIQDPNIKISACTDFSQAGVHEKLLSATLTYPVERCVNCGSTNIVQNGTRLTKMRLPSLGEQPLRMNLRKQRYLCRTCHHTFSAQTQLAPPRHSITRQAVHEIATLAKNSLPVKTISQTVGISASSVQRILYKDQRALVTPKELPTALSFDEFRSTKNCFSFICIDAKTHDLVTLLPDCLSQTIREYFTNTYTLSERQKVQLVTMDLNAQYQTFVRRLFPNALIVFDRFHIVQLAGRALDHERLRVLKGINDHHDRNYKVLKSNWRLFHLAENQLETSQVKYYRGLNEYTTAQNVVDLGLKNFPQFAENYQTYQTILTFIRNRDRATLQQLVMNYRPNGTEMDTVMRTIQKNYLGIRNACLYDYSNGPLEGINRKIKELKRSCYGFSNLRHFFIRIKLIHA
>NZ_LT630287.1|WP_029605403.1|2287902_2288871_-|hydroxyacid-dehydrogenase
MMKVLILGGALNHEGADSAFAKLTSQTDDDFILNRDDLTDEELAEVEVILGSAPGVLERIFSLPSSNLKWIQAFSAGVDYYPLEQLAKRKILLSNVSGIHAEPIAETVFGLILGQLRGIKAAVENQQHSNWDPDSSHYMILSGKKLAVFGTGHIGTRVAELGRAFKMETIGVNHSGHRATGFEQTEAINELGPAVLNADVIVNTLPLTRKTHSLYDSAFFAKLTAAPLFISIGRGPSVVTEDLIKALNDGQVGAAGLDVTDPEPLPSDSPLWHMKNVTITPHVSGLYQEYVRDVVHIFKENLYQYKKNGTLARNEVDMKKGY
>NZ_LT630287.1|WP_010497621.1|2287351_2287801_-|VanZ-family-protein
MNLSKKVVRSFIWLAFIVYLVTVAILCFAPTLPLAIPKSNPAPYIYLGKAPFIYLPFAELLHMDFYLNILMTFPFGVFIALLQKRPSGSARIIWSGVAVGLFIEITQLILDNLGITERWIDVNDVLANGIGLCLGYLLMFWILQKMVGR
>NZ_LT630287.1|WP_010497619.1|2286245_2287139_-|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MKVRKAVIPAAGLGTRFLPATKAMPKEMLPIIDRPTIEFIVKEATDSGIEDILIVTGKGKQPIENHFDSNPELEANLKEKGKSHLLKLVQETTNINLFFIRQPHPNGLGDAVLRARDFIDNEPFVVMLGDDLMKDKVPLTKQLIDRCDKTHASTLAVIRVPRAKTKDYGIIEPISELDQGLYDVKSFVEKPAPKDAPSELAIIGRYLLTPEIFDLLETQKPGKDHEIQLTDAIDRLNATQRVFAHEFTGERFDVGNKFGYLKTAIQFGLENPEIKDDLTKYLKEVGQKLETKPQQKK
>NZ_LT630287.1|WP_010497646.1|2298148_2299492_-|PFL-family-protein
METEKIMETVNMITNENLDVRTITMSISLLDCIDSDSDTACRKIYNKITTKARDLVKVGQQIEAEYGIPITNKRVTVTPIAIVAAASHDKDYVKYAKTLDRAAHTIGIDFIGGYSALVQKGFQQGDHTLLNSLPEALAETELVCASVNVGSTRSGINMDAVAQMGEVIVDASKRDVMTNAKMVVFCNAVEDNPFMAGGFQGISEPDVVINVGVSGPGVVKAALEKVKGQSMDVVAETIKKTAFKVTRMGQLVGTLAAQKLHTQFGIVDLSLAPTPAVGDSVAQILEEIGLESVGTHGTTAALALLNDAVKKGGIMACSHVGGLSGAFIPVSEDAGMIDAVTAGHLNIDKLEAMTAVCSVGLDMIAIPGDTPATTISAMIADEAAIGMINNKTTAVRVIPVPGKDVGDFVEFGGLLGHAPVMSVNQASSAEMIQRGGTIPAPIHSFKN
>NZ_LT630287.1|WP_010497649.1|2299513_2299780_-|ACT-domain-containing-protein
MRAILTTIGQDKVGIIAGVSQYLAEHAINILDVSQTIMEGNFTMMMLVDLPQETDFQSLTAKLNELGTKLGVEINIRNEEIYRAMHQL
>NZ_LT630287.1|WP_148266355.1|2299797_2300922_-|MFS-transporter
MLVNMGIGLIMPITTLYVHNSLHKSLVVAGYVLLGFSGAMTLGSLLGGRLFDNWHQKKTMYLGGTIQVIALLLLTVFPVWPLYPFLLVLYGLGLGILNSAVNGYLAFLQKDDPNIFNNGYWLANIGMALATLLSGLLFDISIRLIFGGSALLFFMTLLLIRVKFRDFSVEKHSGRPLAVSQKSNRANVWGITLVCVTMIVIWICYEQWNSNVSVLMTGQGISVARYSMLFTISTLEIVVMQPFITRLFPNTFRADKLRVILGVLVFACSYLTLVGADVYWQFVLGITFVSLGEILALTAIPMLLNRYAQDNDRGTIQSLGSLSGSLGRALGPLSGGWLITALGYSKTFLVFFVVHLVMAVILLGVHAPSKRINE
>NZ_LT630287.1|WP_010497652.1|2301085_2301622_+|GNAT-family-N-acetyltransferase
MFTYQIDDELSLALPRPQIDAQPLFELVEKSRPDLATWLPWVPEMKSVADEEKFLTTVLEHFGNSTSVNLIIRYHDQPVGMISFNRFLQMDQSTEIGYWLATKFSGNNIMHRAVLAMCHLGFADYAVNKIEIHAATDNPRSNHVAQKAGFHLNGTIRASELLADGFHDGNLWTMLKDE
>NZ_LT630287.1|WP_010497654.1|2301639_2302140_+|hypothetical-protein
MLNLTVKIEENNTQITIPAHQLQLMITSDCAVANLKEDGLCLIFDDRKLVTITTLPLSKTKKSQTMIIISMNDNTLKLDHLKFGLVKLAGKNEKAPQIPVEFEAAVKKKVQVIALILAQFGYKLKSPTPKKLANHVTNGLKKFPRSPFTLTIMVRPPQSFGKNVQK
>NZ_LT630287.1|WP_010497656.1|2302139_2302397_+|hypothetical-protein
MIKSGAKLQTEIPLNKDGSVGFSARFAQKLRIEHENEITGKQTVADIVLKSPNEVGLFLYFGGTNSWLQLKDKDGRTLDSWSKVE
>NZ_LT630287.1|WP_010497658.1|2302401_2302749_+|hypothetical-protein
MKIKTTAFLSVGVILALSAALFVYSGSYISYELNDQINTMLEKQDHTKLTKLAANKKTANLLTNLSPKTKCSNTSDPQGGTRNKLAFATNLHQKTIGVDMKKIGILRWKVAQIYQ
>NZ_LT630287.1|WP_079579519.1|2302845_2303526_+|type-1-glutamine-amidotransferase
MRINILQHTPNEGPGSILDWAQLHGHQTYIYHPYQFGYLPQASETDMLVILGGPMSPNDDLTWIKEERHLIQQLLNNDTPMFGACYGAQQITKTLGYPVIKAPAKEVGWAPVYLQANVISGIPEKLTALHWHEEMFEIPAQAQLLFSSSHLKNQVFVMNHRIVGLQFHFEPQSDNVREMVVNDFPYIKGTVLQQTAADILNTPVPAENKNVMFKILDYIMEGASLE
>NZ_LT630287.1|WP_079579520.1|2303554_2304019_-|Rrf2-family-transcriptional-regulator
MKNSIQFSDTVHIISYIAIFQNTDRLSSKDIAESVQTNPTNVRKIMGNLRNAGLIKTTNGRAQPAVAKDVNEISFYDIYQSLDNKELFQVDTNTEPKCVVGGNIQEILQDDYALLQTTVEEKMKQISLGTVLHQLATIEVKKKRGNQDIVAKFL
>NZ_LT630287.1|WP_010497670.1|2304162_2305017_+|NAD(P)H-binding-protein
MSILVTGATGGFGTYALAALKKLVPQDEIFALARSEEKAAQLRENGFSVKIATYDDPTSLEQAFHGIDRLLFVSSSEIGRQPQHKNVIDAAQKTGISYIAYTSFGKADTSTSPLAQDHAYTEKLILESGIDHTFLRNNWYLENEGGVITSALKTGKFIHAGGEGKAGWGLKREFAELAARAVSGKFDFPSILEVGGPLLTYQQLAEALEKVSGKKFDFITTDADTVSQFLQDNADLPKDAADFTASSQEIVKSGSLAVEPDDMEKYLGKPLSSTQDALKELFIK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

62718 : 193129

108

Streptococcus_phage(18.52%)

transposase,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004271276.1\|62718_63642_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.2e-31	30.9
WP_010495536.1\|63775_64831_+	hypothetical protein	NA	NA	NA	NA
WP_154021994.1\|64925_65576_-	hypothetical protein	NA	NA	NA	NA
WP_079578337.1\|65669_66392_-	hypothetical protein	A0A2K9R7J3	Dishui_lake_phycodnavirus	2.4e-06	42.4
WP_172823811.1\|67980_70056_-	DEAD/DEAH box helicase family protein	A0A1V0SLK0	Klosneuvirus	4.0e-17	30.9
WP_079578340.1\|70337_71402_+	2,3-butanediol dehydrogenase	NA	NA	NA	NA
WP_010495527.1\|71645_72542_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010495525.1\|72886_74266_+	class II fumarate hydratase	NA	NA	NA	NA
WP_079578342.1\|74562_75960_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	5.9e-57	32.3
WP_010495522.1\|76239_77661_+	anion permease	NA	NA	NA	NA
WP_010495519.1\|78067_78934_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010495517.1\|79033_80527_+	FAD-binding protein	NA	NA	NA	NA
WP_010495514.1\|80545_81280_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_056971218.1\|81294_82743_+	FAD-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	4.7e-25	25.8
WP_010495509.1\|84545_85397_+	aldo/keto reductase	NA	NA	NA	NA
WP_079578345.1\|85688_86708_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_010495505.1\|87236_88343_+	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_010495502.1\|88436_89870_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_010495501.1\|89979_90918_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_079578347.1\|91151_91505_-	FAD-binding protein	NA	NA	NA	NA
WP_172823812.1\|91480_92014_-	FAD-binding protein	NA	NA	NA	NA
WP_010495498.1\|92033_92237_-	hypothetical protein	NA	NA	NA	NA
WP_010495497.1\|92303_92528_-	FAD-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	3.2e-05	46.4
WP_010495495.1\|92706_93564_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_079578349.1\|93692_94226_-	hypothetical protein	NA	NA	NA	NA
WP_010495493.1\|94800_95505_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_079578350.1\|95509_96277_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-29	37.1
WP_010495491.1\|96310_97123_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_079578352.1\|97438_99376_+	hypothetical protein	NA	NA	NA	NA
WP_010495489.1\|99368_100193_+	NEAT domain-containing protein	NA	NA	NA	NA
WP_010495488.1\|100176_101067_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010495486.1\|101047_101962_+	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_010495484.1\|101951_102593_+	ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	2.5e-10	32.6
WP_079578354.1\|102666_103902_-	cytosine deaminase	NA	NA	NA	NA
WP_079578356.1\|104203_105238_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_079579634.1\|105466_106816_+	sugar porter family MFS transporter	NA	NA	NA	NA
WP_079578358.1\|106984_107539_+	DoxX family membrane protein	NA	NA	NA	NA
WP_079578360.1\|107741_108950_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_079579635.1\|110522_111908_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.3e-29	30.0
WP_010495474.1\|112552_113452_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010495471.1\|113743_114925_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_079578362.1\|114970_116128_+	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_010495467.1\|116117_116969_+	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
WP_029605048.1\|116999_117785_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_056988147.1\|117987_119319_+	acetyl-CoA hydrolase/transferase family protein	NA	NA	NA	NA
WP_079578364.1\|120243_121176_+	AEC family transporter	NA	NA	NA	NA
WP_056972542.1\|121269_121566_+	hypothetical protein	NA	NA	NA	NA
WP_010495451.1\|121773_123069_+	adenylosuccinate synthase	G5CQQ4	Megavirus	2.3e-63	34.3
WP_079579636.1\|123711_125097_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.4e-29	30.3
WP_056988178.1\|125165_126473_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.8e-47	33.2
WP_010495442.1\|127497_129750_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	2.3e-172	41.6
WP_010495440.1\|129794_130658_+	pyruvate formate lyase-activating protein	M4MAG2	Vibrio_phage	6.9e-08	43.5
WP_079578367.1\|130909_132151_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.7e-13	24.2
WP_079578369.1\|132289_133573_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.1e-48	31.7
WP_079578371.1\|133765_134830_-	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_056988164.1\|136530_138273_+	histidine kinase	Q9EYF3	Enterobacteria_phage	3.1e-55	29.7
WP_010495426.1\|138272_139022_+	LytTR family transcriptional regulator DNA-binding domain-containing protein	NA	NA	NA	NA
WP_035630965.1\|139181_139640_+	CidA/LrgA family protein	NA	NA	NA	NA
WP_010495424.1\|139636_140362_+\|holin	antiholin-like protein LrgB	NA	NA	NA	NA
WP_010495423.1\|140549_141518_+	2-hydroxyacid dehydrogenase	Q89388	Paramecium_bursaria_Chlorella_virus	7.0e-25	29.2
WP_010495422.1\|141582_141846_+	hypothetical protein	NA	NA	NA	NA
WP_003561820.1\|141937_142816_-\|transposase	IS982-like element ISLpl4 family transposase	NA	NA	NA	NA
WP_050955714.1\|142947_143739_+	adenine deaminase	NA	NA	NA	NA
WP_079578375.1\|143699_143960_+	hypothetical protein	NA	NA	NA	NA
WP_035630963.1\|144161_145088_+	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_056972047.1\|145140_145410_+	30S ribosomal protein S14	NA	NA	NA	NA
WP_010495410.1\|146011_146920_+	cysteine synthase family protein	A0A1X9I5F1	Streptococcus_phage	2.8e-60	42.1
WP_010495408.1\|146965_148144_+	PLP-dependent transferase	NA	NA	NA	NA
WP_010495407.1\|148115_148679_+	serine acetyltransferase	NA	NA	NA	NA
WP_079578379.1\|148864_149377_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_079578381.1\|149485_149935_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_010495400.1\|149950_150694_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_079578384.1\|150985_152221_+	NupC/NupG family nucleoside CNT transporter	NA	NA	NA	NA
WP_079578386.1\|152227_153505_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	6.4e-34	27.4
WP_158308956.1\|153673_154090_-	EAL domain-containing protein	NA	NA	NA	NA
WP_079578391.1\|154086_154332_-	hypothetical protein	NA	NA	NA	NA
WP_172823813.1\|154514_155891_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_050955713.1\|156293_157073_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.7e-11	27.1
WP_079579637.1\|157220_158432_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_154021995.1\|158516_159635_+\|transposase	transposase	NA	NA	NA	NA
WP_154021996.1\|159625_159895_+	hypothetical protein	NA	NA	NA	NA
WP_029605027.1\|160555_162199_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010495370.1\|162272_163010_-	peroxide stress protein YaaA	NA	NA	NA	NA
WP_154021997.1\|163206_163371_+	hypothetical protein	NA	NA	NA	NA
WP_010495368.1\|163491_163890_+	VOC family protein	V5UQY3	Oenococcus_phage	2.1e-39	60.6
WP_029605025.1\|164197_165178_+	YhdH/YhfP family quinone oxidoreductase	NA	NA	NA	NA
WP_148266326.1\|165234_166080_-	YitT family protein	M1Q1P6	Streptococcus_phage	1.3e-51	40.0
WP_079578395.1\|166529_167981_-	APC family permease	NA	NA	NA	NA
WP_010495360.1\|168349_170473_+	putative ornithine decarboxylase	NA	NA	NA	NA
WP_154021998.1\|170731_170872_+	hypothetical protein	NA	NA	NA	NA
WP_172823814.1\|170849_171110_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_079578399.1\|171363_171612_+\|transposase	transposase	NA	NA	NA	NA
WP_079578402.1\|172083_172512_-	YjdF family protein	NA	NA	NA	NA
WP_079578404.1\|173618_174929_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.3e-90	42.1
WP_079578407.1\|175873_176611_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	1.1e-51	45.1
WP_079578409.1\|178351_178993_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_079578411.1\|179014_180178_-	ABC transporter permease	NA	NA	NA	NA
WP_079578413.1\|180155_180896_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.5e-27	32.2
WP_010495344.1\|181599_182595_+	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_056988049.1\|182686_183274_+	dihydroxyacetone kinase subunit L	NA	NA	NA	NA
WP_010495341.1\|183270_183639_+	PTS-dependent dihydroxyacetone kinase phosphotransferase subunit DhaM	NA	NA	NA	NA
WP_079578415.1\|184165_185668_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_056971608.1\|185812_187648_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_029605023.1\|187918_188629_+	MIP family channel protein	M1I3H2	Acanthocystis_turfacea_Chlorella_virus	5.3e-22	34.2
WP_010495333.1\|188846_189551_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010495332.1\|189675_191031_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_056988050.1\|191205_191640_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_010499958.1\|191749_193129_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

206777 : 278619

Mycobacterium_phage(20.0%)

transposase,integrase

attL 198707:198727|attR 253560:253580

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
198707:198727	attL	NA	NA	NA	NA
WP_079578423.1\|206777_208019_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.6e-13	24.2
WP_079578425.1\|209199_210024_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_079578427.1\|210141_210828_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_079578429.1\|210981_212151_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_010495284.1\|212165_213173_+	D-2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	1.6e-40	34.9
WP_010495282.1\|213371_214187_-	ZIP family metal transporter	NA	NA	NA	NA
WP_010495275.1\|214588_215209_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_010495273.1\|215327_215816_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010495271.1\|215877_216714_+	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_010495269.1\|217274_217403_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010495267.1\|217399_218065_-	hypothetical protein	NA	NA	NA	NA
WP_154022049.1\|218099_218666_-	ECF transporter S component	NA	NA	NA	NA
WP_010495264.1\|218655_219519_-	pyridoxamine kinase	NA	NA	NA	NA
WP_010495262.1\|219781_220495_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.9e-42	39.6
WP_079578431.1\|220622_222500_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	1.5e-34	34.5
WP_079578433.1\|222483_223806_+	hypothetical protein	NA	NA	NA	NA
WP_010495257.1\|223824_224619_+	two-component system regulatory protein YycI	NA	NA	NA	NA
WP_056972566.1\|225010_225391_-	DUF1634 domain-containing protein	NA	NA	NA	NA
WP_079578435.1\|225387_226236_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_079578437.1\|226450_227266_+	MBL fold metallo-hydrolase	A0A2I7SDH3	Paenibacillus_phage	5.0e-32	37.0
WP_079578439.1\|227403_228723_+	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	3.2e-20	29.1
WP_010500073.1\|228924_229884_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_079578441.1\|230435_230915_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_079578444.1\|231016_232549_+	SAM-dependent DNA methyltransferase	A0A2H4PQP4	Staphylococcus_phage	5.0e-49	29.2
WP_079578446.1\|232538_233105_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_079579638.1\|233101_233683_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_079578448.1\|233813_234788_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAA2	uncultured_Caudovirales_phage	2.4e-33	29.7
WP_079578450.1\|234794_235847_+	restriction endonuclease subunit S	A0A240FAT6	Liberibacter_phage	4.2e-15	34.2
WP_079578369.1\|238451_239735_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.1e-48	31.7
WP_079578452.1\|239892_240525_+	DUF3387 domain-containing protein	NA	NA	NA	NA
WP_010495219.1\|240606_240954_+	DUF1516 family protein	NA	NA	NA	NA
WP_010495216.1\|241009_241804_-	hypothetical protein	NA	NA	NA	NA
WP_010495213.1\|241981_242518_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010495212.1\|242790_244146_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_079578454.1\|244409_245969_+	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
WP_079578456.1\|246056_247241_+	AAA family ATPase	NA	NA	NA	NA
WP_079578458.1\|247380_249570_+	hypothetical protein	NA	NA	NA	NA
WP_079578460.1\|249587_250322_+	hypothetical protein	NA	NA	NA	NA
WP_010495204.1\|250460_250739_+	hypothetical protein	NA	NA	NA	NA
WP_079578462.1\|251027_251576_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_010495192.1\|251731_252322_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_079578464.1\|252562_253507_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_154022050.1\|255530_256895_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
253560:253580	attR	NA	NA	NA	NA
WP_079578470.1\|257287_259126_-	pyruvate oxidase	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	4.1e-26	26.1
WP_079578472.1\|261564_263007_+	amino acid permease	NA	NA	NA	NA
WP_079578474.1\|263019_264387_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	3.6e-19	25.2
WP_056972612.1\|264567_264783_+	hypothetical protein	NA	NA	NA	NA
WP_079578476.1\|264972_265917_+	nucleoside hydrolase	NA	NA	NA	NA
WP_079578478.1\|266606_267800_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.1e-30	38.5
WP_079578480.1\|267799_268642_+	proline/glycine betaine ABC transporter permease	NA	NA	NA	NA
WP_148266381.1\|268651_269563_+	glycine/betaine ABC transporter	NA	NA	NA	NA
WP_079578482.1\|269927_271169_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.3e-12	23.2
WP_079578484.1\|271543_272707_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_079578423.1\|275936_277178_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.6e-13	24.2
WP_079578486.1\|277440_278619_-\|transposase	IS256 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

283817 : 352452

Lactobacillus_phage(30.77%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172823854.1\|283817_284333_+\|protease	DJ-1/PfpI/YhbO family deglycase/protease	NA	NA	NA	NA
WP_029604989.1\|284541_284916_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010495137.1\|284917_285268_+	hypothetical protein	NA	NA	NA	NA
WP_010495135.1\|285905_286508_-	ECF transporter S component	NA	NA	NA	NA
WP_010495133.1\|287074_287374_+	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_079578498.1\|287395_288355_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_079578500.1\|288575_289751_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_079578502.1\|290819_290972_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_079578504.1\|290973_291933_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_079578506.1\|292143_292782_+	SdpI family protein	NA	NA	NA	NA
WP_079578508.1\|293036_295832_+	YhgE/Pip domain-containing protein	NA	NA	NA	NA
WP_079578510.1\|296208_297120_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_079578512.1\|297235_298090_-	patatin family protein	NA	NA	NA	NA
WP_079578514.1\|298304_298613_+	hypothetical protein	NA	NA	NA	NA
WP_079578517.1\|298618_298804_+	hypothetical protein	NA	NA	NA	NA
WP_079578519.1\|299187_299862_+	LysM peptidoglycan-binding domain-containing protein	A0A0A7NNK8	Lactobacillus_phage	2.4e-08	61.5
WP_010495094.1\|300039_301410_+	aspartate kinase	NA	NA	NA	NA
WP_010495092.1\|301771_302272_+	phosphatidylglycerophosphatase A	A0A291I9Q0	Lactobacillus_phage	3.3e-42	53.4
WP_079578521.1\|302446_303361_-	C40 family peptidase	A0A0A8WIF2	Clostridium_phage	2.6e-13	35.5
WP_010495089.1\|303410_304349_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_079578523.1\|304401_305424_-	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_056971420.1\|306225_306795_+	recombinase family protein	NA	NA	NA	NA
WP_079578525.1\|309230_310898_+	alpha-glucosidase	NA	NA	NA	NA
WP_010495073.1\|311459_312509_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_079578527.1\|312535_313141_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_079578529.1\|313260_313749_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_079579635.1\|314225_315611_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.3e-29	30.0
WP_010495059.1\|315687_315963_-	hypothetical protein	NA	NA	NA	NA
WP_010495057.1\|316163_316484_+	hypothetical protein	NA	NA	NA	NA
WP_010495055.1\|316529_318239_+	ABC-ATPase domain-containing protein	NA	NA	NA	NA
WP_010495053.1\|318260_318881_+	DUF3862 domain-containing protein	NA	NA	NA	NA
WP_010499958.1\|319178_320558_+\|transposase	transposase	NA	NA	NA	NA
WP_079578531.1\|320719_321127_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_079578533.1\|321433_322450_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.4e-17	30.5
WP_079578535.1\|322446_323418_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.7e-16	31.3
WP_056971277.1\|323417_324374_+	ABC transporter permease	NA	NA	NA	NA
WP_079578537.1\|324389_325331_+	ABC transporter permease	NA	NA	NA	NA
WP_079578540.1\|325472_327284_+	oligopeptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_079578542.1\|328820_330572_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	8.4e-53	29.6
WP_079578544.1\|330571_332359_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-48	27.2
WP_056971282.1\|332519_332783_-	hypothetical protein	NA	NA	NA	NA
WP_079578546.1\|333257_334196_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.0e-68	44.0
WP_079578548.1\|334524_336438_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	1.0e-229	65.3
WP_079578550.1\|336603_337677_+	dipeptide epimerase	NA	NA	NA	NA
WP_056971287.1\|337795_338569_-	(S)-acetoin forming diacetyl reductase	NA	NA	NA	NA
WP_079578423.1\|338843_340085_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.6e-13	24.2
WP_010494999.1\|340297_342070_-	oleate hydratase	NA	NA	NA	NA
WP_056988160.1\|342387_343266_-	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_079578552.1\|343364_344948_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	5.7e-08	22.5
WP_010494990.1\|345434_345641_+	hypothetical protein	NA	NA	NA	NA
WP_010494981.1\|345886_346348_+	NUDIX hydrolase	NA	NA	NA	NA
WP_010494979.1\|346398_347604_+	MFS transporter	NA	NA	NA	NA
WP_010494977.1\|347788_348418_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_010494976.1\|348651_349998_+	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_079578554.1\|350069_350717_-	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_079578556.1\|350709_351345_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_079578558.1\|351423_352452_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.5e-37	32.2

DBSCAN-SWA_4

364754 : 416140

Streptococcus_phage(22.22%)

transposase,integrase,protease

attL 365902:365920|attR 421299:421317

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_056988198.1\|364754_365105_+	helix-turn-helix transcriptional regulator	A0A1X9I5R1	Streptococcus_phage	1.8e-15	50.0
WP_010494923.1\|365104_365533_+	ImmA/IrrE family metallo-endopeptidase	A0A0P0IJN5	Lactobacillus_phage	5.3e-25	41.2
365902:365920	attL	NA	NA	NA	NA
WP_079578568.1\|366009_366612_+	DUF5067 domain-containing protein	Q6SEF8	Lactobacillus_prophage	3.1e-39	59.5
WP_079578572.1\|366981_368010_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.9e-37	32.2
WP_056988153.1\|368103_368904_+	SHOCT domain-containing protein	B8R671	Lactobacillus_phage	2.1e-06	60.0
WP_056988154.1\|369182_370139_+\|integrase	site-specific integrase	Q6SEA7	Lactobacillus_prophage	8.3e-79	47.7
WP_079578574.1\|370259_371375_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_010494872.1\|371775_372342_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_010494869.1\|372409_374146_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-48	27.7
WP_079578576.1\|374145_375981_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.3e-59	31.9
WP_079578578.1\|376000_376960_+	hypothetical protein	NA	NA	NA	NA
WP_010499943.1\|377287_378598_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.3e-87	41.2
WP_079578580.1\|378756_380181_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_079578582.1\|380170_380617_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_079578584.1\|380935_382246_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.9e-90	42.1
WP_056972565.1\|382731_382995_+	CsbD family protein	NA	NA	NA	NA
WP_079578586.1\|384320_384752_+	OsmC family protein	NA	NA	NA	NA
WP_191980739.1\|385118_385538_-	hypothetical protein	NA	NA	NA	NA
WP_191980740.1\|385708_386440_-	hypothetical protein	NA	NA	NA	NA
WP_079578588.1\|386628_387939_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.1e-89	41.6
WP_010494843.1\|388275_388950_-	membrane protein	NA	NA	NA	NA
WP_079578590.1\|389530_390391_+	fructosamine kinase family protein	NA	NA	NA	NA
WP_079578592.1\|390653_391874_+	AI-2E family transporter	NA	NA	NA	NA
WP_079578594.1\|391960_392605_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010494834.1\|392684_393386_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_079578596.1\|393378_394722_-	Trk family potassium uptake protein	NA	NA	NA	NA
WP_079578598.1\|394976_395738_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	3.5e-19	29.4
WP_079578604.1\|395767_396337_+	SOS response-associated peptidase family protein	A0A1P8CX02	Bacillus_phage	1.6e-05	29.5
WP_154022001.1\|397609_398384_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	7.1e-28	54.1
WP_010494826.1\|398589_399030_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_056971324.1\|399499_399904_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_079578606.1\|399866_400601_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.2e-14	27.5
WP_079578608.1\|400593_401355_+	hypothetical protein	NA	NA	NA	NA
WP_079578610.1\|401700_402726_+	BMP family protein	A0A0A7DN02	Lactobacillus_phage	6.2e-56	38.3
WP_079578612.1\|403137_404676_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-18	29.1
WP_079579640.1\|404750_405761_+	ABC transporter permease	NA	NA	NA	NA
WP_010494806.1\|405760_406720_+	ABC transporter permease	NA	NA	NA	NA
WP_079578614.1\|406924_408310_+\|transposase	ISLre2 family transposase	NA	NA	NA	NA
WP_056988172.1\|408508_409129_+	LemA family protein	NA	NA	NA	NA
WP_172823816.1\|409203_409974_+	TPM domain-containing protein	NA	NA	NA	NA
WP_010494796.1\|410040_410754_+	demethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_010494795.1\|410896_411178_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_010494794.1\|411332_411827_+	hypothetical protein	NA	NA	NA	NA
WP_079578616.1\|411854_412607_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_079578618.1\|412707_414168_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_010494791.1\|414168_414678_+	DUF4811 domain-containing protein	NA	NA	NA	NA
WP_079578423.1\|414898_416140_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.6e-13	24.2
421299:421317	attR	NA	NA	NA	NA

DBSCAN-SWA_5

426064 : 487028

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010500073.1\|426064_427024_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_079578622.1\|427123_429463_+	ABC transporter ATP-binding protein/permease	G9BWD6	Planktothrix_phage	4.5e-33	40.1
WP_079578624.1\|429551_430907_+	APC family permease	NA	NA	NA	NA
WP_010499933.1\|431095_432406_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	8.4e-90	41.9
WP_079578626.1\|432594_434112_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	6.6e-38	28.7
WP_079578588.1\|434435_435746_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.1e-89	41.6
WP_154022051.1\|435914_436262_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_079578630.1\|436254_436437_-	hypothetical protein	NA	NA	NA	NA
WP_010498722.1\|436878_438012_-	L-lactate oxidase	NA	NA	NA	NA
WP_079579641.1\|438597_439425_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_172823818.1\|439571_442295_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_010498738.1\|442707_443454_-	tyrosine-protein phosphatase	NA	NA	NA	NA
WP_010498740.1\|443621_444704_-	NAD(P)-dependent alcohol dehydrogenase	NA	NA	NA	NA
WP_050955747.1\|444997_445507_+	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_079578634.1\|445494_447366_+	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_172823819.1\|447407_447593_+	hypothetical protein	NA	NA	NA	NA
WP_010498742.1\|447734_448166_+	PTS fructose IIA component	NA	NA	NA	NA
WP_010498744.1\|448199_448685_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_010498745.1\|448819_449662_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_079578638.1\|450579_452265_+	alpha-glucosidase	NA	NA	NA	NA
WP_079579635.1\|452741_454127_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.3e-29	30.0
WP_079578404.1\|455173_456484_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.3e-90	42.1
WP_010498765.1\|457417_458569_+	hypothetical protein	A0A218MNE0	uncultured_virus	2.6e-58	37.5
WP_035631387.1\|458736_459078_+	hypothetical protein	NA	NA	NA	NA
WP_010498777.1\|459339_459681_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_050955751.1\|459690_460560_+	SPFH domain-containing protein	NA	NA	NA	NA
WP_056988048.1\|460605_461178_+	hypothetical protein	NA	NA	NA	NA
WP_010498788.1\|461234_461630_-	hypothetical protein	NA	NA	NA	NA
WP_010498790.1\|461642_464273_-	cation-translocating P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	7.4e-77	28.7
WP_010498793.1\|465280_466648_-	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	5.8e-09	25.2
WP_010498795.1\|467181_467736_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010498797.1\|468136_468418_+	hypothetical protein	NA	NA	NA	NA
WP_010498798.1\|468833_470234_+	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_079578642.1\|470515_472780_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_079578644.1\|472782_473454_+	beta-phosphoglucomutase	NA	NA	NA	NA
WP_010498807.1\|473649_474597_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_079578646.1\|474775_476017_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-13	24.0
WP_079578648.1\|476306_477986_+	alpha-glucosidase	NA	NA	NA	NA
WP_079578650.1\|478667_480443_+	alpha-glycosidase	NA	NA	NA	NA
WP_079578652.1\|480547_481840_+	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_079578654.1\|481932_482793_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_079578656.1\|482792_483605_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_079578658.1\|483624_484281_+	hypothetical protein	NA	NA	NA	NA
WP_079578660.1\|484340_485447_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-22	33.6
WP_010499943.1\|485717_487028_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.3e-87	41.2

DBSCAN-SWA_6

575424 : 707800

104

Streptococcus_phage(24.0%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079578646.1\|575424_576666_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-13	24.0
WP_010499933.1\|577145_578456_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	8.4e-90	41.9
WP_079578732.1\|578887_579904_+	adenosine deaminase	NA	NA	NA	NA
WP_079578734.1\|579984_581142_-	hypothetical protein	NA	NA	NA	NA
WP_079578736.1\|581792_584447_-	cation-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	8.2e-84	31.7
WP_010497167.1\|584831_584972_+	hypothetical protein	NA	NA	NA	NA
WP_079578738.1\|585344_586889_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2H4UUX5	Bodo_saltans_virus	1.6e-34	25.0
WP_154022005.1\|587222_587375_+	hypothetical protein	NA	NA	NA	NA
WP_079578740.1\|588936_590355_+	C69 family dipeptidase	NA	NA	NA	NA
WP_010497177.1\|590931_591792_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_010497179.1\|591863_592334_+	hypothetical protein	NA	NA	NA	NA
WP_010497182.1\|592353_593202_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_010497183.1\|593391_594294_+	N-acetylmuramic acid 6-phosphate etherase	NA	NA	NA	NA
WP_079578742.1\|594312_596295_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_010497187.1\|596791_597835_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-30	35.9
WP_079578744.1\|597827_598514_+	ABC transporter permease	NA	NA	NA	NA
WP_056988026.1\|598564_599392_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_154022006.1\|599481_599643_+	hypothetical protein	NA	NA	NA	NA
WP_010497190.1\|599822_601199_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_079579643.1\|601306_602089_+	tyrosine-protein phosphatase	NA	NA	NA	NA
WP_010497192.1\|602103_602613_+	methylated-DNA--[protein]-cysteine S-methyltransferase	NA	NA	NA	NA
WP_172823855.1\|602664_603564_-	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_010497194.1\|603791_605072_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	3.3e-115	54.5
WP_010497197.1\|606119_608333_+	alpha-galactosidase	NA	NA	NA	NA
WP_010497198.1\|608610_608868_+	hypothetical protein	NA	NA	NA	NA
WP_010497200.1\|608913_609567_+	hypothetical protein	NA	NA	NA	NA
WP_010497202.1\|610253_611027_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_010497205.1\|611027_611489_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_010497206.1\|613336_614833_+\|tRNA	glutamyl-tRNA amidotransferase subunit A	NA	NA	NA	NA
WP_010497207.1\|615059_615524_-	nucleoside-diphosphate kinase	NA	NA	NA	NA
WP_079578748.1\|615637_616531_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_010497210.1\|616801_617221_+	(deoxy)nucleoside triphosphate pyrophosphohydrolase	NA	NA	NA	NA
WP_079578750.1\|617213_620096_+	DEAD/DEAH box helicase	U3PFS7	Lactobacillus_phage	1.4e-23	26.9
WP_010497215.1\|620354_621842_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	7.3e-98	41.4
WP_010497217.1\|622697_623141_-	large-conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_079578752.1\|623360_624389_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.5e-37	32.2
WP_010497219.1\|624566_625076_+	nitroreductase family protein	NA	NA	NA	NA
WP_010497221.1\|625658_626261_+	LysM peptidoglycan-binding domain-containing protein	A0A0E3XCL7	Enterococcus_phage	6.3e-16	46.0
WP_010497223.1\|626396_627272_-	VOC family protein	NA	NA	NA	NA
WP_010497225.1\|627436_628075_-	hypothetical protein	NA	NA	NA	NA
WP_010497227.1\|628343_629342_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	5.9e-51	38.5
WP_010497229.1\|629588_629855_+	hypothetical protein	NA	NA	NA	NA
WP_010497231.1\|630119_630422_-	hypothetical protein	NA	NA	NA	NA
WP_010497233.1\|630754_631792_+	galactose mutarotase	NA	NA	NA	NA
WP_079578754.1\|632094_632733_+	HAD family hydrolase	NA	NA	NA	NA
WP_079578756.1\|632890_633952_+	AI-2E family transporter	NA	NA	NA	NA
WP_079578758.1\|633944_635135_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_056972449.1\|635222_635909_+	2,3-diphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_079578423.1\|636110_637352_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.6e-13	24.2
WP_079578369.1\|637605_638889_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.1e-48	31.7
WP_172823822.1\|639068_639446_+\|transposase	transposase	NA	NA	NA	NA
WP_079579644.1\|641590_642073_+	DNA starvation/stationary phase protection protein	A0A2K9VCK5	Lactobacillus_phage	8.9e-13	31.1
WP_079578764.1\|644008_644674_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_172823856.1\|644874_645096_+	cation transporter	NA	NA	NA	NA
WP_010497316.1\|645108_645663_+	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_010497317.1\|645791_645965_+	hypothetical protein	NA	NA	NA	NA
WP_079578768.1\|646064_646334_-	metal-sensitive transcriptional regulator	NA	NA	NA	NA
WP_003643543.1\|646357_646678_-	thioredoxin family protein	A0A2K9L3H4	Tupanvirus	5.2e-09	39.1
WP_079578770.1\|647062_647821_+	aquaporin family protein	M1HQW3	Paramecium_bursaria_Chlorella_virus	9.4e-25	31.3
WP_079578772.1\|647997_649239_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.6e-13	24.2
WP_079578774.1\|649517_651422_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.8e-94	34.2
WP_079578778.1\|652384_652804_+	hypothetical protein	NA	NA	NA	NA
WP_079578780.1\|652783_654094_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	8.4e-90	41.9
WP_079578782.1\|654984_655344_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_056972533.1\|655751_656069_+	hypothetical protein	NA	NA	NA	NA
WP_056988129.1\|659355_659778_+	hypothetical protein	NA	NA	NA	NA
WP_079578786.1\|659809_660769_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_154022007.1\|660780_662997_+	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_056971496.1\|663416_664481_-\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
WP_079578790.1\|664856_665159_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_079578792.1\|665169_666318_+	ArgE/DapE family deacylase	NA	NA	NA	NA
WP_010497373.1\|666472_667150_+	DUF554 domain-containing protein	NA	NA	NA	NA
WP_079578794.1\|667184_667946_+	flavodoxin family protein	NA	NA	NA	NA
WP_010497377.1\|668119_668776_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_010497379.1\|668951_669425_+	PH domain-containing protein	NA	NA	NA	NA
WP_056971501.1\|669414_670872_+	PH domain-containing protein	NA	NA	NA	NA
WP_079578798.1\|670908_671775_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_079578800.1\|672314_673559_+	DUF3114 domain-containing protein	NA	NA	NA	NA
WP_010497396.1\|673708_674017_+	hypothetical protein	NA	NA	NA	NA
WP_010497399.1\|674371_674779_+	OsmC family protein	NA	NA	NA	NA
WP_162829030.1\|674820_675645_-	YitT family protein	NA	NA	NA	NA
WP_079578802.1\|675978_678375_+	phosphoketolase family protein	NA	NA	NA	NA
WP_010497405.1\|678515_678779_+	hypothetical protein	NA	NA	NA	NA
WP_079578804.1\|678893_679898_+	NERD domain-containing protein	NA	NA	NA	NA
WP_056972372.1\|680150_681887_-	N-6 DNA methylase	A0A1V0SLK8	Klosneuvirus	4.1e-07	24.4
WP_079578806.1\|682164_683673_+	YfcC family protein	NA	NA	NA	NA
WP_010497414.1\|683685_684843_+	ArgE/DapE family deacylase	NA	NA	NA	NA
WP_010497418.1\|685413_685971_+	LemA family protein	A0A1X9IGG1	Lactococcus_phage	4.8e-10	29.6
WP_010497420.1\|685986_687012_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_154022052.1\|688628_689813_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_079578588.1\|690152_691463_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.1e-89	41.6
WP_056972017.1\|691684_692740_+	DUF871 domain-containing protein	NA	NA	NA	NA
WP_010499128.1\|693058_695290_+	AAA family ATPase	A0A249XZV4	Enterococcus_phage	8.1e-08	34.3
WP_079578752.1\|695966_696995_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.5e-37	32.2
WP_079578808.1\|697348_697861_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_079578810.1\|699043_699937_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.1e-19	28.4
WP_079578812.1\|699937_701380_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_154022008.1\|701451_701607_-	hypothetical protein	NA	NA	NA	NA
WP_010499133.1\|701974_702838_+	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_010499134.1\|702979_703783_+	deoxyribose-phosphate aldolase	NA	NA	NA	NA
WP_010499958.1\|703972_705352_+\|transposase	transposase	NA	NA	NA	NA
WP_079578814.1\|705534_705822_+	hypothetical protein	NA	NA	NA	NA
WP_079578816.1\|705895_706774_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_079578818.1\|706903_707800_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

720176 : 794109

Bacillus_phage(17.65%)

tRNA,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172823857.1\|720176_721322_+\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_056972074.1\|721341_721719_+	DUF4430 domain-containing protein	NA	NA	NA	NA
WP_079579647.1\|721850_722564_+	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	3.9e-73	56.3
WP_010499188.1\|722679_723174_+	DUF1440 domain-containing protein	NA	NA	NA	NA
WP_079579648.1\|723305_724625_+	MFS transporter	NA	NA	NA	NA
WP_079578828.1\|724935_725916_+	linear amide C-N hydrolase	NA	NA	NA	NA
WP_010499191.1\|726195_726969_-	SDR family NAD(P)-dependent oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	9.0e-15	29.0
WP_079578830.1\|727139_728477_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_086989537.1\|729553_730329_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_079578834.1\|730327_731209_+	hypothetical protein	A0A0U4J920	Pseudomonas_phage	1.3e-09	26.5
WP_079578836.1\|732436_733864_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_010499196.1\|733863_734889_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_079578838.1\|734930_736643_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	2.3e-26	24.1
WP_079578840.1\|736643_738419_+	thiol reductant ABC exporter subunit CydC	A0A1V0SE00	Indivirus	1.9e-23	32.7
WP_056971585.1\|738467_739448_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_086989537.1\|739572_740348_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_079578842.1\|740654_741563_+	prenyltransferase	NA	NA	NA	NA
WP_010499207.1\|741575_742787_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_010499209.1\|742923_743877_+	D-2-hydroxyacid dehydrogenase	NA	NA	NA	NA
WP_010499211.1\|744013_744691_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_079578844.1\|745080_746295_+	MFS transporter	NA	NA	NA	NA
WP_010499215.1\|746504_747179_+	hypothetical protein	NA	NA	NA	NA
WP_010499216.1\|747426_748383_+	Dyp-type peroxidase	S4VXK8	Pandoravirus	1.7e-18	30.8
WP_010499218.1\|748466_748826_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_079578846.1\|749076_750264_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_079578848.1\|750832_752218_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.9e-30	30.3
WP_191976425.1\|752570_753776_+\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.7e-24	33.5
WP_056972284.1\|753781_754408_+	ABC transporter permease	NA	NA	NA	NA
WP_079578850.1\|754419_755367_+	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010499227.1\|755366_756023_+	ABC transporter permease	NA	NA	NA	NA
WP_010499229.1\|756082_756967_+	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_010499231.1\|756966_757698_+	hypothetical protein	NA	NA	NA	NA
WP_057785074.1\|758076_759255_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_010499541.1\|759459_760149_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.9e-38	37.6
WP_010499543.1\|760173_761343_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.0e-26	29.6
WP_079578852.1\|761609_762944_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.8e-26	31.3
WP_010499547.1\|763151_763919_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_010499549.1\|763922_764267_+	AzlD domain-containing protein	NA	NA	NA	NA
WP_010499556.1\|764399_765215_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_035631516.1\|765455_766025_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_079578854.1\|766275_767166_+	hypothetical protein	NA	NA	NA	NA
WP_010499569.1\|767283_768192_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_010499570.1\|768240_768888_+	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_010499572.1\|769047_769248_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.1e-20	69.2
WP_079578369.1\|769316_770600_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.1e-48	31.7
WP_079578856.1\|770892_771966_-	LCP family protein	NA	NA	NA	NA
WP_079578857.1\|774013_774799_+	zinc-ribbon domain-containing protein	D6PSS5	Lactobacillus_phage	5.3e-15	34.3
WP_079578860.1\|774868_775402_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010499587.1\|775406_775901_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_010499588.1\|775951_777646_+	acetolactate synthase AlsS	NA	NA	NA	NA
WP_079578862.1\|777698_778418_+	acetolactate decarboxylase	NA	NA	NA	NA
WP_079579649.1\|778853_780368_+	amino acid permease	NA	NA	NA	NA
WP_010499601.1\|780692_781964_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	6.9e-97	45.1
WP_010496666.1\|787800_788400_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_079578614.1\|788817_790203_-\|transposase	ISLre2 family transposase	NA	NA	NA	NA
WP_079578864.1\|790348_792619_-	AAA family ATPase	NA	NA	NA	NA
WP_010496669.1\|793092_794109_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA

DBSCAN-SWA_8

823137 : 959780

112

Streptococcus_phage(26.83%)

tRNA,transposase,holin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079578614.1\|823137_824523_+\|transposase	ISLre2 family transposase	NA	NA	NA	NA
WP_035631537.1\|824722_824932_+	hypothetical protein	NA	NA	NA	NA
WP_079578888.1\|825121_826408_+	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_010499680.1\|826421_827714_+	transcription termination factor Rho	NA	NA	NA	NA
WP_010499682.1\|827867_828116_+	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_010499684.1\|828291_828975_+	hypothetical protein	NA	NA	NA	NA
WP_010499686.1\|829049_831416_-	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_010499688.1\|831752_833063_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	7.5e-46	31.5
WP_056972050.1\|833251_833782_+	dihydrofolate reductase	NA	NA	NA	NA
WP_010499691.1\|833766_834588_+	TIGR02452 family protein	NA	NA	NA	NA
WP_010499695.1\|835092_835527_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_056988122.1\|835926_837300_+	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_010499698.1\|837465_838977_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.2e-74	41.3
WP_079578890.1\|839189_840431_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	4.6e-13	24.0
WP_191980741.1\|841102_841684_+	hypothetical protein	NA	NA	NA	NA
WP_079578896.1\|841734_842511_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	7.1e-28	54.1
WP_085898786.1\|842537_842780_+	reverse transcriptase	NA	NA	NA	NA
WP_010499646.1\|844409_844769_+	holo-ACP synthase	NA	NA	NA	NA
WP_010499643.1\|844787_845912_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	4.3e-34	30.4
WP_010499641.1\|845996_846239_+	hypothetical protein	NA	NA	NA	NA
WP_010499638.1\|846277_846655_+	type II toxin-antitoxin system PemK/MazF family toxin	A0A2P0ZKX3	Lactobacillus_phage	2.6e-12	37.8
WP_010499636.1\|846771_846993_+	hypothetical protein	NA	NA	NA	NA
WP_010499634.1\|847385_848021_-	CBS domain-containing protein	NA	NA	NA	NA
WP_056972137.1\|848244_849219_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_010499630.1\|849502_850060_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_010499628.1\|850074_853605_+	transcription-repair coupling factor	NA	NA	NA	NA
WP_079578898.1\|853604_855179_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_010499623.1\|855215_855485_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_010499622.1\|855660_856065_+	septum formation initiator family protein	NA	NA	NA	NA
WP_056988161.1\|856214_856718_+	RNA-binding protein S1	NA	NA	NA	NA
WP_056988162.1\|856836_858195_+\|tRNA	tRNA lysidine(34) synthetase TilS	A0A0N7G7K4	Chrysochromulina_ericina_virus	3.9e-13	24.7
WP_010499613.1\|858199_858742_+	hypoxanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_010499612.1\|858832_860920_+\|protease	ATP-dependent zinc metalloprotease FtsH	H8ZJI5	Ostreococcus_tauri_virus	2.3e-105	47.2
WP_010499610.1\|861119_862004_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_010499609.1\|862153_863650_+\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	2.0e-87	36.8
WP_010497832.1\|870738_872205_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.9e-75	36.0
WP_079578900.1\|872676_873474_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	3.4e-33	36.7
WP_056988088.1\|873568_874705_+	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_010497835.1\|874751_875453_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010497836.1\|875627_876590_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	4.8e-127	68.6
WP_079578902.1\|876692_878864_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	8.9e-254	60.7
WP_010497849.1\|878853_879225_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A2H4J545	uncultured_Caudovirales_phage	2.1e-17	40.3
WP_010497851.1\|879221_879452_-	glutaredoxin-like protein NrdH	X2KRY7	Enterococcus_phage	8.0e-12	40.3
WP_010497853.1\|879726_880332_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_162829031.1\|880369_880816_+	nucleoside deaminase	NA	NA	NA	NA
WP_010497856.1\|881159_882950_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	2.3e-53	37.3
WP_172823858.1\|882967_883279_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_056971745.1\|883303_883903_+	recombination protein RecR	NA	NA	NA	NA
WP_010497863.1\|883920_884160_+	YaaL family protein	NA	NA	NA	NA
WP_079578906.1\|884252_884882_+	dTMP kinase	M1PSC7	Streptococcus_phage	2.7e-49	51.2
WP_010497867.1\|884930_885260_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_010497869.1\|885272_886259_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	1.1e-36	32.9
WP_029605439.1\|886275_886620_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	3.7e-13	37.6
WP_079578908.1\|886619_887498_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.5e-71	50.3
WP_010497874.1\|887607_888348_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_079578910.1\|888483_889443_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_056988218.1\|889531_890506_-	asparaginase	NA	NA	NA	NA
WP_057785074.1\|890653_891832_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_010497893.1\|892061_892790_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_050955736.1\|892764_893331_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_056988204.1\|893345_894377_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	NA	NA	NA	NA
WP_056988200.1\|894482_896435_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.5e-55	31.2
WP_010497907.1\|896611_897253_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_010499958.1\|897408_898788_-\|transposase	transposase	NA	NA	NA	NA
WP_010499958.1\|898990_900370_-\|transposase	transposase	NA	NA	NA	NA
WP_010497916.1\|900493_901120_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_010497918.1\|901302_901587_+	co-chaperone GroES	A0A219PVY9	uncultured_virus	1.2e-09	38.0
WP_010497920.1\|901635_903264_+	chaperonin GroEL	A0A219YK78	uncultured_virus	7.6e-157	55.9
WP_010497924.1\|903555_905388_+	APC family permease	NA	NA	NA	NA
WP_010497925.1\|905447_906104_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	1.7e-43	44.2
WP_010497926.1\|906162_907497_+	DEAD/DEAH box helicase family protein	A0A1X9I5S6	Streptococcus_phage	1.7e-82	41.5
WP_010497927.1\|907489_908182_+	ComF family protein	NA	NA	NA	NA
WP_079578780.1\|908381_909692_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	8.4e-90	41.9
WP_010497928.1\|910076_910631_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_010497931.1\|910873_913237_+	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_191976421.1\|913367_914486_+	peptide chain release factor 2	NA	NA	NA	NA
WP_010497933.1\|914617_915301_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	7.9e-23	29.7
WP_079578914.1\|915293_916187_+	ABC transporter permease	NA	NA	NA	NA
WP_079578916.1\|916437_917583_+	PDZ domain-containing protein	NA	NA	NA	NA
WP_079578918.1\|917597_918320_+	response regulator transcription factor	W8CYM9	Bacillus_phage	9.2e-38	37.3
WP_079578920.1\|918297_919689_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	2.5e-31	34.3
WP_010497943.1\|919850_920186_+	PspC domain-containing protein	NA	NA	NA	NA
WP_010497945.1\|920182_920530_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_079578922.1\|920639_921575_+	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_079578924.1\|921673_922522_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_079578926.1\|922600_923545_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	1.6e-82	50.5
WP_079578928.1\|924467_925646_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_010497966.1\|925791_927519_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	2.1e-189	56.5
WP_172823859.1\|927881_929876_+	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_079578932.1\|929928_932763_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.3e-301	54.3
WP_010497972.1\|932854_933328_+	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_079578934.1\|933527_934187_+	serine dehydratase	NA	NA	NA	NA
WP_079578936.1\|934201_935083_+	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_079578938.1\|935213_936098_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.7e-09	32.2
WP_079578940.1\|936094_937114_+	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	5.2e-95	55.1
WP_079578942.1\|937164_938109_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	9.5e-51	38.6
WP_010497992.1\|938262_938856_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	5.9e-51	52.8
WP_079578944.1\|939318_940644_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_079578946.1\|940936_941965_+	SorC family transcriptional regulator	NA	NA	NA	NA
WP_079578948.1\|942026_943040_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_056988119.1\|943202_944396_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_010498002.1\|944476_945232_+	triose-phosphate isomerase	NA	NA	NA	NA
WP_079579652.1\|945862_947248_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.3e-29	30.0
WP_010498005.1\|948950_949187_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_010498006.1\|949272_951675_+	ribonuclease R	Q0GXV6	Lactococcus_phage	2.2e-83	36.9
WP_010498008.1\|951773_952238_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.1e-44	56.6
WP_079578950.1\|953769_955155_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.4e-29	31.0
WP_010498013.1\|955817_956351_-	hypothetical protein	NA	NA	NA	NA
WP_056971806.1\|956397_957270_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_010498017.1\|957468_958164_+	uracil-DNA glycosylase	V5NWU7	Chelonid_alphaherpesvirus	2.0e-45	43.7
WP_010498019.1\|958299_959289_+	phosphate acetyltransferase	NA	NA	NA	NA
WP_010498021.1\|959315_959780_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA

DBSCAN-SWA_9

966541 : 1041160

Staphylococcus_phage(29.41%)

tRNA,transposase,integrase

attL 1030240:1030261|attR 1036127:1036148

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079578752.1\|966541_967570_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.5e-37	32.2
WP_010499933.1\|967822_969133_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	8.4e-90	41.9
WP_029605467.1\|969532_969841_+	hypothetical protein	NA	NA	NA	NA
WP_010498053.1\|970163_971027_+	phosphate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010498055.1\|971073_971991_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_010498056.1\|971990_972881_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_010498057.1\|972978_973788_+	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-12	29.9
WP_010498059.1\|973808_974564_+	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.5e-18	31.5
WP_010498061.1\|974578_975244_+	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_010498063.1\|975411_976275_+	class II fructose-1,6-bisphosphate aldolase	NA	NA	NA	NA
WP_010499958.1\|978263_979643_+\|transposase	transposase	NA	NA	NA	NA
WP_148266359.1\|979710_980160_-	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_056972500.1\|980366_980996_+	hemolysin III family protein	NA	NA	NA	NA
WP_010498076.1\|981104_981443_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_035631266.1\|981563_982268_+	viroplasmin family protein	C1KFJ1	Lactobacillus_virus	1.6e-31	35.6
WP_010498093.1\|982282_982981_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_010498094.1\|982977_983157_+	hypothetical protein	NA	NA	NA	NA
WP_056972573.1\|983870_986078_+	LTA synthase family protein	W6LM83	Streptococcus_phage	2.0e-176	49.6
WP_010498101.1\|986203_987553_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_079578956.1\|987777_989019_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	4.6e-13	24.0
WP_010498102.1\|989252_989747_+	CBS domain-containing protein	NA	NA	NA	NA
WP_056988080.1\|989924_990632_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	NA	NA	NA	NA
WP_079578958.1\|990736_991873_+	N-acetyldiaminopimelate deacetylase	NA	NA	NA	NA
WP_079578960.1\|992010_992907_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_010498107.1\|993249_993687_+	DUF948 domain-containing protein	NA	NA	NA	NA
WP_010498108.1\|993689_994085_+	hypothetical protein	NA	NA	NA	NA
WP_010498109.1\|994193_995297_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_010498110.1\|995506_996517_+	catabolite control protein A	NA	NA	NA	NA
WP_079578962.1\|996675_997395_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_079578964.1\|997595_998576_+	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_079578966.1\|998568_999588_+	type II secretion system F family protein	NA	NA	NA	NA
WP_010498114.1\|999587_999893_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_010498116.1\|999885_1000338_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_010498119.1\|1000315_1000582_+	hypothetical protein	NA	NA	NA	NA
WP_050955738.1\|1000544_1001009_+	type II secretion system protein	NA	NA	NA	NA
WP_035631275.1\|1001079_1001319_+	hypothetical protein	NA	NA	NA	NA
WP_029605481.1\|1001422_1002445_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_056971485.1\|1002598_1003207_+	metallophosphoesterase	A0A076G7D9	Bacillus_phage	1.1e-28	39.4
WP_010498132.1\|1003218_1004604_+	metallophosphoesterase	NA	NA	NA	NA
WP_010498134.1\|1004642_1005263_+	YutD family protein	NA	NA	NA	NA
WP_010498136.1\|1005301_1006084_+	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_079578968.1\|1006073_1006709_+	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_056971481.1\|1006773_1007433_-	VTT domain-containing protein	NA	NA	NA	NA
WP_010498148.1\|1007520_1008525_-	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	6.8e-23	47.5
WP_079578970.1\|1008744_1009326_+	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	7.7e-27	42.9
WP_010498153.1\|1009361_1009754_+	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_079578956.1\|1017085_1018327_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	4.6e-13	24.0
WP_079578972.1\|1018656_1019847_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.2e-143	65.8
WP_079578974.1\|1020044_1022261_+	LysM peptidoglycan-binding domain-containing protein	U5PW24	Bacillus_virus	6.6e-10	35.0
WP_079578976.1\|1022588_1025003_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	71.3
WP_010499774.1\|1025230_1026892_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_010499776.1\|1027010_1027412_+	hypothetical protein	NA	NA	NA	NA
WP_079579654.1\|1027602_1030182_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	1.1e-106	44.1
WP_056971822.1\|1030181_1031471_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	3.8e-10	21.5
1030240:1030261	attL	NA	NA	NA	NA
WP_079578978.1\|1031517_1034604_+	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_079578980.1\|1034755_1035688_+\|integrase	site-specific integrase	A8ATM2	Listeria_phage	1.1e-78	47.7
WP_079578982.1\|1035684_1036116_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_079578984.1\|1036206_1037127_+	restriction endonuclease	NA	NA	NA	NA
1036127:1036148	attR	NA	NA	NA	NA
WP_057785074.1\|1037231_1038410_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_079578986.1\|1039969_1041160_+\|transposase	IS256 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

1199289 : 1303158

102

Lactobacillus_phage(35.42%)

capsid,portal,terminase,integrase,tail,tRNA,transposase,holin

attL 1207637:1207656|attR 1301357:1301376

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079578356.1\|1199289_1200324_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_010496130.1\|1200733_1201339_+	Fic family protein	NA	NA	NA	NA
WP_154022015.1\|1201392_1201545_+	hypothetical protein	NA	NA	NA	NA
WP_010496125.1\|1202203_1203322_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	2.1e-36	32.7
WP_154022016.1\|1203582_1204494_+	hypothetical protein	NA	NA	NA	NA
WP_079579635.1\|1205069_1206455_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.3e-29	30.0
1207637:1207656	attL	NA	NA	NA	NA
WP_010496112.1\|1207980_1208433_-	hypothetical protein	NA	NA	NA	NA
WP_172823862.1\|1211629_1212934_+	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	1.0e-87	41.1
WP_010496098.1\|1213462_1214113_+	hypothetical protein	NA	NA	NA	NA
WP_010496097.1\|1214140_1214911_+	RNA methyltransferase	NA	NA	NA	NA
WP_010496096.1\|1215035_1215545_+	hydrolase	NA	NA	NA	NA
WP_056971955.1\|1215648_1215999_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_056971954.1\|1216456_1217503_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	3.5e-30	35.6
WP_079579022.1\|1217512_1219927_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_079579024.1\|1220205_1221306_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_010496075.1\|1221325_1221973_+	uridine kinase	A0A1V0SAA3	Catovirus	8.0e-33	37.1
WP_010496074.1\|1222219_1222693_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_079579659.1\|1223189_1224584_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.0e-30	30.3
WP_079579026.1\|1224679_1225438_+	NADPH-dependent oxidoreductase	NA	NA	NA	NA
WP_010496068.1\|1225546_1225903_-	hypothetical protein	NA	NA	NA	NA
WP_010496066.1\|1225922_1226882_-	nucleoside hydrolase	NA	NA	NA	NA
WP_056988036.1\|1227121_1228006_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_010496058.1\|1228022_1228796_+	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_172823825.1\|1228867_1230019_-\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	1.3e-62	37.4
WP_079579030.1\|1230161_1230701_-	Ltp family lipoprotein	A0A097BY93	Leuconostoc_phage	6.2e-15	64.7
WP_079579032.1\|1230873_1231578_-	LexA family transcriptional regulator	E9LUS8	Lactobacillus_phage	3.3e-48	48.1
WP_079579034.1\|1231753_1231984_+	helix-turn-helix transcriptional regulator	E9LUS9	Lactobacillus_phage	2.0e-23	65.8
WP_079579036.1\|1231998_1232736_+	phage antirepressor KilAC domain-containing protein	E9LUT0	Lactobacillus_phage	6.5e-55	46.5
WP_169790223.1\|1232738_1232891_+	hypothetical protein	NA	NA	NA	NA
WP_056971148.1\|1232887_1233115_-	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	1.4e-21	68.5
WP_079579038.1\|1233206_1233506_+	hypothetical protein	NA	NA	NA	NA
WP_154022017.1\|1233591_1233762_+	hypothetical protein	NA	NA	NA	NA
WP_079579040.1\|1233883_1234072_+	hypothetical protein	NA	NA	NA	NA
WP_079579042.1\|1234061_1234262_+	hypothetical protein	NA	NA	NA	NA
WP_079579044.1\|1234254_1234536_+	hypothetical protein	NA	NA	NA	NA
WP_172823826.1\|1234528_1235050_+	host-nuclease inhibitor Gam family protein	A0A0A7S0G6	Clostridium_phage	9.0e-19	35.8
WP_079579048.1\|1235061_1235772_+	ERF family protein	A0A1S5SAA3	Streptococcus_phage	9.7e-40	53.0
WP_079579050.1\|1235785_1236448_+	hypothetical protein	U5U4M2	Lactobacillus_phage	2.1e-57	49.5
WP_079579052.1\|1236440_1236860_+	single-stranded DNA-binding protein	B8R683	Lactobacillus_phage	8.0e-26	46.0
WP_079579054.1\|1236870_1237155_+	hypothetical protein	NA	NA	NA	NA
WP_079579056.1\|1237168_1237909_+	conserved phage C-terminal domain-containing protein	A0A1P8BK94	Lactococcus_phage	1.1e-65	55.7
WP_079579057.1\|1237921_1238677_+	ATP-binding protein	D2KRE5	Lactobacillus_phage	1.2e-11	33.1
WP_079579061.1\|1238881_1239286_+	RusA family crossover junction endodeoxyribonuclease	A8YQM5	Lactobacillus_phage	1.2e-26	43.7
WP_079579063.1\|1239275_1239923_+	HNH endonuclease	A0A220GJG3	Streptococcus_phage	2.8e-30	46.6
WP_079579065.1\|1239943_1240147_+	hypothetical protein	NA	NA	NA	NA
WP_079579067.1\|1240159_1240987_+	hypothetical protein	NA	NA	NA	NA
WP_079579069.1\|1240973_1241375_+	hypothetical protein	A0A140HLR7	Bacillus_phage	2.5e-24	49.0
WP_079579071.1\|1241633_1242416_+	site-specific DNA-methyltransferase	B4XYT3	Lactobacillus_phage	2.2e-114	77.5
WP_154022018.1\|1242429_1243146_+	hypothetical protein	NA	NA	NA	NA
WP_172823827.1\|1243243_1243705_+	hypothetical protein	NA	NA	NA	NA
WP_079579077.1\|1244275_1244788_+\|terminase	terminase small subunit	A0A097BYC9	Leuconostoc_phage	6.3e-33	52.3
WP_079579079.1\|1244771_1246082_+\|terminase	PBSX family phage terminase large subunit	A8ASJ2	Listeria_phage	8.6e-127	51.6
WP_079579081.1\|1246208_1247861_+\|portal	phage portal protein	U3PCP8	Lactobacillus_phage	7.2e-147	51.3
WP_079579083.1\|1247805_1248948_+\|capsid	minor capsid protein	U3PFU0	Lactobacillus_phage	2.1e-97	50.8
WP_172823829.1\|1249041_1249626_+	phage scaffolding protein	A8ASJ5	Listeria_phage	1.2e-16	47.8
WP_079579085.1\|1249643_1250522_+\|capsid	capsid protein	U3PDP8	Lactobacillus_phage	4.0e-96	62.0
WP_079579087.1\|1250608_1250803_+	hypothetical protein	NA	NA	NA	NA
WP_079579089.1\|1250911_1251229_+	hypothetical protein	NA	NA	NA	NA
WP_079579091.1\|1251293_1251644_+\|capsid	capsid protein	O03932	Lactobacillus_phage	4.9e-29	56.9
WP_079579093.1\|1251644_1252001_+\|capsid	capsid protein	U3PIU9	Lactobacillus_phage	4.5e-14	41.3
WP_079579095.1\|1251997_1252429_+	hypothetical protein	NA	NA	NA	NA
WP_079579097.1\|1252432_1252924_+\|capsid	capsid protein	NA	NA	NA	NA
WP_079579099.1\|1253031_1253496_+	hypothetical protein	NA	NA	NA	NA
WP_079579101.1\|1253501_1254128_+	hypothetical protein	O03936	Lactobacillus_phage	3.1e-26	35.9
WP_079579103.1\|1254130_1258561_+	tape measure protein	Q9AZL4	Lactococcus_phage	2.6e-82	54.3
WP_079579105.1\|1258547_1259270_+	hypothetical protein	C5IUK4	Streptococcus_phage	4.1e-22	29.6
WP_079579107.1\|1259269_1261174_+\|tail	phage tail protein	A0A1B2APX2	Phage_Wrath	1.7e-59	37.3
WP_079579109.1\|1261185_1263108_+	hypothetical protein	A0A0S2MYI4	Enterococcus_phage	8.7e-51	32.0
WP_079579111.1\|1263120_1263699_+	hypothetical protein	NA	NA	NA	NA
WP_079579113.1\|1263965_1264961_+	collagen-like protein	A0A2P0ZL67	Lactobacillus_phage	2.7e-120	78.9
WP_079579115.1\|1264965_1265502_+	hypothetical protein	A0A2K9VCK7	Lactobacillus_phage	5.4e-51	62.4
WP_154022020.1\|1265529_1265949_+\|holin	phage holin family protein	A0A097BY69	Enterococcus_phage	3.6e-18	43.7
WP_172823830.1\|1265949_1266993_+	LysM peptidoglycan-binding domain-containing protein	A0A075KQK4	Lactobacillus_phage	5.9e-62	44.2
WP_079579117.1\|1267151_1267412_+	hypothetical protein	NA	NA	NA	NA
WP_079579119.1\|1267371_1267827_+	DUF2335 domain-containing protein	NA	NA	NA	NA
WP_010496057.1\|1269515_1269842_+	hypothetical protein	NA	NA	NA	NA
WP_010496056.1\|1270018_1272253_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A1V0SJX2	Klosneuvirus	1.2e-08	34.1
WP_029605165.1\|1272278_1272725_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_056971077.1\|1272793_1273744_+	alpha/beta hydrolase fold domain-containing protein	L7RDF8	Acanthamoeba_polyphaga_moumouvirus	1.7e-36	33.3
WP_079579121.1\|1273767_1274409_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_029605157.1\|1274465_1275323_-	N-acetylmuramoyl-L-alanine amidase	C8CHK8	Thermus_virus	1.7e-06	37.0
WP_079579123.1\|1275882_1277181_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_079579125.1\|1277187_1278978_+\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
WP_056971968.1\|1279135_1280008_+	YitT family protein	NA	NA	NA	NA
WP_079579127.1\|1280030_1281209_+	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_010496033.1\|1281260_1282163_+	deoxyribonuclease IV	A0A2H4UU70	Bodo_saltans_virus	1.0e-22	30.5
WP_010496032.1\|1282245_1283073_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_003690207.1\|1283366_1283552_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_010496031.1\|1283573_1284020_+	GatB/YqeY domain-containing protein	G3MAQ0	Bacillus_virus	3.7e-13	37.2
WP_056972469.1\|1284160_1285138_+	PhoH family protein	W8D063	Erwinia_phage	3.2e-49	49.1
WP_056972468.1\|1285170_1285650_+	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_010496027.1\|1285627_1286038_+	diacylglycerol kinase family protein	NA	NA	NA	NA
WP_010496024.1\|1286083_1286986_+	GTPase Era	NA	NA	NA	NA
WP_029605150.1\|1287072_1287849_+	DNA repair protein RecO	NA	NA	NA	NA
WP_010496020.1\|1288438_1289356_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_079579129.1\|1289357_1291436_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_079579131.1\|1291887_1293759_+	DNA primase	A0A1S5REW9	Helicobacter_phage	4.5e-44	30.0
WP_010496014.1\|1293772_1294894_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.1e-37	37.4
WP_010496005.1\|1295047_1295758_+\|tRNA	tRNA (adenine(22)-N(1))-methyltransferase TrmK	NA	NA	NA	NA
WP_010496004.1\|1295741_1296857_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_010496003.1\|1296890_1298132_+	peptidase T	NA	NA	NA	NA
WP_010499943.1\|1301847_1303158_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.3e-87	41.2
1301357:1301376	attR	NA	NA	NA	NA

DBSCAN-SWA_11

1393837 : 1640346

231

Streptococcus_phage(13.64%)

integrase,protease,tRNA,transposase,holin

attL 1558364:1558383|attR 1565532:1565551

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079579186.1\|1393837_1395139_-\|tRNA	asparagine--tRNA ligase	M1PB22	Moumouvirus	2.1e-56	31.1
WP_079579188.1\|1395150_1396335_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_079579190.1\|1396352_1396847_-	DUF5590 domain-containing protein	NA	NA	NA	NA
WP_056971161.1\|1396935_1399731_-	hypothetical protein	A0A1X9I5C8	Streptococcus_phage	4.9e-55	33.3
WP_079579192.1\|1400018_1400975_+	mevalonate kinase	NA	NA	NA	NA
WP_079579194.1\|1400974_1401949_+	diphosphomevalonate decarboxylase	NA	NA	NA	NA
WP_010494292.1\|1401979_1403053_+	phosphomevalonate kinase	NA	NA	NA	NA
WP_010494294.1\|1403071_1404094_+	type 2 isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_079579196.1\|1404176_1405556_-	RsmF rRNA methyltransferase first C-terminal domain-containing protein	NA	NA	NA	NA
WP_079579198.1\|1405552_1406524_-	ABC transporter permease	NA	NA	NA	NA
WP_010494311.1\|1406545_1406872_-	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_010494313.1\|1406887_1407640_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_010494315.1\|1407950_1408757_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_079579200.1\|1408839_1410132_-	diaminopimelate decarboxylase	NA	NA	NA	NA
WP_056988157.1\|1410349_1411780_+	C69 family dipeptidase	NA	NA	NA	NA
WP_010494322.1\|1411804_1412803_+	hypothetical protein	NA	NA	NA	NA
WP_079579310.1\|1412882_1414268_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.8e-29	30.3
WP_056971172.1\|1414737_1415613_-	elongation factor Ts	NA	NA	NA	NA
WP_010494327.1\|1415712_1416510_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_010494329.1\|1416733_1417729_-	D-2-hydroxyacid dehydrogenase	Q89388	Paramecium_bursaria_Chlorella_virus	2.0e-43	35.0
WP_010494331.1\|1417838_1418126_-	GIY-YIG nuclease family protein	A0A1V0SLS6	Klosneuvirus	5.3e-05	43.1
WP_056988017.1\|1418112_1418871_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_010494337.1\|1418965_1419598_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_079579664.1\|1419649_1419877_-	YneF family protein	NA	NA	NA	NA
WP_010494340.1\|1419991_1420240_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_010494342.1\|1420404_1421031_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	1.6e-14	52.1
WP_079578646.1\|1421259_1422501_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-13	24.0
WP_079579203.1\|1422761_1424441_-	DNA repair protein RecN	NA	NA	NA	NA
WP_010494352.1\|1424522_1424981_-	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_010494355.1\|1425042_1425864_-	TlyA family RNA methyltransferase	NA	NA	NA	NA
WP_010494356.1\|1425873_1426761_-	polyprenyl synthetase family protein	A0A1V0SE37	Indivirus	4.9e-09	25.6
WP_010494359.1\|1426753_1426996_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_010494361.1\|1426988_1428335_-	exodeoxyribonuclease VII large subunit	L7RDW5	Acanthamoeba_polyphaga_moumouvirus	3.2e-28	32.3
WP_079579205.1\|1428331_1429183_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	3.1e-32	37.8
WP_079579207.1\|1429312_1429714_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_079579209.1\|1429713_1430145_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_010494369.1\|1430164_1430722_-	elongation factor P	NA	NA	NA	NA
WP_154022022.1\|1430840_1431902_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_010494371.1\|1432069_1432351_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_010494373.1\|1432373_1432700_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_029604862.1\|1432725_1433034_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_010494474.1\|1434149_1434707_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_079578404.1\|1435347_1436658_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.3e-90	42.1
WP_057785074.1\|1437088_1438267_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_079579213.1\|1438362_1438695_-	hypothetical protein	NA	NA	NA	NA
WP_154022023.1\|1438711_1438873_-	hypothetical protein	NA	NA	NA	NA
WP_010494484.1\|1439293_1439758_-	hypothetical protein	NA	NA	NA	NA
WP_010494487.1\|1439772_1440768_-	hypothetical protein	NA	NA	NA	NA
WP_079579215.1\|1440760_1441651_-	exonuclease SbcC	NA	NA	NA	NA
WP_056988203.1\|1441937_1442954_-	hypothetical protein	NA	NA	NA	NA
WP_056971404.1\|1443063_1444236_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_079578356.1\|1444533_1445568_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_010494497.1\|1445755_1446028_+	acylphosphatase	NA	NA	NA	NA
WP_056988211.1\|1446188_1447112_+	membrane protein insertase YidC	NA	NA	NA	NA
WP_079579217.1\|1447178_1448729_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_056971407.1\|1448728_1449415_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.3e-29	30.8
WP_079578646.1\|1449745_1450987_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-13	24.0
WP_010494511.1\|1451161_1452583_-	NADP-dependent phosphogluconate dehydrogenase	A0A0P0C6S9	Ostreococcus_lucimarinus_virus	1.8e-37	28.8
WP_056988034.1\|1452750_1453998_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	6.9e-134	58.4
WP_056988033.1\|1454154_1455483_-	trigger factor	NA	NA	NA	NA
WP_010494526.1\|1455651_1456845_-	elongation factor Tu	A0A076FFS6	Aureococcus_anophage	2.1e-31	29.7
WP_056988032.1\|1457060_1457975_-	hypothetical protein	NA	NA	NA	NA
WP_079579219.1\|1458000_1459701_-	ribonuclease J	NA	NA	NA	NA
WP_056971414.1\|1459718_1460597_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_079579221.1\|1460609_1461662_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_010494555.1\|1464183_1464453_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_010494557.1\|1464788_1465043_+	30S ribosomal protein S20	NA	NA	NA	NA
WP_056971773.1\|1465101_1466133_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_172823837.1\|1466122_1468279_-	DNA internalization-related competence protein ComEC/Rec2	M1PSD2	Streptococcus_phage	8.9e-28	38.3
WP_010494573.1\|1468416_1468911_-	ComE operon protein 2	A7KUY9	Bacillus_phage	4.2e-34	55.8
WP_010494574.1\|1469025_1469763_-	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_056971771.1\|1469838_1470855_-	PDZ domain-containing protein	NA	NA	NA	NA
WP_056971770.1\|1470847_1471330_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	3.7e-27	38.1
WP_056971769.1\|1471326_1471896_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_010494588.1\|1471912_1472197_-	YlbG family protein	NA	NA	NA	NA
WP_056988029.1\|1472229_1475688_-	pyruvate carboxylase	NA	NA	NA	NA
WP_029604896.1\|1475749_1476943_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_010494601.1\|1476953_1477235_-	DUF1507 family protein	NA	NA	NA	NA
WP_079579223.1\|1477400_1478294_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_056988028.1\|1478501_1480343_-	translational GTPase TypA	NA	NA	NA	NA
WP_079579224.1\|1480478_1481258_-	inositol monophosphatase family protein	NA	NA	NA	NA
WP_010494612.1\|1481263_1481554_-	UPF0223 family protein	NA	NA	NA	NA
WP_079579225.1\|1481558_1482476_-	lactate dehydrogenase	NA	NA	NA	NA
WP_079579226.1\|1482595_1483627_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	8.0e-35	31.4
WP_056972721.1\|1483871_1484432_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.5e-11	39.2
WP_010494630.1\|1484493_1484979_-	hypothetical protein	NA	NA	NA	NA
WP_079578748.1\|1485199_1486093_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_010494636.1\|1486291_1486510_+	DNA-dependent RNA polymerase auxiliary subunit epsilon family protein	NA	NA	NA	NA
WP_010494638.1\|1486506_1488183_+	ribonuclease J	NA	NA	NA	NA
WP_079579227.1\|1488273_1489248_+	YegS/Rv2252/BmrU family lipid kinase	A0A1V0SBJ0	Catovirus	6.6e-07	21.9
WP_079578367.1\|1489485_1490727_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.7e-13	24.2
WP_079579228.1\|1490857_1493380_-	ATP-dependent RecD-like DNA helicase	A0A0K2FLP8	Brevibacillus_phage	3.5e-52	25.2
WP_010494650.1\|1493382_1494057_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_010494651.1\|1494101_1494758_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_010494653.1\|1494900_1496028_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_010494655.1\|1496367_1496709_-	DUF1831 domain-containing protein	NA	NA	NA	NA
WP_079579229.1\|1496733_1497876_-	cysteine desulfurase	NA	NA	NA	NA
WP_010494656.1\|1497913_1498597_-	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_010494657.1\|1498659_1498971_-	hypothetical protein	NA	NA	NA	NA
WP_010494658.1\|1498977_1499520_-	NUDIX hydrolase	NA	NA	NA	NA
WP_056971343.1\|1499567_1500554_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_010494660.1\|1500776_1503575_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.3e-87	27.3
WP_010494661.1\|1503905_1504634_-	DivIVA domain-containing protein	NA	NA	NA	NA
WP_172823863.1\|1504665_1505448_-	RNA-binding protein	NA	NA	NA	NA
WP_010494662.1\|1505456_1505723_-	YggT family protein	NA	NA	NA	NA
WP_079579231.1\|1505735_1506155_-	cell division protein SepF	NA	NA	NA	NA
WP_010494664.1\|1506188_1507448_-	cell division protein FtsZ	NA	NA	NA	NA
WP_010494665.1\|1507475_1508828_-	cell division protein FtsA	NA	NA	NA	NA
WP_056988053.1\|1508943_1509801_-	cell division protein FtsQ/DivIB	NA	NA	NA	NA
WP_056971350.1\|1509884_1510979_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_010494675.1\|1510982_1512356_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_010494677.1\|1512487_1513450_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_079579233.1\|1513478_1515635_-	penicillin-binding protein	NA	NA	NA	NA
WP_010494687.1\|1515631_1515997_-	cell division protein FtsL	NA	NA	NA	NA
WP_010494689.1\|1516026_1516977_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_010494692.1\|1517029_1517461_-	division/cell wall cluster transcriptional repressor MraZ	NA	NA	NA	NA
WP_148266320.1\|1517684_1518047_-	DUF3397 family protein	NA	NA	NA	NA
WP_010499933.1\|1518455_1519766_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	8.4e-90	41.9
WP_079579234.1\|1519999_1520119_+	DUF4044 domain-containing protein	NA	NA	NA	NA
WP_079578367.1\|1520331_1521573_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.7e-13	24.2
WP_010494705.1\|1521712_1522651_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_056971396.1\|1522749_1524213_-	cardiolipin synthase	NA	NA	NA	NA
WP_010494714.1\|1524379_1525189_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_056971394.1\|1525190_1525868_-	cell division inhibitor	NA	NA	NA	NA
WP_056988168.1\|1525882_1526395_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_010494722.1\|1526407_1527259_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_148266321.1\|1527432_1528428_-	rod shape-determining protein	NA	NA	NA	NA
WP_010494725.1\|1528559_1528769_-	cold-shock protein	Q9AZD3	Lactococcus_phage	4.7e-11	55.4
WP_029604921.1\|1528971_1529646_-	DNA repair protein RadC	NA	NA	NA	NA
WP_154022025.1\|1529696_1530347_-	HAD family phosphatase	NA	NA	NA	NA
WP_010494734.1\|1530364_1531672_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_010494736.1\|1531824_1534485_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	6.6e-158	42.5
WP_079578404.1\|1534684_1535995_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.3e-90	42.1
WP_010494738.1\|1536660_1537878_-\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_079579235.1\|1537890_1539042_-	cysteine desulfurase	A0A1X6WFP1	Pacmanvirus	1.4e-35	29.1
WP_010494742.1\|1539174_1540890_-	septation ring formation regulator EzrA	NA	NA	NA	NA
WP_056971385.1\|1541058_1541523_+	GAF domain-containing protein	NA	NA	NA	NA
WP_010494744.1\|1541808_1542417_+	30S ribosomal protein S4	NA	NA	NA	NA
WP_079579236.1\|1542615_1543890_+	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	7.7e-96	49.4
WP_056971381.1\|1544734_1545232_+	universal stress protein	NA	NA	NA	NA
WP_010494753.1\|1545335_1545893_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_010494755.1\|1545991_1546840_-	aminoglycoside phosphotransferase family protein	NA	NA	NA	NA
WP_010494757.1\|1547143_1548763_+	amino acid permease	NA	NA	NA	NA
WP_079579237.1\|1548922_1549381_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_079579238.1\|1549392_1550169_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.5e-09	27.6
WP_079579652.1\|1550352_1551738_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.3e-29	30.0
WP_010494765.1\|1552303_1552786_-	GNAT family acetyltransferase	NA	NA	NA	NA
WP_079579239.1\|1553008_1554184_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_079578752.1\|1554439_1555468_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.5e-37	32.2
WP_002320682.1\|1556463_1556664_-	hypothetical protein	NA	NA	NA	NA
WP_079579240.1\|1556708_1557497_-	AAA family ATPase	Q7M293	Enterobacteria_phage	8.3e-08	27.1
WP_079579241.1\|1557681_1558245_-	recombinase family protein	A0A0A8WIK3	Clostridium_phage	1.1e-30	42.0
1558364:1558383	attL	NA	NA	NA	NA
WP_079578404.1\|1558519_1559830_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.3e-90	42.1
WP_079578423.1\|1560817_1562059_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.6e-13	24.2
WP_010499826.1\|1562521_1562785_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_079579243.1\|1562883_1563471_+\|integrase	site-specific integrase	D2XR58	Bacillus_phage	2.2e-21	34.1
WP_010494774.1\|1563498_1563699_-	helix-turn-helix transcriptional regulator	A0A0E3U244	Fusobacterium_phage	5.0e-10	46.2
WP_079579244.1\|1563711_1563945_-	hypothetical protein	NA	NA	NA	NA
WP_010499943.1\|1564087_1565398_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.3e-87	41.2
WP_079578407.1\|1565994_1566732_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	1.1e-51	45.1
1565532:1565551	attR	NA	NA	NA	NA
WP_010499979.1\|1566752_1567973_-\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	2.2e-100	49.5
WP_079579245.1\|1568069_1568537_-	hypothetical protein	NA	NA	NA	NA
WP_056988216.1\|1568558_1569119_-	DUF536 domain-containing protein	NA	NA	NA	NA
WP_146983699.1\|1569542_1569665_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_079579246.1\|1569995_1571402_-	LtrC	NA	NA	NA	NA
WP_079579247.1\|1571404_1571623_-	hypothetical protein	NA	NA	NA	NA
WP_079579248.1\|1571739_1571973_-	hypothetical protein	NA	NA	NA	NA
WP_079579249.1\|1571989_1574167_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	5.7e-115	48.5
WP_079579250.1\|1574184_1574529_-	hypothetical protein	NA	NA	NA	NA
WP_172823864.1\|1574545_1575193_-	conjugal transfer protein	NA	NA	NA	NA
WP_079579252.1\|1575407_1575812_-	hypothetical protein	NA	NA	NA	NA
WP_079579253.1\|1575824_1577354_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_079579254.1\|1577350_1577809_-	conjugal transfer protein	NA	NA	NA	NA
WP_079579255.1\|1577809_1577995_-	hypothetical protein	NA	NA	NA	NA
WP_079579256.1\|1578041_1579070_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.5e-37	32.2
WP_079579257.1\|1579159_1579414_-	hypothetical protein	NA	NA	NA	NA
WP_079579258.1\|1579391_1580009_-	hypothetical protein	NA	NA	NA	NA
WP_079579259.1\|1580025_1580625_-	CHAP domain-containing protein	NA	NA	NA	NA
WP_010499979.1\|1581907_1583128_+\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	2.2e-100	49.5
WP_079578407.1\|1583148_1583886_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	1.1e-51	45.1
WP_010499439.1\|1584265_1585666_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_010499441.1\|1585658_1586105_-	SUF system NifU family Fe-S cluster assembly protein	A0A0K1LSF9	Mycobacterium_phage	2.4e-12	36.9
WP_010499443.1\|1586091_1587330_-	cysteine desulfurase	Q2XUY6	environmental_halophage	7.9e-106	44.5
WP_079579260.1\|1587310_1588594_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_010499455.1\|1588606_1589389_-	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	1.8e-07	27.1
WP_010499457.1\|1589472_1589829_-	arsenate reductase family protein	NA	NA	NA	NA
WP_056971886.1\|1590053_1591250_-	rod shape-determining protein RodA	NA	NA	NA	NA
WP_010499469.1\|1591295_1591514_-	DUF2969 domain-containing protein	NA	NA	NA	NA
WP_029605706.1\|1591491_1591794_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	1.4e-16	57.7
WP_010499471.1\|1591810_1592803_-	rod shape-determining protein	NA	NA	NA	NA
WP_010499472.1\|1593131_1594436_-	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_010499473.1\|1594487_1594724_-	DUF1146 domain-containing protein	NA	NA	NA	NA
WP_079578646.1\|1594973_1596215_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-13	24.0
WP_056971821.1\|1596437_1596857_-	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_010499482.1\|1596871_1598278_-	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_010499484.1\|1598297_1599230_-	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_056988075.1\|1599247_1600759_-	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_010499494.1\|1600779_1601322_-	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
WP_010499496.1\|1601308_1601833_-	F0F1 ATP synthase subunit B	NA	NA	NA	NA
WP_010499498.1\|1601878_1602109_-	F0F1 ATP synthase subunit C	NA	NA	NA	NA
WP_010499500.1\|1602138_1602849_-	F0F1 ATP synthase subunit A	NA	NA	NA	NA
WP_010499502.1\|1603182_1603812_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_010499504.1\|1603919_1604942_-	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	1.8e-50	38.2
WP_079579261.1\|1604960_1605806_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_079579262.1\|1605798_1606884_-	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	1.1e-05	39.7
WP_056988077.1\|1606938_1607514_-	thymidine kinase	V9VG58	Lactococcus_phage	7.8e-48	52.9
WP_010499511.1\|1607742_1609092_+	Mur ligase family protein	NA	NA	NA	NA
WP_079579263.1\|1609091_1609793_+	glutamine amidotransferase	NA	NA	NA	NA
WP_079579635.1\|1609869_1611255_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.3e-29	30.0
WP_010499521.1\|1611783_1612749_-	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
WP_079579264.1\|1613108_1614350_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.7e-13	24.0
WP_029605717.1\|1614474_1615476_-	serine hydrolase	NA	NA	NA	NA
WP_010499526.1\|1615481_1616144_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_010499528.1\|1616171_1616438_-	hypothetical protein	NA	NA	NA	NA
WP_079579265.1\|1616523_1617264_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-34	41.4
WP_057785074.1\|1617885_1619064_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_079578588.1\|1619314_1620625_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.1e-89	41.6
WP_079578748.1\|1621076_1621970_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_079579665.1\|1623526_1624966_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.4e-29	30.0
WP_079579310.1\|1625471_1626857_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.8e-29	30.3
WP_010499866.1\|1627725_1628034_-	hypothetical protein	NA	NA	NA	NA
WP_010499867.1\|1628380_1628977_-	XTP/dITP diphosphatase	A0A2H4UUV7	Bodo_saltans_virus	1.0e-10	29.1
WP_010499869.1\|1629146_1629635_+	YslB family protein	NA	NA	NA	NA
WP_079579310.1\|1631187_1632573_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.8e-29	30.3
WP_010499108.1\|1633181_1635542_-	endonuclease MutS2	Q94M10	Lactobacillus_phage	2.0e-20	47.8
WP_010499106.1\|1635564_1636077_-	CvpA family protein	NA	NA	NA	NA
WP_010499104.1\|1636088_1636340_-	cell division protein ZapA	NA	NA	NA	NA
WP_010499101.1\|1636532_1636835_-	DUF1292 domain-containing protein	NA	NA	NA	NA
WP_010499099.1\|1636852_1637293_-	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_010499097.1\|1637292_1637556_-	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_079579266.1\|1637694_1640346_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	9.1e-67	34.8

DBSCAN-SWA_12

1680864 : 1757153

Streptococcus_phage(23.81%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010498999.1\|1680864_1681377_-\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_079579291.1\|1681706_1682567_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_056988047.1\|1682588_1683104_-\|tRNA	aminoacyl-tRNA deacylase	NA	NA	NA	NA
WP_079578404.1\|1683362_1684673_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.3e-90	42.1
WP_010498973.1\|1685029_1686007_+	GMP reductase	Q4ZCY7	Staphylococcus_virus	1.0e-140	72.8
WP_010498971.1\|1686089_1686449_-	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_010498969.1\|1686640_1687672_+	lactonase family protein	NA	NA	NA	NA
WP_172823865.1\|1687687_1688335_+	copper homeostasis protein CutC	NA	NA	NA	NA
WP_010499943.1\|1688475_1689786_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.3e-87	41.2
WP_079579668.1\|1690474_1691860_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.0e-29	30.0
WP_056971699.1\|1691952_1693437_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_010498953.1\|1693481_1694645_-	galactokinase	NA	NA	NA	NA
WP_010498952.1\|1694793_1695801_+	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	1.5e-09	25.8
WP_056971694.1\|1695871_1697242_-	magnesium transporter	NA	NA	NA	NA
WP_010498948.1\|1697255_1698149_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_079579293.1\|1698145_1698955_-	NAD kinase	NA	NA	NA	NA
WP_079579294.1\|1700378_1702184_-	oligoendopeptidase F	NA	NA	NA	NA
WP_079579295.1\|1702325_1703345_-	hypothetical protein	NA	NA	NA	NA
WP_010498926.1\|1703470_1704220_-	adaptor protein MecA	NA	NA	NA	NA
WP_079578369.1\|1704478_1705762_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.1e-48	31.7
WP_010498925.1\|1705852_1706251_-	transcriptional regulator Spx	NA	NA	NA	NA
WP_056988166.1\|1706625_1707312_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0C5K925	Enterococcus_phage	3.6e-52	55.2
WP_079579296.1\|1707312_1709475_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.3e-249	58.9
WP_079579297.1\|1709616_1709931_+	helix-turn-helix transcriptional regulator	A0A1B0Y3N1	Lactobacillus_phage	1.1e-19	46.2
WP_079579298.1\|1709931_1710339_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	1.2e-21	39.0
WP_079579299.1\|1710379_1710877_+	PH domain-containing protein	Q9B015	Lactococcus_phage	4.2e-26	41.7
WP_079578423.1\|1712298_1713540_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.6e-13	24.2
WP_010497049.1\|1720575_1722657_-	LTA synthase family protein	W6LM83	Streptococcus_phage	7.5e-149	45.8
WP_010497047.1\|1722759_1722993_-	YkuJ family protein	NA	NA	NA	NA
WP_079579301.1\|1723216_1724230_-	flippase-like domain-containing protein	NA	NA	NA	NA
WP_010497042.1\|1724229_1725255_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_010497040.1\|1725278_1726457_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_079579302.1\|1726681_1728403_-	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_010497037.1\|1728402_1728669_-	phosphocarrier protein HPr	NA	NA	NA	NA
WP_010497036.1\|1729025_1729220_-	hypothetical protein	NA	NA	NA	NA
WP_079579303.1\|1729401_1731624_+\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	1.2e-120	39.9
WP_010497034.1\|1731852_1732134_+	DUF1827 family protein	NA	NA	NA	NA
WP_079579304.1\|1732342_1733470_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_010497032.1\|1733677_1735255_-	peptide chain release factor 3	A0A1B0RXH7	Streptococcus_phage	2.9e-28	25.3
WP_079579305.1\|1735369_1736734_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_056971524.1\|1736805_1738257_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-09	26.0
WP_010497029.1\|1738442_1739489_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_010497028.1\|1739754_1740300_-	DUF402 domain-containing protein	NA	NA	NA	NA
WP_079579669.1\|1740420_1741773_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	1.4e-79	35.3
WP_010497025.1\|1741981_1742779_+	recombination regulator RecX	NA	NA	NA	NA
WP_010497023.1\|1743007_1743937_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_172823839.1\|1743964_1744360_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_010497012.1\|1744719_1745592_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	2.5e-74	49.1
WP_010497010.1\|1745758_1746544_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_010497008.1\|1746779_1747247_+	flavodoxin	NA	NA	NA	NA
WP_010497006.1\|1747243_1747663_+	GtrA family protein	NA	NA	NA	NA
WP_079579307.1\|1748262_1751148_+	YfhO family protein	NA	NA	NA	NA
WP_079579308.1\|1751329_1752472_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	1.8e-24	28.2
WP_010496991.1\|1752924_1753338_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_010496989.1\|1753473_1754760_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.6e-37	31.9
WP_010496987.1\|1754749_1755787_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_010496978.1\|1756478_1757153_-\|protease	matrixin family metalloprotease	W6JIV8	Anomala_cuprea_entomopoxvirus	5.6e-05	35.6

DBSCAN-SWA_13

1761185 : 1831059

Erysipelothrix_phage(50.0%)

capsid,head,terminase,integrase,protease,tail,tRNA,transposase,holin

attL 1808038:1808097|attR 1810013:1810366

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010500073.1\|1761185_1762145_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_079578848.1\|1763612_1764998_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.9e-30	30.3
WP_079579310.1\|1765503_1766889_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.8e-29	30.3
WP_079579311.1\|1767554_1767929_+	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_079579312.1\|1768897_1770169_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_079579313.1\|1770300_1771488_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_079579314.1\|1772777_1773293_+	ECF transporter S component	NA	NA	NA	NA
WP_010496960.1\|1773411_1773603_+	hypothetical protein	NA	NA	NA	NA
WP_079579315.1\|1773729_1774485_-	class II aldolase/adducin family protein	NA	NA	NA	NA
WP_079579316.1\|1774481_1774739_-	hypothetical protein	NA	NA	NA	NA
WP_079579317.1\|1774755_1776306_-	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_079579318.1\|1776327_1776645_-	PTS galactitol transporter subunit IIB	NA	NA	NA	NA
WP_079579319.1\|1776657_1777125_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_079579320.1\|1777465_1778242_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_079578626.1\|1778479_1779997_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	6.6e-38	28.7
WP_148095623.1\|1780131_1780503_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_079578630.1\|1780495_1780678_-	hypothetical protein	NA	NA	NA	NA
WP_079579321.1\|1783141_1783738_-	hypothetical protein	NA	NA	NA	NA
WP_079579322.1\|1783759_1784653_-	abortive infection family protein	NA	NA	NA	NA
WP_172823841.1\|1784657_1785866_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_079579324.1\|1785858_1787811_-	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_079579325.1\|1787811_1790520_-	class I SAM-dependent DNA methyltransferase	Q6NE04	Leptospira_phage	5.7e-141	35.5
WP_079579326.1\|1790535_1790751_-	helix-turn-helix transcriptional regulator	A0A2K5B263	Erysipelothrix_phage	4.1e-18	65.2
WP_079579327.1\|1790762_1793375_-	helicase	NA	NA	NA	NA
WP_079579328.1\|1793379_1794702_-	DUF1837 domain-containing protein	NA	NA	NA	NA
WP_079579329.1\|1795072_1795591_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_079579330.1\|1795689_1795893_+	hypothetical protein	A0A2I4R673	Erysipelothrix_phage	7.5e-06	36.2
WP_079579331.1\|1795876_1796212_+	hypothetical protein	A0A2K5B2A7	Erysipelothrix_phage	1.9e-06	34.9
WP_172823842.1\|1797348_1797900_+	DUF2815 family protein	A0A2K5B2A9	Erysipelothrix_phage	6.1e-74	73.8
WP_079579332.1\|1799959_1800364_+	hypothetical protein	NA	NA	NA	NA
WP_079579333.1\|1800366_1802622_+	primase C-terminal domain-containing protein	A0A1X9I6B6	Streptococcus_phage	4.4e-211	48.2
WP_079579334.1\|1802835_1803117_+	VRR-NUC domain-containing protein	A0A1B0RXC4	Streptococcus_phage	7.5e-20	52.2
WP_079579335.1\|1804436_1804904_+	restriction endonuclease	NA	NA	NA	NA
WP_079579336.1\|1805050_1805428_+	HNH endonuclease	A0A2K5B276	Erysipelothrix_phage	6.7e-32	54.7
WP_079579337.1\|1805547_1806090_+\|terminase	terminase	A0A2K5B277	Erysipelothrix_phage	1.4e-54	57.1
WP_063507627.1\|1806095_1806374_-	hypothetical protein	NA	NA	NA	NA
WP_154022029.1\|1806564_1808037_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
1808038:1808097	attL	NA	NA	NA	NA
WP_154022029.1\|1808539_1810012_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_079579339.1\|1810511_1810718_+	DUF5049 domain-containing protein	NA	NA	NA	NA
1810013:1810366	attR	NA	NA	NA	NA
WP_079579671.1\|1810818_1812381_+\|terminase	terminase large subunit	A0A2K5B285	Erysipelothrix_phage	1.4e-245	76.2
WP_079579340.1\|1812451_1812679_+	hypothetical protein	NA	NA	NA	NA
WP_079579672.1\|1812681_1812960_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_079579341.1\|1814409_1815081_+\|protease	Clp protease ClpP	Q6DMU1	Streptococcus_phage	3.7e-57	50.9
WP_079579342.1\|1815100_1816279_+\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	8.3e-129	58.5
WP_079579343.1\|1816295_1816574_+\|head,tail	phage gp6-like head-tail connector protein	A0A1X9I695	Streptococcus_phage	1.4e-07	38.9
WP_079579344.1\|1816574_1816952_+\|head	phage head closure protein	A0A0A7RUH8	Clostridium_phage	4.2e-10	34.5
WP_079579345.1\|1816948_1817359_+\|holin	phage holin family protein	A0A2K5B2A2	Erysipelothrix_phage	2.9e-41	63.1
WP_079579346.1\|1817355_1818234_+	1,4-beta-N-acetylmuramidase	A0A1U9WQS3	Geobacillus_phage	3.1e-11	27.4
WP_079579347.1\|1818325_1818562_+	hypothetical protein	NA	NA	NA	NA
WP_079579348.1\|1820242_1821820_+	recombinase family protein	A0A2K5B2B4	Erysipelothrix_phage	8.8e-134	49.6
WP_079579673.1\|1821867_1823268_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_079579349.1\|1823286_1824000_-	hypothetical protein	NA	NA	NA	NA
WP_079579350.1\|1824497_1825874_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	4.7e-123	49.8
WP_056988074.1\|1826794_1827823_-	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	5.0e-21	27.7
WP_010496864.1\|1827856_1829290_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_010496862.1\|1829289_1830753_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_079579351.1\|1830756_1831059_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA

DBSCAN-SWA_14

1895189 : 1997521

Mycobacterium_phage(14.81%)

tRNA,transposase,integrase,protease

attL 1953556:1953569|attR 1989151:1989164

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079579370.1\|1895189_1896500_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	3.2e-89	41.4
WP_079579371.1\|1896863_1897430_+	cysteine hydrolase	G3MA16	Bacillus_virus	1.6e-21	35.5
WP_010496686.1\|1897503_1899597_-	elongation factor G	E4ZFJ7	Streptococcus_phage	6.1e-66	26.9
WP_010496685.1\|1899748_1900219_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_010496682.1\|1900284_1900698_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_010496681.1\|1900948_1901641_+	prepilin peptidase	NA	NA	NA	NA
WP_079579372.1\|1901720_1903106_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.3e-29	27.8
WP_010499362.1\|1903702_1907368_-	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	1.1e-67	25.0
WP_148266373.1\|1907407_1911001_-	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	1.0e-52	25.7
WP_010499359.1\|1911308_1913780_-\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	2.1e-126	39.8
WP_010499357.1\|1913884_1914352_-	CtsR family transcriptional regulator	NA	NA	NA	NA
WP_079579373.1\|1915044_1916286_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.2e-13	24.3
WP_010498448.1\|1923061_1924315_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	2.2e-87	40.8
WP_010498446.1\|1924708_1925164_-	transcriptional repressor	NA	NA	NA	NA
WP_010498444.1\|1925300_1925891_-	metal-dependent hydrolase	NA	NA	NA	NA
WP_010498442.1\|1925928_1929057_-	SMC family ATPase	A0A1D8KRV2	Synechococcus_phage	2.1e-09	26.6
WP_010498440.1\|1929043_1930180_-	exonuclease SbcCD subunit D	NA	NA	NA	NA
WP_010498439.1\|1930276_1930684_-	hypothetical protein	NA	NA	NA	NA
WP_010498437.1\|1931313_1932042_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_079579375.1\|1932271_1933513_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.2e-13	23.7
WP_010498428.1\|1933699_1934890_-	class I SAM-dependent methyltransferase	A0A2K9L4K8	Tupanvirus	9.8e-45	38.7
WP_079579376.1\|1934943_1935627_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	1.7e-17	45.7
WP_079579377.1\|1935900_1936998_-	glycosyltransferase	NA	NA	NA	NA
WP_010498423.1\|1937212_1938010_-	tyrosine-protein phosphatase	NA	NA	NA	NA
WP_010498421.1\|1938288_1938879_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_010498419.1\|1938958_1940020_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_079579378.1\|1940195_1940726_-	hypothetical protein	NA	NA	NA	NA
WP_010498416.1\|1941432_1942224_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_004271276.1\|1942363_1943287_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.2e-31	30.9
WP_010498407.1\|1943338_1943782_-	ASCH domain-containing protein	NA	NA	NA	NA
WP_079579379.1\|1944009_1945251_-	peptidase T	NA	NA	NA	NA
WP_010498403.1\|1947265_1947955_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_010498401.1\|1948185_1948635_-	hypothetical protein	NA	NA	NA	NA
WP_010498399.1\|1949363_1950209_-	hypothetical protein	NA	NA	NA	NA
WP_010498396.1\|1950333_1951014_-	hypothetical protein	NA	NA	NA	NA
WP_010498394.1\|1951236_1952097_-	arginase family protein	A0A1V0SJM8	Klosneuvirus	1.3e-09	27.3
WP_010498393.1\|1952302_1952722_-	OsmC family protein	NA	NA	NA	NA
WP_010498391.1\|1952755_1953508_-	hypothetical protein	NA	NA	NA	NA
1953556:1953569	attL	NA	NA	NA	NA
WP_056972717.1\|1953573_1954401_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	8.5e-104	65.9
WP_079579310.1\|1954571_1955957_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.8e-29	30.3
WP_010498381.1\|1956395_1957946_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	3.2e-48	31.3
WP_154022033.1\|1958010_1958388_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_079579380.1\|1958753_1959152_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_010498364.1\|1959779_1960028_+	DUF3173 family protein	NA	NA	NA	NA
WP_010498362.1\|1960031_1961225_+\|integrase	site-specific integrase	A0A0S2MV79	Bacillus_phage	4.7e-39	32.2
WP_172823867.1\|1961289_1962828_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.5e-16	29.4
WP_056988104.1\|1962949_1963873_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	1.3e-31	33.8
WP_010498357.1\|1964054_1964615_+	lipase	NA	NA	NA	NA
WP_010498355.1\|1964992_1967296_-	AAA family ATPase	NA	NA	NA	NA
WP_079579381.1\|1967495_1969367_+	monovalent cation:proton antiporter family protein	NA	NA	NA	NA
WP_056971998.1\|1969452_1970121_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_079579382.1\|1970148_1970817_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_056988103.1\|1971031_1971214_+	hypothetical protein	NA	NA	NA	NA
WP_079579383.1\|1971203_1971560_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_079579384.1\|1971706_1973275_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	9.0e-38	28.0
WP_010498341.1\|1973790_1974774_-	NERD domain-containing protein	NA	NA	NA	NA
WP_079579385.1\|1974989_1976231_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.2e-13	23.7
WP_010498333.1\|1976414_1977395_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.3e-22	33.2
WP_056988173.1\|1977419_1978460_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.8e-17	31.1
WP_010498331.1\|1978469_1979504_-	ABC transporter permease	NA	NA	NA	NA
WP_010498329.1\|1979507_1980437_-	ABC transporter permease	NA	NA	NA	NA
WP_079579386.1\|1980686_1982312_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_079579387.1\|1982711_1983974_+	GTPase HflX	NA	NA	NA	NA
WP_079579388.1\|1984027_1984438_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003561820.1\|1984725_1985604_-\|transposase	IS982-like element ISLpl4 family transposase	NA	NA	NA	NA
WP_056972535.1\|1986240_1986894_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_010498313.1\|1986907_1987546_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_079579389.1\|1987542_1988373_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_172823868.1\|1988385_1989120_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.3e-34	42.3
WP_079579391.1\|1989518_1990529_-	hypothetical protein	NA	NA	NA	NA
1989151:1989164	attR	NA	NA	NA	NA
WP_079578748.1\|1990722_1991616_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_079579392.1\|1991605_1992040_-	hypothetical protein	NA	NA	NA	NA
WP_056971938.1\|1992710_1993139_-	transcriptional repressor	NA	NA	NA	NA
WP_056971937.1\|1993270_1993852_-	AAA family ATPase	NA	NA	NA	NA
WP_079579393.1\|1994131_1995529_+	amino acid permease	NA	NA	NA	NA
WP_010498298.1\|1995597_1995981_-	VOC family protein	NA	NA	NA	NA
WP_079579394.1\|1996279_1997521_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-13	24.2

DBSCAN-SWA_15

2061643 : 2200956

103

Streptococcus_phage(25.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079579420.1\|2061643_2062822_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_079579421.1\|2063274_2064075_-	OmpA family protein	NA	NA	NA	NA
WP_010498457.1\|2064097_2064880_-	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_010498459.1\|2065013_2065403_-	flagellar export chaperone FliS	NA	NA	NA	NA
WP_010498460.1\|2065464_2065794_-	hypothetical protein	NA	NA	NA	NA
WP_079579422.1\|2065821_2067282_-	flagellar filament capping protein FliD	NA	NA	NA	NA
WP_010498465.1\|2067290_2067725_-	flagellar protein FlaG	NA	NA	NA	NA
WP_079578317.1\|2068194_2069580_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.5e-28	29.7
WP_079579423.1\|2070064_2070952_-	flagellin	NA	NA	NA	NA
WP_079579424.1\|2071141_2071963_-	flagellin	NA	NA	NA	NA
WP_079579425.1\|2072149_2072767_-	LysM peptidoglycan-binding domain-containing protein	A0A249XZV3	Enterococcus_phage	9.6e-20	37.9
WP_010499943.1\|2073254_2074565_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.3e-87	41.2
WP_079579426.1\|2075241_2077380_+	hypothetical protein	NA	NA	NA	NA
WP_010498484.1\|2077612_2077870_-	hypothetical protein	NA	NA	NA	NA
WP_079579427.1\|2078068_2079058_+	aldo/keto reductase	NA	NA	NA	NA
WP_056972400.1\|2079172_2079466_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	1.2e-07	46.3
WP_056972398.1\|2079480_2079768_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_079579428.1\|2084230_2086843_-	alpha-mannosidase	NA	NA	NA	NA
WP_010498509.1\|2088042_2088369_-	PTS fructose transporter subunit IIB	NA	NA	NA	NA
WP_172823845.1\|2088390_2088849_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_079579430.1\|2089159_2090188_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.4e-36	32.0
WP_079579431.1\|2090201_2090441_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_050955744.1\|2090465_2092025_-	PRD domain-containing protein	NA	NA	NA	NA
WP_010499943.1\|2092283_2093594_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.3e-87	41.2
WP_010498520.1\|2093839_2094940_+	glycosyl hydrolase	NA	NA	NA	NA
WP_079579433.1\|2095123_2097070_-	acyltransferase	T1SAQ6	Salmonella_phage	2.3e-22	24.7
WP_010498525.1\|2097032_2097428_-	hypothetical protein	NA	NA	NA	NA
WP_010498527.1\|2097605_2098715_-\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
WP_010498529.1\|2099100_2099424_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	1.6e-18	37.8
WP_010498531.1\|2099432_2100257_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_010498533.1\|2100457_2101198_-	TerC family protein	S5MAL1	Bacillus_phage	9.1e-41	47.1
WP_079579434.1\|2101255_2102221_-	acyltransferase family protein	NA	NA	NA	NA
WP_079579435.1\|2102168_2102342_-	acyltransferase family protein	NA	NA	NA	NA
WP_010498536.1\|2102406_2102814_-	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.5e-08	32.5
WP_172823846.1\|2103991_2105842_+	sulfatase-like hydrolase/transferase	NA	NA	NA	NA
WP_079579437.1\|2105946_2106681_-	L,D-transpeptidase	NA	NA	NA	NA
WP_010498566.1\|2106837_2107773_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_158308975.1\|2107974_2108208_-	hypothetical protein	NA	NA	NA	NA
WP_148266364.1\|2108480_2108861_-	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	1.1e-05	35.7
WP_010498571.1\|2109021_2109921_-	PAS domain-containing protein	NA	NA	NA	NA
WP_056988085.1\|2110276_2110894_-	PAS domain S-box protein	NA	NA	NA	NA
WP_056972755.1\|2111077_2111545_-	hypothetical protein	NA	NA	NA	NA
WP_079578404.1\|2113111_2114422_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.3e-90	42.1
WP_079579441.1\|2117220_2118387_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_010498604.1\|2118823_2119867_-	LysM peptidoglycan-binding domain-containing protein	A0A2P0ZLG0	Lactobacillus_phage	3.9e-13	47.3
WP_079578752.1\|2121478_2122507_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.5e-37	32.2
WP_079579442.1\|2125104_2125767_-	class II aldolase/adducin family protein	NA	NA	NA	NA
WP_154022058.1\|2125768_2127142_-	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_079579444.1\|2127166_2127454_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_079579445.1\|2127466_2127934_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_079579446.1\|2128845_2130009_-	glycerate kinase	W6LM47	Streptococcus_phage	2.9e-49	39.0
WP_079579447.1\|2130295_2130460_-	hypothetical protein	NA	NA	NA	NA
WP_079579448.1\|2130764_2130983_+	helix-turn-helix transcriptional regulator	A0A2R2ZGJ3	Clostridioides_phage	6.2e-06	39.1
WP_079578614.1\|2131230_2132616_-\|transposase	ISLre2 family transposase	NA	NA	NA	NA
WP_010498628.1\|2134324_2135281_+	LCP family protein	NA	NA	NA	NA
WP_079579450.1\|2135526_2135748_-	hypothetical protein	NA	NA	NA	NA
WP_079579451.1\|2135944_2137255_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.4e-89	41.9
WP_079579452.1\|2137855_2138761_-	SH3 domain-containing protein	U3PJ04	Lactobacillus_phage	4.4e-53	39.7
WP_079579453.1\|2138842_2139070_-	DUF2922 domain-containing protein	NA	NA	NA	NA
WP_010498667.1\|2139097_2139304_-	DUF1659 domain-containing protein	NA	NA	NA	NA
WP_079579454.1\|2139738_2140440_-	zinc metallopeptidase	NA	NA	NA	NA
WP_079579455.1\|2141138_2141369_-	DUF2922 domain-containing protein	NA	NA	NA	NA
WP_079579456.1\|2141425_2141623_-	hypothetical protein	NA	NA	NA	NA
WP_079579457.1\|2141757_2142306_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_010498674.1\|2142573_2143347_+	hypothetical protein	NA	NA	NA	NA
WP_056971530.1\|2143456_2144206_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_079579677.1\|2144384_2145704_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_056971531.1\|2145844_2147278_+	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_079579458.1\|2147377_2148280_+	ROK family protein	NA	NA	NA	NA
WP_079579459.1\|2148398_2149493_+	acyltransferase family protein	NA	NA	NA	NA
WP_010499979.1\|2149847_2151068_+\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	2.2e-100	49.5
WP_079578407.1\|2151088_2151826_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	1.1e-51	45.1
WP_079579460.1\|2153736_2154702_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.1e-74	44.5
WP_079579461.1\|2154923_2155790_+	DegV family protein	NA	NA	NA	NA
WP_079579462.1\|2156317_2158168_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.8e-69	30.2
WP_079578752.1\|2158477_2159506_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.5e-37	32.2
WP_010500073.1\|2159833_2160793_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_079578848.1\|2162261_2163647_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.9e-30	30.3
WP_079579635.1\|2165652_2167038_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.3e-29	30.0
WP_172823869.1\|2167620_2170710_-	glycosyl hydrolase family 70	NA	NA	NA	NA
WP_079579464.1\|2173514_2174516_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_079579465.1\|2174646_2175849_-	hypothetical protein	NA	NA	NA	NA
WP_079579466.1\|2175979_2177185_-	hypothetical protein	NA	NA	NA	NA
WP_079579467.1\|2177207_2178623_-	polysaccharide biosynthesis C-terminal domain-containing protein	NA	NA	NA	NA
WP_079579468.1\|2178629_2179745_-	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	3.2e-162	75.4
WP_172823848.1\|2179771_2180806_-	glycosyltransferase	NA	NA	NA	NA
WP_079579470.1\|2180963_2181746_-	hypothetical protein	A0A2K9L639	Tupanvirus	2.4e-07	25.8
WP_079579471.1\|2181758_2182760_-	sugar transferase	Q5ULS2	Lactobacillus_virus	3.6e-16	24.4
WP_172823849.1\|2182899_2184024_-	glycosyltransferase	NA	NA	NA	NA
WP_079579473.1\|2184013_2184856_-	LicD family protein	A0A1V0SD50	Indivirus	5.7e-07	41.3
WP_079579474.1\|2184845_2185628_-	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_079579475.1\|2185649_2186300_-	sugar transferase	NA	NA	NA	NA
WP_079579476.1\|2186728_2187730_-	sugar transferase	NA	NA	NA	NA
WP_079579477.1\|2187762_2188779_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_079579478.1\|2188945_2190280_-	hypothetical protein	NA	NA	NA	NA
WP_079579479.1\|2190401_2191334_-	glycosyltransferase	V5USA4	Oenococcus_phage	1.0e-81	51.5
WP_154022035.1\|2191361_2193038_-	hypothetical protein	NA	NA	NA	NA
WP_079579678.1\|2193434_2193842_+	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	2.2e-20	42.2
WP_079579481.1\|2195302_2195626_+	GtrA family protein	NA	NA	NA	NA
WP_079578956.1\|2195848_2197090_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	4.6e-13	24.0
WP_079579482.1\|2197212_2198343_-	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_003561746.1\|2198675_2199851_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_079579483.1\|2199996_2200956_+\|transposase	IS30 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

2320414 : 2366311

Streptococcus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010499933.1\|2320414_2321725_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	8.4e-90	41.9
WP_079579526.1\|2322005_2322779_-	acetoin reductase	A0A2P0VP75	Tetraselmis_virus	8.4e-05	27.1
WP_079579527.1\|2323445_2325851_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	9.0e-122	32.6
WP_079579528.1\|2326006_2326519_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_172823851.1\|2327634_2327943_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_079578928.1\|2328160_2329339_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_079579530.1\|2329600_2330101_-	kinase	NA	NA	NA	NA
WP_010499943.1\|2330572_2331883_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.3e-87	41.2
WP_079579531.1\|2332288_2334217_-	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	4.4e-95	37.6
WP_010497768.1\|2334216_2334489_-	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_079579532.1\|2334859_2335231_-	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_079579533.1\|2335256_2335694_-	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_079579534.1\|2335988_2336840_+	aldo/keto reductase	A0A1V0SDE7	Indivirus	8.6e-35	33.3
WP_172823870.1\|2336956_2339455_-	ERAP1-like C-terminal domain-containing protein	A0A0P0IY26	Acinetobacter_phage	1.2e-68	25.5
WP_010497777.1\|2339962_2340487_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_154022040.1\|2340655_2342035_+\|transposase	transposase	NA	NA	NA	NA
WP_010497779.1\|2342569_2342869_-	hypothetical protein	NA	NA	NA	NA
WP_056971708.1\|2343154_2343916_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	4.4e-14	29.4
WP_010497783.1\|2344045_2344693_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_079579537.1\|2344845_2345943_-	glycerol dehydrogenase	NA	NA	NA	NA
WP_010497787.1\|2346209_2347028_+	glycyl-radical enzyme activating protein	NA	NA	NA	NA
WP_079579538.1\|2347240_2349679_+	glycyl radical protein	A0A060AHY5	Cronobacter_phage	2.2e-06	47.2
WP_079579539.1\|2349697_2350378_+	fructose-6-phosphate aldolase	A0A1D8KKK9	Synechococcus_phage	2.1e-20	31.0
WP_079579540.1\|2351195_2353106_+	peptidase M13	E3T4I7	Cafeteria_roenbergensis_virus	2.6e-63	29.6
WP_010497795.1\|2353363_2354740_+	Nramp family divalent metal transporter	NA	NA	NA	NA
WP_172823852.1\|2355854_2356520_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010497799.1\|2356526_2357300_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_010497801.1\|2357296_2358121_+	glycosyl transferase	NA	NA	NA	NA
WP_010497804.1\|2358145_2359117_+	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_056988051.1\|2359113_2359977_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_010497813.1\|2360119_2360560_-	universal stress protein	NA	NA	NA	NA
WP_079579542.1\|2360719_2361211_-	hypothetical protein	NA	NA	NA	NA
WP_079579543.1\|2361412_2362798_+\|transposase	ISLre2 family transposase	NA	NA	NA	NA
WP_079579544.1\|2363115_2363616_+	hypothetical protein	NA	NA	NA	NA
WP_154022041.1\|2364673_2364919_+	AzlD domain-containing protein	NA	NA	NA	NA
WP_079579394.1\|2365069_2366311_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-13	24.2

DBSCAN-SWA_17

2522641 : 2586678

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079579612.1\|2522641_2523820_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_056972039.1\|2524074_2524440_+	hypothetical protein	NA	NA	NA	NA
WP_079579613.1\|2524593_2525967_-	MFS transporter	NA	NA	NA	NA
WP_056972038.1\|2526006_2527536_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_010495808.1\|2527863_2528262_+	hypothetical protein	NA	NA	NA	NA
WP_010495807.1\|2528506_2529874_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_079579614.1\|2530082_2530310_+	HIT family protein	NA	NA	NA	NA
WP_079579615.1\|2530605_2532126_-	glutamate/gamma-aminobutyrate family transporter YjeM	NA	NA	NA	NA
WP_010499943.1\|2532666_2533977_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.3e-87	41.2
WP_056971984.1\|2536038_2536647_-	DedA family protein	NA	NA	NA	NA
WP_079579616.1\|2537430_2537715_-	hypothetical protein	NA	NA	NA	NA
WP_154022046.1\|2537879_2539835_-	hypothetical protein	NA	NA	NA	NA
WP_079579618.1\|2540201_2541122_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_079579619.1\|2541392_2542313_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	8.9e-62	45.4
WP_079579620.1\|2542569_2543487_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_079579621.1\|2543497_2543956_+	GNAT family N-acetyltransferase	E9LUK4	Lactobacillus_phage	2.9e-53	67.1
WP_079579622.1\|2544233_2545031_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_079579623.1\|2545203_2545917_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010495771.1\|2546545_2547898_+	amino acid permease	NA	NA	NA	NA
WP_172823853.1\|2548414_2549200_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.5e-14	26.6
WP_010495767.1\|2549192_2549921_-	iron ABC transporter permease	NA	NA	NA	NA
WP_079579624.1\|2549917_2550940_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	8.2e-16	25.9
WP_079578404.1\|2552005_2553316_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.3e-90	42.1
WP_010495755.1\|2553877_2555323_-	catalase	A0A2K9L0T1	Tupanvirus	5.3e-101	40.2
WP_050955717.1\|2555525_2556041_+	biotin transporter BioY	NA	NA	NA	NA
WP_010495752.1\|2556133_2556730_-	dephospho-CoA kinase	NA	NA	NA	NA
WP_010495751.1\|2556850_2557660_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_079579626.1\|2558406_2559582_+	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	1.7e-57	34.5
WP_056972146.1\|2559754_2560660_+	metallophosphoesterase	NA	NA	NA	NA
WP_079579627.1\|2560865_2561282_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_010495744.1\|2561500_2562883_-	argininosuccinate lyase	NA	NA	NA	NA
WP_010495741.1\|2562900_2564124_-	argininosuccinate synthase	NA	NA	NA	NA
WP_056971860.1\|2564462_2565281_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_056971861.1\|2565360_2565894_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_079579628.1\|2565961_2567545_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_010495726.1\|2567611_2567809_-	hypothetical protein	NA	NA	NA	NA
WP_010495724.1\|2567811_2568375_-	hypothetical protein	NA	NA	NA	NA
WP_154022047.1\|2568885_2569032_-	hypothetical protein	NA	NA	NA	NA
WP_010495721.1\|2569021_2569297_-	hypothetical protein	NA	NA	NA	NA
WP_010495720.1\|2569375_2569882_-	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	1.1e-29	43.5
WP_010495718.1\|2570032_2570788_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_010495716.1\|2570793_2571435_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.2e-22	33.8
WP_010495714.1\|2571632_2572106_-	glutathione peroxidase	NA	NA	NA	NA
WP_079579629.1\|2572284_2573244_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_056988145.1\|2573245_2573500_-	hypothetical protein	NA	NA	NA	NA
WP_010495704.1\|2574098_2575190_+	pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha	NA	NA	NA	NA
WP_010495702.1\|2575192_2576170_+	alpha-ketoacid dehydrogenase subunit beta	NA	NA	NA	NA
WP_010495699.1\|2576303_2577926_+	2-oxo acid dehydrogenase subunit E2	NA	NA	NA	NA
WP_010495698.1\|2577930_2579337_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	8.9e-45	28.1
WP_079578367.1\|2579503_2580745_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.7e-13	24.2
WP_010495697.1\|2581132_2582155_+	lipoate--protein ligase	NA	NA	NA	NA
WP_035630993.1\|2582370_2583333_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_079579686.1\|2583457_2585359_-	fructose-1,6-bisphosphatase	NA	NA	NA	NA
WP_003561820.1\|2585799_2586678_-\|transposase	IS982-like element ISLpl4 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LT630287

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection