CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP054569	Achromobacter denitrificans strain FDAARGOS_787 chromosome, complete genome	10 crisprs	csa3,DEDDh,DinG,WYL,RT	0	1	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP054569_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054569_1

660166-660262

Orphan

Consensus_repeat	Method
CGGCAGCATGGGTTTCGCGTGTTCGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054569_1

>merge|NZ_CP054569|1|660166-660262|CRISPRCasFinder
CGGCAGCATGGGTTTCGCGTGTTCGGCTGTGAGCAGATTCTGTTCCGCAGCGGGCAAAAAAATCTGCTCACGGCAGCATGGGTTTCGCGCGTTCGGC

>NZ_CP054569|1|1|660166-660262|CRISPRCasFinder
CGGCAGCATGGGTTTCGCGTGTTCGGC	TGTGAGCAGATTCTGTTCCGCAGCGGGCAAAAAAATCTGCTCA
CGGCAGCATGGGTTTCGCGCGTTCGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054569.1\|WP_062684164.1\|666298_666646_+\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|225753
NZ_CP054569.1\|WP_125284279.1\|656094_656463_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226765
NZ_CP054569.1\|WP_062685562.1\|655550_656063_-\|RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|224511
NZ_CP054569.1\|WP_088447122.1\|667304_668684_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|340430
NZ_CP054569.1\|WP_123786589.1\|658288_659269_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564
NZ_CP054569.1\|WP_088148808.1\|664404_665721_-\|sorbosone-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|225044
NZ_CP054569.1\|WP_174715729.1\|661927_663493_-\|DUF1800-domain-containing-protein	unknown	unknown	gnl\|CDD\|378055
NZ_CP054569.1\|WP_123786863.1\|654733_655549_-\|anti-sigma-factor	unknown	unknown	gnl\|CDD\|227949
NZ_CP054569.1\|WP_123786865.1\|663593_664298_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187602
NZ_CP054569.1\|WP_062684161.1\|668698_669127_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|238182
NZ_CP054569.1\|WP_062685560.1\|653991_654723_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP054569.1\|WP_174715727.1\|648495_650328_+\|allophanate-hydrolase	unknown	unknown	gnl\|CDD\|236177
NZ_CP054569.1\|WP_062684163.1\|666645_667308_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP054569.1\|WP_125284278.1\|656553_657006_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NZ_CP054569.1\|WP_062685565.1\|657092_657569_-\|transposase	unknown	unknown	gnl\|CDD\|224854
NZ_CP054569.1\|WP_062684460.1\|646881_648135_-\|urea-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|372603
NZ_CP054569.1\|WP_062684169.1\|660315_661680_-\|DUF1501-domain-containing-protein	unknown	unknown	gnl\|CDD\|226587
NZ_CP054569.1\|WP_174715728.1\|650356_653995_+\|urea-carboxylase	unknown	unknown	gnl\|CDD\|274264
NZ_CP054569.1\|WP_174717473.1\|665778_666105_-\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|379323
NZ_CP054569.1\|WP_062684176.1\|669144_669570_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180

Protein	Function_ID	Function_description	E-value
NZ_CP054569.1\|WP_062684164.1\|666298_666646_+\|PepSY-domain-containing-protein	gnl\|CDD\|225753	COG3212, COG3212, Predicted membrane protein [Function unknown].	2.43408e-11
NZ_CP054569.1\|WP_125284279.1\|656094_656463_-\|hypothetical-protein	gnl\|CDD\|226765	COG4315, COG4315, Uncharacterized protein conserved in bacteria [Function unknown].	1.61875e-40
NZ_CP054569.1\|WP_062685562.1\|655550_656063_-\|RNA-polymerase-sigma-factor	gnl\|CDD\|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	1.72147e-41
NZ_CP054569.1\|WP_088447122.1\|667304_668684_+\|sensor-histidine-kinase	gnl\|CDD\|340430	cd16954, HATPase_PhoQ-like, Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Escherichia coli PhoQ and Providencia stuartii AarG. This family includes histidine kinase-like ATPase (HATPase) domain of two-component sensor histidine kinases similar to Escherichia coli PhoQ and Providencia stuartii AarG. PhoQ is the histidine kinase (HK) of the PhoP-PhoQ two-component regulatory system (TCS), which responds to the levels of Mg2+ and Ca2+, controls virulence, mediates the adaptation to Mg2+-limiting environments, and regulates numerous cellular activities. Providencia stuartii AarG is a putative sensor kinase which controls the expression of the 2'-N-acetyltransferase and an intrinsic multiple antibiotic resistance (Mar) response in Providencia stuartii. The AarG product is similar to PhoQ in that it is able to restore wild-type levels of resistance to a Salmonella typhimurium phoQ mutant. However, the expression of the 2'-N-acetyltransferase gene and of aarP (a gene encoding a transcriptional activator of 2'-N-acetyltransferase) are not significantly affected by the levels of Mg2+ or Ca2+. Most proteins in this group contain a histidine kinase dimerization and phosphoacceptor domain (HisKA); some have an accessory HAMP sensor domain, and some have an intracellular membrane -interaction PhoQ sensor domain.	5.74451e-47
NZ_CP054569.1\|WP_123786589.1\|658288_659269_-\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	4.4407e-18
NZ_CP054569.1\|WP_088148808.1\|664404_665721_-\|sorbosone-dehydrogenase-family-protein	gnl\|CDD\|225044	COG2133, COG2133, Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism].	9.86121e-107
NZ_CP054569.1\|WP_174715729.1\|661927_663493_-\|DUF1800-domain-containing-protein	gnl\|CDD\|378055	pfam08811, DUF1800, Protein of unknown function (DUF1800). This is a family of large bacterial proteins of unknown function.	7.00589e-98
NZ_CP054569.1\|WP_123786863.1\|654733_655549_-\|anti-sigma-factor	gnl\|CDD\|227949	COG5662, COG5662, Predicted transmembrane transcriptional regulator (anti-sigma factor) [Transcription].	2.73038e-40
NZ_CP054569.1\|WP_123786865.1\|663593_664298_-\|SDR-family-oxidoreductase	gnl\|CDD\|187602	cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR. This subgroup resembles the SDR family, but does not have a perfect match to the NAD-binding motif or the catalytic tetrad characteristic of the SDRs. It includes the SDRs, Q9HYA2 from Pseudomonas aeruginosa PAO1 and APE0912 from Aeropyrum pernix K1. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	2.61075e-97
NZ_CP054569.1\|WP_062684161.1\|668698_669127_-\|universal-stress-protein	gnl\|CDD\|238182	cd00293, USP_Like, Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity.	7.11601e-26
NZ_CP054569.1\|WP_062685560.1\|653991_654723_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	1.62689e-34
NZ_CP054569.1\|WP_174715727.1\|648495_650328_+\|allophanate-hydrolase	gnl\|CDD\|236177	PRK08186, PRK08186, allophanate hydrolase; Provisional.	0
NZ_CP054569.1\|WP_062684163.1\|666645_667308_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	2.28412e-85
NZ_CP054569.1\|WP_125284278.1\|656553_657006_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	3.2262e-11
NZ_CP054569.1\|WP_062685565.1\|657092_657569_-\|transposase	gnl\|CDD\|224854	COG1943, COG1943, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.37901e-27
NZ_CP054569.1\|WP_062684460.1\|646881_648135_-\|urea-ABC-transporter-substrate-binding-protein	gnl\|CDD\|372603	pfam13433, Peripla_BP_5, Periplasmic binding protein domain. This domain is found in a variety of bacterial periplasmic binding proteins.	0
NZ_CP054569.1\|WP_062684169.1\|660315_661680_-\|DUF1501-domain-containing-protein	gnl\|CDD\|226587	COG4102, COG4102, Uncharacterized protein conserved in bacteria [Function unknown].	5.0776e-50
NZ_CP054569.1\|WP_174715728.1\|650356_653995_+\|urea-carboxylase	gnl\|CDD\|274264	TIGR02712, Includes:_Allophanate_hydrolase, urea carboxylase. Members of this family are ATP-dependent urea carboxylase, including characterized members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae. The allophanate hydrolase domain of the yeast enzyme is not included in this model and is represented by an adjacent gene in Oleomonas sagaranensis. The fusion of urea carboxylase and allophanate hydrolase is designated urea amidolyase. The enzyme from Oleomonas sagaranensis was shown to be highly active on acetamide and formamide as well as urea. [Central intermediary metabolism, Nitrogen metabolism].	0
NZ_CP054569.1\|WP_174717473.1\|665778_666105_-\|PepSY-domain-containing-protein	gnl\|CDD\|379323	pfam13670, PepSY_2, Peptidase propeptide and YPEB domain. This region is likely to have a protease inhibitory function (personal obs:C Yeats). The name is derived from Peptidase & Bacillus subtilis YPEB.	7.31189e-10
NZ_CP054569.1\|WP_062684176.1\|669144_669570_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	7.26587e-23

>NZ_CP054569.1|WP_123786589.1|658288_659269_-|IS110-family-transposase
MQIAVSFFGADVGKAEIVVADHGRAKPVTQILKNTPSSLSKWLQTLPPGSVLAMESTGGYERMLADLAHERGLKVYVLNPKALHHYAKSQGQRGKTDRLDAIMIARFIASEHERLHPYQPCAQYIERLRQMLRLRRMAVITRTQLRLSSERHHQVHDAQAQVQKALDALTELANSLEDQMLAEIQAEPALAQDFKLLTSIVGVGNLTATALVTTFARIPFTSSDAVVAYAGLDPRPKESGAYKGMRKLSKQGDAILRSLAYNAATAAARSITFKPMYQALLAKGWATTQALNIIARKLLRIAFGVWKSRKPFERELFLANQACVKP
>NZ_CP054569.1|WP_062685565.1|657092_657569_-|transposase
MTSYRRLFLPGGTYFFTVAARPRGTRRLVERAELLKACIRAEQRLAPFSILAAVIMPDHLHMVWRLPEGDSDYPNRWRRIKARFSRALPMPPPIVARRGRGEREIWQRRYWEHAVRDEAELAACIGYVHANPIKHGYVERPEEWPHSTYLAWRERQRR
>NZ_CP054569.1|WP_125284278.1|656553_657006_-|GNAT-family-N-acetyltransferase
MTSPALTLRPATEADLPFLLALRKATMTEHLRRAGAPDDDGHHLERIRHRFEDAHIVWADDRPAGLFKASRDAAAWRVVQIQIDPAFQGQGLGRRLLAELLAQADAQGVAVTLSVLHGNPARRLYESLGFTPIEENRLEIEMRYPSRLAG
>NZ_CP054569.1|WP_125284279.1|656094_656463_-|hypothetical-protein
MRKHIAAALALTSAALFSAGALAQAVKTQDGVLVNSAGMTLYTFDKDSGGKSACNDQCAKIWPPLMASADAKPMGDLTVITRDDGSKQWASKGKPLYTYAKDAKAGDKTGDNFKEVWHAAKP
>NZ_CP054569.1|WP_062685562.1|655550_656063_-|RNA-polymerase-sigma-factor
MRADDEALILACIPSLRRYARGLTGDPHRADDLVQDTLERAWSRYSRWQRRGELRAWMFGIMHNHFIDGVRATSRRAEQTAPGELPDAPVRATQTDHLEVRDLDRCLQALPAEQREVLLLVCVEDLSYQETAQILDVPMGTVMSRLSRAREKLGLLMQGRDAVNRLHRVK
>NZ_CP054569.1|WP_123786863.1|654733_655549_-|anti-sigma-factor
MNDKRLHPVPAQGTPITEADLHAYADGQLPPARHAEVESFLATHPHDQTRVDDWRAQRRALHAFLDPVLDEPLPLRLPLAPPARRWPWRALAASVAVAAVSASAAWITRGAMDARHWQAVLATASPERAAGGYAQRAAIAHAVYAPDMGRPVEVGVDNEKGLVTWLTKRMGAPVRAPSLSQAGYELMGGRLLPGGAGPVALFMYGAPDGQRLTLYVTREAAGDQTAFQFTQEGSVRVFYWVEGQFGYALSGAVSREELQRVSQEVYRQLQG
>NZ_CP054569.1|WP_062685560.1|653991_654723_+|GntR-family-transcriptional-regulator
MRRLASVQAGLGIRPAPALAGSLADQVYQRIKDDLFDFRMLPGERFTEAELAARLGVSRTPVRLGLARLAREGFVLAQPRSGWQARPFDFERFEALYDVRVVLEQAAVERLCAREPMDGAGILGALADVWLAPPPQRILDGRLVAQLDEAFHCSLVSAAGNAEMAQIHRDVTEKIRIVRRLDFTKDFRVDATYDEHAAILRAVLARRADEAGRLLRSHIGMSKAEVRKITLHMLHEARQAGRA
>NZ_CP054569.1|WP_174715728.1|650356_653995_+|urea-carboxylase
MFDTVLIANRGEIAVRAIRSLKRLGIRSVAVYSDPDRNAAHVREADVAVALGGEKAADSYLRMDLLLAAAREQGAQAIYPGYGFLSESAEFAQACEAAGIAFVGPTPAQIREFGLKHRSRELAAEAGVPMTPGTGLLGSLGEALSQAERIGYPVMLKSTAGGGGIGLSRCENEAELTVAFDSVQRMGEHFFRDGGAFLERYVDNARHVEVQIFGDGAGRVAALGERDCSVQRRNQKVIEETPAPLLPAATRAALHAAAVQLGASVNYRSAGTVEFIYDPARDSFYFLEVNTRLQVEHPVTEEVTGLDLVECMLRVAAGEPLDFEVLSRPPQGASIEVRLYAEDPLRQFQPSPGVLTEVAFPRGVRVDGWVETGTEVPAFYDPLLAKLIVRAETREAALDKLSEALAATRLHGIATNLDYLRQIVADARFRAGEISTRFLESFAYRPAAIEVLEAGTYTSVQDYPGRVGYWDIGVPPSGPMDDYAFRMANRIVGNAADAAGIEATLAGPTLRFHGDAIVALTGAVCAATLDGEPVPMWQPVAVRSGQVLVTGRALSGCRSYLAVRNGLDVPVYLGSRSTFALGQFGGHAGRTLRVGDMLPLLRPELAGAGAAAPIAVPRAAPPELIPAYGNAWEIGVLYGPHGAPDFFRPESMEAFFAADWEVHYNSNRLGVRLVGPKPAWARESGGEAGLHPSNIHDCEYAIGSINFTGDSPVILTRDGPSLGGFVCPVTIARAELWKVGQVKPGDRIRFVRIDYAQARALEQAQDRRVEELAAPTTPAVAPAPATASEAIVATLPAEGTRPSVCYRQAGDGYLLLEYGDNVLDLALRMRVHLLMEALKAEPVAGVLELSPGVRSLQIRYDGGVIPQGRLVARLLEIEAGLPDVADLKVPTRVLRLPMAFEDSATLGAVRRYQETVRANAPWLPNNVDFIRRINGLAGRDDVRRIVFDASYLIMGLGDVYLGAPCAVPIDPRHRLLTSKYNPARTHTAEGTVGIGGVYMCIYGMDSPGGYQLVGRTLPIWNKFLRNPVFQEGKPWLLRFFDQVRFYPVTEAELDRLREDFREGRAAVSIEEEVFDFAAHRRFLAEEADSIAAFQTRQRAAFDAEVALWKTEEAPAEPAAPPPEPEAAAALREGERLVSADMCGNVWKIPVQVGQSVSAGDTLVVVEAMKMELSVIAPASGIVTAIRCAPGKPVNAGDPLIVLAEDAACAVAG
>NZ_CP054569.1|WP_174715727.1|648495_650328_+|allophanate-hydrolase
MNALATQKGPEGWTIAQWQAAYRDEGARPEALLAAWAAPGGAADNAWISRVDEAMLARQLDDLQGLRDAAQGDLARLPLYGVPFAVKDNIDAAGWPTTAACPEFAYLPGEDATVVRRLRAAGAILVGKTNLDQFATGLVGTRSPHGAVPNAFRPEYVSGGSSSGSASVVARGLAAFSLGTDTAGSGRVPAGFNNIVGLKPTRGWLSTAGVVPACRTLDCVSVFALTVDDAALVARIAGGYDDADPYSREQPADVARPWPAAPRLAIPAQLKFFGDAQAAAAFDDAVRALREDGASVESLDFAPFAELAALLYQGPWVAERYAAVEGLLREMPDAIHPVVRGIVEQAGRYSALDAFKAEYRRAELSRRIHRALEGYDALVVPTSPSIYTIAELQADPVALNSRLGVYTNFANLADLSALAVPAGMRADGLPAGITLIGPAWQDAALARFGRQWQASRGLPLGATGAPLPASSAAPQPAAHTVRVAVVGAHLTGMPLNHQLTSRRAAFVERTRTAGDYRLYALAGTTPPKPGLVKSGAGEPIEVELWDVPLPAFGAFVAEIPAPLGIGTLELEDGRQVKGFICEPRGLEGALDITAFGGWRAYLASLGAAPR
>NZ_CP054569.1|WP_062684460.1|646881_648135_-|urea-ABC-transporter-substrate-binding-protein
MKRRLALKQLTAVSLLAMTGWMPQVHAAGDTIKVGILHSLSGTMAISETSLKDVALMAIDEINANGGVLGRKLEPVVVDPASNWPLFAEKSRQLLAQDKVAVVFGCWTSVSRKSVLPVFKELNGLLFYPVQYEGEELEKNVFYTGAAPNQQAIPAVEYLMSEDGGGAKRFVLLGTDYVYPRTTNKILRAFLHSKGVKDSDIDEVYTPFGHADYQTIVANIKKFATGGKTAVISTINGDSNVPFYKELGNAGLKATDVPVVAFSVGEEELRGVDTKPLVGHLAAWNYFESIKNPVNEDFIKKWKAYARAKNLPNAGTVVTNDPMEATYIGIHMWKQAVEQAKSTDVDKVIASMGGQKFNAPDGYTIEMDKTNHHLHKPVYIGEIRADGQFNVVWKSKGPIRAQPWSPYIPGNESKQGL
>NZ_CP054569.1|WP_062684169.1|660315_661680_-|DUF1501-domain-containing-protein
MKAARREFLLRAATLGATHAAAPLALNLAALGAAAAQAAPTSYKALVCVFLYGGNDPYNSLVPYDTAAYRAYAQARGDIALPRDALQATALRGKEAAPGGAQFALAPSLAPLKPLYESGDMAALLNIGPLVVPTTKAEYIGARVPLPPKLFSHNDQQSYWQALAPEGASSGWAGRLTDLFAGANAQRTFTGITAGGSTVLLAGRRVAGYRVGINGSTRMDLLTRDLYGSSDCTALLRQLITQPREHLMERELSRIAAQSIDADARLRAALADVAVPGEFSTPLAQQLKIVARIIGAREALGARRQVFFVSQNGYDNHAGLNDTHPALLRELGQALAAFQQALSAMGMADQVTTFTASEFGRTLGSNGNGSDHGWGSHHFVLGGAVRGGRCYGQHPEIARDGPGFVDNGRLLPTLAVDQLGASLGRWFGASPDDLRLVFPNLRRFDAHALALFEA
>NZ_CP054569.1|WP_174715729.1|661927_663493_-|DUF1800-domain-containing-protein
MSATPSAAAPQSAAPASARPTPGQASRFLAQATFGPTPADIDAVVRDGYAAWLDAQLAMPPSQTHFDWLLQQGKNTEAFKGNGINAPLESTLWRKFITAPDQVRTRVAFSLSEIFVVGVSSITASWPLFGAAGFMDLLAEHALGSYPELLGAVSRNLSMGCMLTYRGNRKEDPKTGRHPDENYAREIMQLFSIGLLELEPDGAIRMVDGAPVETYSNADVQGLAKVFTGWDINGPETDVEFHRRPMALNNALHSMAEKRFLGAVIPAGTDGHLSLKRAVEVISAHPNVGPFIGTQLIQRLVTSNPSHAYVGRVAAAFDDDGTGRRGNLKAVVRAILLDPEAREPDLSAPEWGKVREPILRFSGWARAFGANSTNGAWAMPDTTDNTIRLAQSPMRSASVFNFFRPRYVPPVTELARRHLVAPELQITDETSVAGYLNFLAIYVDRGWEDLQTPYTAEIALARDPAALVARVALLLAGDTFSAQTAAAIARAVSTIPADRPRDRVRAAITLVASTPEYLVQK
>NZ_CP054569.1|WP_123786865.1|663593_664298_-|SDR-family-oxidoreductase
MSTEKVAIVTAGGSGMGAAAARKLSADGYRVAILSSSGKGEALAAELGGLGITGSNRSPEDLSRLVDATMQKWGRVDAVVNSAGHGPKGPLLDISDEDWHLGMEFYLLNVVRIARLVAPIMKRQKAGAIVNISTYATFEPEALFPTSGVFRAGLAAFTKVFADEYAEHNVRMNNVLPGFIDSLPEKEDRRVRIPMGRYGTAEEVADLIAFLASDASSYITGQNIRIDGGITRSV
>NZ_CP054569.1|WP_088148808.1|664404_665721_-|sorbosone-dehydrogenase-family-protein
MPILRIMAAAGLALAALSACGEMATLPVEAGMGPTPQLPAPNPTTVPTVKTAKAVGWPPGAHPIPASGLAVTAFADGLDHPRWLYVLPNGDVLVAETNAPPKPESASGGLKDWVAGLVMKRAGARTLSANRITLLRDADHDGIAETRSVLLEGLNSPFGMALVGDWLYVANADAVVRYPYRAGQTRIDAPGEKVADLPAGINHHWTKNLIASPDGGKLYVSVGSNSNVAENGMEIEEGRAAIWEIDLASGARRLYATGLRNPVGMAWAPDGKTLWTAVNERDELGSDLVPDYMTSVRDGGFYGWPYSYFGQHVDTRVTPQRPDLVARAIVPDYALGPHTASLGLAWSGGARLPAPYTDGMFVGQHGSWNRNPRSGYKVIFVPFSQGKPDGPARDVLTGFLNESGEAQGRPVGVAIDRQGGLLVADDVGNAIWRVGAAP
>NZ_CP054569.1|WP_174717473.1|665778_666105_-|PepSY-domain-containing-protein
MTRVQKTLAALAIGGSVLAAGAPAFAQTAPQPAPAATAPAATTPAAAPMLTIRQVYDKMEAAGYRNISEIERSSKHGYEVKAYDPQGQRVKLRVDPQTGAVTRSRFDD
>NZ_CP054569.1|WP_062684164.1|666298_666646_+|PepSY-domain-containing-protein
MTRRRPGRLILPACALAFALAAGPVSGLADESDHERARQALEAGKVLPLGAVLDIVERDFPGQVVKVEFEEDDDEFIYEIRVLQSGGSILKLKIDARDGTLLGIKGRDIKFKGKP
>NZ_CP054569.1|WP_062684163.1|666645_667308_+|response-regulator-transcription-factor
MRILVVEDEPTLAGQLVEALRGAGYTVDAAADGESARYLGDVETFDAVVLDLGLPVMDGLTVLKAWRAGGRNMPVLILTARDNWHEKVAGIDAGADDYLTKPFHMEELLARVRALLRRSTAHASAEWRCGPLVLDTRQARASVDGRALTLTSHEFKVLSVLMQRAGEVVSRSELTEHVYAQDLDRDSNTIEVFIGRLRKKLPPDTIETVRGLGYRLAAGG
>NZ_CP054569.1|WP_088447122.1|667304_668684_+|sensor-histidine-kinase
MTPARRAAGSLRLRLLAGTLAWILVSVALAGWGLASLFRQHITQQLRAELTLHLNQLTAAVNIGPDGRPVVAPPLSDPRLEQPLSGLYWQIDRLAEGGRPGAAAVARSRSLWDQTLEVPPGADGEGDREYDIAGPAGRELAALARVLKPAEEDAAPLRLLVAADRAVLAEPIGRFNHMLAIALGTLAAGLTVAAIVQVLVGLRPLARLRRKLAAQNAGDSNRIEGSFPSEIQPLVDDFNKVLAMNAEIVQRARTQAGNLAHAVKTPLTILANAAAREDGALAGLVREQVGMANRQIDYHLARARAAASSDSRDGRTPLRDTAQGLLRVVRRLYAQRGLNVEEADIAPGLVFRGEQQDLQEMLGNLLDNACKWAAGRVLVTAGQDGPGHLLIHVDDDGPGIEDHERERIFLRGVRMDEQRPGSGLGLDIVRDLAGTYGGEVRAARSPLGGLRVSLRLPAA
>NZ_CP054569.1|WP_062684161.1|668698_669127_-|universal-stress-protein
MLNILVPVDGSDNANRAVLYARQLAQGAGTARIHLLNVQTPVQGRAGLSRLITQDMIDDFYAREGREAMEDARKLLDVTDTAYASQVAFGHVATEIAGYARDHGCARIVMGTRGNGSLANILIGSVANQVLQLADVPVTLVK
>NZ_CP054569.1|WP_062684176.1|669144_669570_-|universal-stress-protein
MKRILIPVDGSQQSTHAVRALLDARRYDPVERVELLTVQIPLQAGKIGRGLSQAEIDAYHQEEGQAALQAASALLTDAGVPFQARVEVGAAADTIVRVADECEADEIYMGSRGLGSVSSWFLGSVATRVLHLTELPVTLVK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054569_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054569_2

1395790-1395904

Orphan

Consensus_repeat	Method
CCCCCTCGGGGGGCAGCAAGCGCGCTCCGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054569_2

>merge|NZ_CP054569|2|1395790-1395904|CRISPRCasFinder
CCCCCTCGGGGGGCAGCAAGCGCGCTCCGCGTGCGTGGCGTGGGGGCTCCCCCCCGCCGCCGGGCCGCCCCAAGGCGGGGGGCTCCCCCTCGGGGGGCAGCAAGCGCGCTCCGCG

>NZ_CP054569|2|2|1395790-1395904|CRISPRCasFinder
CCCCCTCGGGGGGCAGCAAGCGCGCTCCGCG	TGCGTGGCGTGGGGGCTCCCCCCCGCCGCCGGGCCGCCCCAAGGCGGGGGGCT
CCCCCTCGGGGGGCAGCAAGCGCGCTCCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054569.1\|WP_062684100.1\|1391901_1393218_-\|oligosaccharide-flippase-family-protein	unknown	unknown	gnl\|CDD\|240533
NZ_CP054569.1\|WP_062684099.1\|1389658_1390951_-\|O-antigen-ligase-family-protein	unknown	unknown	gnl\|CDD\|377422
NZ_CP054569.1\|WP_123787186.1\|1385833_1387081_-\|glycosyltransferase-WbuB	unknown	unknown	gnl\|CDD\|236670
NZ_CP054569.1\|WP_062685185.1\|1406100_1407150_+\|UDP-glucose-4-epimerase-GalE	unknown	unknown	gnl\|CDD\|187558
NZ_CP054569.1\|WP_123787188.1\|1387634_1388522_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP054569.1\|WP_062684109.1\|1395349_1395712_-\|VanZ-family-protein	unknown	unknown	gnl\|CDD\|227939
NZ_CP054569.1\|WP_062684108.1\|1390978_1391881_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133055
NZ_CP054569.1\|WP_062685182.1\|1400719_1402981_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|273391
NZ_CP054569.1\|WP_174715963.1\|1388535_1389666_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340839
NZ_CP054569.1\|WP_062685183.1\|1403001_1404405_+\|phosphomannomutase/phosphoglucomutase	unknown	unknown	gnl\|CDD\|100091
NZ_CP054569.1\|WP_062685186.1\|1407335_1408283_+\|serine-acetyltransferase	unknown	unknown	gnl\|CDD\|200082
NZ_CP054569.1\|WP_062684101.1\|1393269_1394223_-\|GDP-L-fucose-synthase	unknown	unknown	gnl\|CDD\|187550
NZ_CP054569.1\|WP_088447429.1\|1404418_1406086_+\|glucose-6-phosphate-isomerase	unknown	unknown	gnl\|CDD\|234679
NZ_CP054569.1\|WP_062685187.1\|1408340_1409159_+\|NAD-dependent-protein-deacetylase	unknown	unknown	gnl\|CDD\|235415
NZ_CP054569.1\|WP_123787191.1\|1397861_1399271_-\|undecaprenyl-phosphate-glucose-phosphotransferase	unknown	unknown	gnl\|CDD\|274396
NZ_CP054569.1\|WP_062685178.1\|1395923_1397354_-\|mannose-1-phosphate-guanylyltransferase/mannose-6-phosphate-isomerase	unknown	unknown	gnl\|CDD\|273648
NZ_CP054569.1\|WP_062685181.1\|1399521_1400658_+\|polysaccharide-biosynthesis/export-family-protein	unknown	unknown	gnl\|CDD\|237903
NZ_CP054569.1\|WP_062684096.1\|1387077_1387638_-\|colanic-acid-biosynthesis-acetyltransferase-WcaF	unknown	unknown	gnl\|CDD\|236703
NZ_CP054569.1\|WP_062685179.1\|1397359_1397812_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|239522
NZ_CP054569.1\|WP_062684102.1\|1394229_1395339_-\|GDP-mannose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|224014

Protein	Function_ID	Function_description	E-value
NZ_CP054569.1\|WP_062684100.1\|1391901_1393218_-\|oligosaccharide-flippase-family-protein	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	6.50707e-23
NZ_CP054569.1\|WP_062684099.1\|1389658_1390951_-\|O-antigen-ligase-family-protein	gnl\|CDD\|377422	pfam04932, Wzy_C, O-Antigen ligase. This group of bacterial proteins is involved in the synthesis of O-antigen, a lipopolysaccharide found in the outer membrane in gram-negative bacteria. This family includes O-antigen ligases such as E. coli RfaL.	1.47283e-08
NZ_CP054569.1\|WP_123787186.1\|1385833_1387081_-\|glycosyltransferase-WbuB	gnl\|CDD\|236670	PRK10307, PRK10307, colanic acid biosynthesis glycosyltransferase WcaI.	0
NZ_CP054569.1\|WP_062685185.1\|1406100_1407150_+\|UDP-glucose-4-epimerase-GalE	gnl\|CDD\|187558	cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs. UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), is a homodimeric extended SDR. It catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	9.73796e-175
NZ_CP054569.1\|WP_123787188.1\|1387634_1388522_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	3.69751e-51
NZ_CP054569.1\|WP_062684109.1\|1395349_1395712_-\|VanZ-family-protein	gnl\|CDD\|227939	COG5652, COG5652, Predicted integral membrane protein [Function unknown].	1.70127e-05
NZ_CP054569.1\|WP_062684108.1\|1390978_1391881_-\|glycosyltransferase	gnl\|CDD\|133055	cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.30814e-76
NZ_CP054569.1\|WP_062685182.1\|1400719_1402981_+\|AAA-family-ATPase	gnl\|CDD\|273391	TIGR01005, Putative_tyrosine-protein_kinase_EpsB, exopolysaccharide transport protein family. The model describes the exopolysaccharide transport protein family in bacteria. The transport protein is part of a large genetic locus which is associated with exopolysaccharide (EPS) biosynthesis. Detailed molecular characterization and gene fusion analysis revealed atleast seven gene products are involved in the overall regulation, which among other things, include exopolysaccharide biosynthesis, property of conferring virulence and exopolysaccharide export. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	5.75334e-165
NZ_CP054569.1\|WP_174715963.1\|1388535_1389666_-\|glycosyltransferase	gnl\|CDD\|340839	cd03811, GT4_GT28_WabH-like, family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.	6.95813e-77
NZ_CP054569.1\|WP_062685183.1\|1403001_1404405_+\|phosphomannomutase/phosphoglucomutase	gnl\|CDD\|100091	cd03089, PMM_PGM, The phosphomannomutase/phosphoglucomutase (PMM/PGM) bifunctional enzyme catalyzes the reversible conversion of 1-phospho to 6-phospho-sugars (e.g. between mannose-1-phosphate and mannose-6-phosphate or glucose-1-phosphate and glucose-6-phosphate) via a bisphosphorylated sugar intermediate. The reaction involves two phosphoryl transfers, with an intervening 180 degree reorientation of the reaction intermediate during catalysis. Reorientation of the intermediate occurs without dissociation from the active site of the enzyme and is thus, a simple example of processivity, as defined by multiple rounds of catalysis without release of substrate. Glucose-6-phosphate and glucose-1-phosphate are known to be utilized for energy metabolism and cell surface construction, respectively. PMM/PGM belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the phosphoglucomutases (PGM1 and PGM2). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.	0
NZ_CP054569.1\|WP_062685186.1\|1407335_1408283_+\|serine-acetyltransferase	gnl\|CDD\|200082	TIGR01172, Serine_acetyltransferase, serine O-acetyltransferase. Cysteine biosynthesis [Amino acid biosynthesis, Serine family].	6.36061e-54
NZ_CP054569.1\|WP_062684101.1\|1393269_1394223_-\|GDP-L-fucose-synthase	gnl\|CDD\|187550	cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, extended (e) SDRs. GDP-fucose synthetase (aka 3, 5-epimerase-4-reductase) acts in the NADP-dependent synthesis of GDP-fucose from GDP-mannose. Two activities have been proposed for the same active site: epimerization and reduction. Proteins in this subgroup are extended SDRs, which have a characteristic active site tetrad and an NADP-binding motif, [AT]GXXGXXG, that is a close match to the archetypical form. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.5531e-174
NZ_CP054569.1\|WP_088447429.1\|1404418_1406086_+\|glucose-6-phosphate-isomerase	gnl\|CDD\|234679	PRK00179, pgi, glucose-6-phosphate isomerase; Reviewed.	0
NZ_CP054569.1\|WP_062685187.1\|1408340_1409159_+\|NAD-dependent-protein-deacetylase	gnl\|CDD\|235415	PRK05333, PRK05333, NAD-dependent protein deacetylase.	1.37013e-169
NZ_CP054569.1\|WP_123787191.1\|1397861_1399271_-\|undecaprenyl-phosphate-glucose-phosphotransferase	gnl\|CDD\|274396	TIGR03023, Sugar_transferase., Undecaprenyl-phosphate glucose phosphotransferase. This family of proteins encompasses the E. coli WcaJ protein involved in colanic acid biosynthesis, the Methylobacillus EpsB protein involved in methanolan biosynthesis, as well as the GumD protein involved in the biosynthesis of xanthan. All of these are closely related to the well-characterized WbaP (formerly RfbP) protein, which is the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose (NOTE: not glucose) to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. Colanic acid biosynthesis utilizes a glucose-undecaprenyl carrier, knockout of EpsB abolishes incorporation of UDP-glucose into the lipid phase, and the C-terminal portion of GumD has been shown to be responsible for the glucosyl-1-transferase activity.	0
NZ_CP054569.1\|WP_062685178.1\|1395923_1397354_-\|mannose-1-phosphate-guanylyltransferase/mannose-6-phosphate-isomerase	gnl\|CDD\|273648	TIGR01479, Mannose-1-phosphate_guanylyltransferase, mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase. This enzyme is known to be bifunctional, as both mannose-6-phosphate isomerase (EC 5.3.1.8) (PMI) and mannose-1-phosphate guanylyltransferase (EC 2.7.7.22) in Pseudomonas aeruginosa, Xanthomonas campestris, and Gluconacetobacter xylinus. The literature on the enzyme from E. coli attributes mannose-6-phosphate isomerase activity to an adjacent gene, but the present sequence has not been shown to lack the activity. The PMI domain is C-terminal. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NZ_CP054569.1\|WP_062685181.1\|1399521_1400658_+\|polysaccharide-biosynthesis/export-family-protein	gnl\|CDD\|237903	PRK15078, PRK15078, polysaccharide export protein Wza; Provisional.	9.34224e-89
NZ_CP054569.1\|WP_062684096.1\|1387077_1387638_-\|colanic-acid-biosynthesis-acetyltransferase-WcaF	gnl\|CDD\|236703	PRK10502, PRK10502, putative acyl transferase; Provisional.	3.5223e-99
NZ_CP054569.1\|WP_062685179.1\|1397359_1397812_-\|NUDIX-domain-containing-protein	gnl\|CDD\|239522	cd03430, GDPMH, GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily. This class of enzymes is unique from other members of the superfamily in two aspects. First, it contains a modified Nudix signature sequence. The slight changes to the conserved sequence motif, GX5EX7REUXEEXGU, where U = I, L or V), are believed to contribute to the removal of all magnesium binding sites but one, retaining only the metal site that coordinates the pyrophosphate of the substrate. Secondly, it is not a pyrophosphatase that substitutes at a phosphorus; instead, it hydrolyzes nucleotide sugars such as GDP-mannose to GDP and mannose, cleaving the phosphoglycosyl bond by substituting at a carbon position. GDP-mannose provides mannosyl components for cell wall synthesis and is required for the synthesis of other glycosyl donors (such as GDP-fucose and colitose) for the cell wall. The importance of GDP-sugar hydrolase activities is thus closely related to the regulation of cell wall biosynthesis. Enzymes in this family are believed to regulate the concentration of GDP-mannose and GDP-glucose in the bacterial cell wall.	1.51133e-60
NZ_CP054569.1\|WP_062684102.1\|1394229_1395339_-\|GDP-mannose-4,6-dehydratase	gnl\|CDD\|224014	COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane].	0

>NZ_CP054569.1|WP_062684109.1|1395349_1395712_-|VanZ-family-protein
MARLCLPVAGLFFLVLVTVGNLPGLASEMSDAFGDKRLHLAAYAFLTGLIYMSVNRRPALVAMLAITALGALDESIQSFFPYRQAELLDLLADISAAGATVISLHIGTAAFGSFRAVTKS
>NZ_CP054569.1|WP_062684102.1|1394229_1395339_-|GDP-mannose-4,6-dehydratase
MPKRALITGVTGQDGSYLAEFLLAKGYEVHGIKRRASLFNTARIDHLYQDPHDQPRNFVLHHGDMTDSCSLIRIVQSVQPDEIYNLAAQSHVGVSFEEPEYTANADGLGTLRLLEAIRILKLENKTRFYQASTSELYGLVQEIPQKETTPFYPRSPYAAAKLYAYWISVNYREAYGMYACNGILFNHESPKRGETFVTRKITRGLARIVLGLQECLYLGNLSALRDWGHARDYVEMQWLMLQQDTPEDYVIATGMQYSVREFINTAARELGILLAWEGEGLEETATVLFSPVHDVKPGQVIVRVDPRYFRPTEVETLLGDPTKAREKLGWSPRISFAELVKEMIESDLRDARRDALVEQNGYEIYAYKE
>NZ_CP054569.1|WP_062684101.1|1393269_1394223_-|GDP-L-fucose-synthase
MTNLEQRVFVAGHRGMVGAAITRELHRRGYGNVLTRSREELDLENQNQVHRFFSTTPVDVVYLAAAKVGGILANQTHPVDFLYKNLMIQCNVIRAAYAAGVRKLLFLGSSCIYPREAPQPIREDALLTGPLESTNEPYAIAKIAGLKLCEAYQRQYGARFICAMPTNLYGQHDNYDLHSSHVLPALIRKFHEGRESGQDSVTIWGTGTPLREFLYVDDLAQACVMLMEHPDAEGIYNIGAGQDISIADLARLVARVVGYTGNIVYDTGKPDGTPRKLMDSSRVQALGWKPEISLTHGITLAYGHFLRERTQHALPVA
>NZ_CP054569.1|WP_062684100.1|1391901_1393218_-|oligosaccharide-flippase-family-protein
MLGFLRKHIAGNASFWGLVEYGIGPVAALVALPILFRQLGTVGFGQYSMIIALAGFGNAANLGAAVTATKLVSERLHEPGGAYRAAGVSMSLIGCALGVVTLAALLLWGAVGLGWPGATFGGVAVTMLALPALAIYLTQQYDQLFSGCLKGREDFRATALCEVFSRSGTMALACVTAWLTASPTWTGLAQALGLLVAGSIKMGVFSRAYGRLLVRPVRDRGAMMDAFRFSRWSWLNSLSALAFGSVDRVLVGSLMGPAALAIYTVGVQVGQIIHTASVAIFQKAMPRVSRLSASPPYPGAAEREIRRMMLWNLALSAGATLAVLAVSRPLLNVLLSASVAQDHLGTFQLLIVASGLLSLNAAAHFSLLGLGNSRAVAILNGLGGLAMLCVMAGLVHVAGEHAAAWGRMAYAAITLAGVAFAIRQSRPDFPGALPAATR
>NZ_CP054569.1|WP_062684108.1|1390978_1391881_-|glycosyltransferase
MRKRHNEYSRQLIDFVRELRPPAPIAGGLMPKVTIVTPSFNQARFLERTILSVLNQGYPRLEYIIMDGGSTDGSVDIIRKYERYLTYWESTPDRGQSHAINKGFERATGDYVGWQNSDDLYFPGALRKLGSAASRGRAPIVSGNLFVADADNRIFRKIHYTPVNRGTLTVVKASIPNQSAIFRRDLLQKYGLLQESMRYCMDLELWSRLLREGKNLIVPDAMGVYTAHDETKTALMQDVLLEEREQIVTRIRRTEPGLGRLFELSCRASKVAAHARQGDLSYLFEKLTTKIFGRDDWASH
>NZ_CP054569.1|WP_062684099.1|1389658_1390951_-|O-antigen-ligase-family-protein
MRPHRRLSTLHLLGMFAFTALALNDDHFVLGVGSFKLSPFDVIFVAMLAVKALRLAEPSAYALPRGVLGMLLGIQTLSVIYLLLVSLDHPGIETGDVARDLRIVFYFLCTPFLCYKDIDSPAAYAVLQKYIVAACLAVATLMLLEQAQGFSVANPLRNVRLGVWAIPFGVVSLLYFRRTLNVSGPKAYALTVYMLLALVFSLNRSQYLQLAISVFIAVLLGAGPEIRRRAVLIFAPAAVAGVLVFASIGYLDVLTNRIFSVERLDEDSSYGARIQEMQGQMDSFAESPVFGKGAGFRSWVMGENGFELSTFAHNSWAFYLMKFGVVGTTMIMLPPLLILLLTLLRRYAHPGLELHRRYLLSTAPIYIFIDSLSGGLAYAPKTAFTGFLLCYCLSLMRNAQIMPVPSITPPAPSPRPAAARRAPPRVIPHA
>NZ_CP054569.1|WP_174715963.1|1388535_1389666_-|glycosyltransferase
MPDVLFVAPDLHGGVGRCVAFIVDALPEQGVDSALFLLRSRNREYPVSNPKVTRALPVIESPAKLRLMLPVAFMRLLRQIRRDKPAIVCSHGLLCNMLVVLAKKLLRGNFSTVAFEHSSPAIHYGASRMRRLKCWLVSQTYRRHDAVVGVSRGVKEDLVSMFPPLRGKVHTIYNGVPLDNVRQQGANRAQEAEGQAPYHVVAVGRLEAVKDYATLIDAAALLDDPGIAFTILGEGSEHAALQKRIDEHGSRTPVTLAGHIDNPFPVIASAGAFALTSVRESFGNVLVEALCLGVPVISTDCPHGPAEILDAGRYGLLVPVGDAAALAAAVRRLAYDGETRERLAAQGPERADAFSLERHCRNVIALFQPLMQRGTP
>NZ_CP054569.1|WP_123787188.1|1387634_1388522_-|glycosyltransferase-family-2-protein
MQKIPVSVVVMTKNEERNIAKCLKALVDFDEVFVVDSNSTDATCAMATALGAKVSNFNWNGKYPKKKQWCLEQLPFSHPVVLYVDADEEMTPKLAAEIREALPRFAAGAGGAFVPFDYVFCGKKLEHGHRVYKLALLARGRSRFLDYDDLDVAHMWEVEGHYQPQVEGDTFALRQRMVHNDHDSLFHYFDKHNRYSDWEANLRTKGLMNDPREANVGARALLKRIFQAMPFKAPISFLHSYVFKLGFLDGKAGYDYAVARAMYYWQIRIKTEELQKARQASAAAARDDAVAGAAK
>NZ_CP054569.1|WP_062684096.1|1387077_1387638_-|colanic-acid-biosynthesis-acetyltransferase-WcaF
MSALQRLDRFALAPGQRGRSALTVQLWWMVQGTLFRWSPQVAYGFRRWLLRCFGARVGRKVLIRPTATVTYPWKVEIGDYAWIGDDAVIYSLGPIQIGAHAVVSQRSYLCAADHDAAQPEFPLRERAVRVEEGAWVATDVFVGPGVTIGREAVIGARSSVFRNMPPAMVCHGNPCRPVRPRKAGAP
>NZ_CP054569.1|WP_123787186.1|1385833_1387081_-|glycosyltransferase-WbuB
MKILIYGINYAPELTGIGKYSAEMAEWLAARGHEVSVVTAPPYYPQWEVQPGYRAGRYAKETRRGVTVRRAPLWVPARPGGLKRLVHLASFALSSLPSLLRAAAGRPDIILVVEPALFCAPAAWLAARLCGARAWLHIQDYEVDAAFELGLLKGAGLRGAVRRAERWLMRRFDRVSTISNRMLDLALAKGVDPGRAVLLPNWIDVDAIAPGEGGDYRAELGIPESAIVALYSGNMGGKQGLQTLADVARRLSREHRVWFVFCGQGPERAPLEAQCQGLPRVRFLDLQPAERLGELLNTADIHLLPQRAGAADLVMPSKLTGMLASGRPVVCGAAPGTELAAVVTRCGLVTPPEDGEAMAEAVRKLSYNARLRDTLGVAARQYALAHLHVDTVLAAAEREFAAIAASKSKPAGAGA
>NZ_CP054569.1|WP_062685178.1|1395923_1397354_-|mannose-1-phosphate-guanylyltransferase/mannose-6-phosphate-isomerase
MTNPPPPYRAVILCGGSGSRLWPLSRELLPKQFIRLTDDRSLLQNTLLRLGSAGAENRPTLVCNDAHRYIAAEQALELGIKDAEVILEPFARNTAPAIAAATLRAMRDGEDPVMLIMPSDHVLEDGEVLRAAFAEAYQAALQGALVTFGITPTAPLSGYGYIQADEPGAMGPARRVKRFVEKPSPEVAQRFIEDGGYYWNSGMFAFQASVFLSEMARLAPKILEQVQAAVAIGHGENALFHLDGPSFEACPSDSMDYAIMERTDSAVVIPLSASWSDVGAWDAVWGIAQKTVEGNSTTGDVMVEDSRNCLIHSTSRLVASVGLDDIVVIETADAVLVAHKSRSQDVKRLVEIFKTQHRSELNHHREVQRPWGSYDSVGQGPRYQVKRITVKPGARLSSQMHHHRAEHWIVVSGTARIYNGDKQYLLTENQSTYIPLGEIHSLENPGKIPLEIIEVQSGAYLGEDDIVRFQDMYGRV
>NZ_CP054569.1|WP_062685179.1|1397359_1397812_-|NUDIX-domain-containing-protein
MLAGADFRRAVEMLPLVSIDLLLRDGSGRYLTGLRANPPAQGAWFVPGGRIRKNETLRDALRRIARDELGLPVPDQAWQPRGVYEHFYGTNFAGEAGRSTHYVVLAYEAEIPLDIASLPQAQHRSYRWQPAEAIAADPGVHPYTQAYFKE
>NZ_CP054569.1|WP_123787191.1|1397861_1399271_-|undecaprenyl-phosphate-glucose-phosphotransferase
MEPSQTDTSARFSGASYIYRLLDAAIVITCGLTATGLKFSDDALADPPQIHLFLVYLCGLGVIAIFPAFRLYVSWRGRRLADLVARSLAAWAMVFALGICISFLMHQTAAISRIWAATWFIMTALTLAGVRIAVYAALGAARDRGLDRKRVLLVGFGALGHDLWRRVERYRGTGYEVAGIYAEPHENLPPQVRRLHELEELHTFVNENKVREIWIVLPMEAGQELREVLYHLRNDLVDIRWIPDVMSIQLLGHQIGEFLGLPAIQLNSLPAAGVRGLAKEVFDRSFAFCALIGLSPLMLTVALLVKATSRGPVFFTQPRLGVDGKVFHVYKFRTMTVHQEQGVVTQATRNDTRVTRIGGFLRRTSLDELPQFLNVLMGDMSVVGPRPHALEHNELYKDLVQRYMMRHRVKPGITGWAQVNGLRGQTDTLRKMSDRVEYDIYYIQHWTFRMDLLIIARTAISGWTGRNVY
>NZ_CP054569.1|WP_062685181.1|1399521_1400658_+|polysaccharide-biosynthesis/export-family-protein
MTTFFGTLSRAIAAIALVSSLGACALSPGMTFDANQLADPLDPNSKAEIREITPSLVLEDQRAREALLDNAGVDRLYGKSGPYIIGPGDILSVVVWDHPELVLPTQTYAIGSGVTELAIGDTASGIPGYTVSSTGYIQFPYAGLLKVAGLTELQARNLIVNSSGKYIQDPQITVRVLGYRSKRVYVDGEVTTPGTVAINDIPMTLLEAINRAGGILPTGDRSAVYVIRDGRRTRVNLPALIERGQDLNQVLLKSGDIVRVTPRDDSKVFVMGEVTLPTAAVMRDGRMSLTEALGLAGGPNQLTSNPSQVFVVRSTEQATPLVFHLNAGSPQALAVAEKFELQPKDVVFVDSAGLVRWNRFISNLFPSAQTVQTVKAID
>NZ_CP054569.1|WP_062685182.1|1400719_1402981_+|AAA-family-ATPase
MSLPIESFEPSVPARQQETPLSSHVDAIFSNRWMIIAITLLALFGALAYVMVTPKVFSADIIVQVEEELPQGQGRSLLGDVSTMFDTKAETSGEMEVLRSRMVVGPAVDKFLLYIHAKPRYFPVVGEWLAQRYESLPYPSSLPRGGYAWGGEAIAISQLDVPNEWLGKPFRVTTLGDGRYTLSDKLTGATFNGTVGKPEHFLLPGGGAMDVHIDALTGRPGTEFTVSRSSRLAAIEDVQARLGIFERGRTSGVIGVTLEGNDPALTTAVLNQIGQEYVQQNVNRKSAQAEKSLVFLEQQLPVLKGELDAAETKYNTLRNKRGTIDLSEEAKLILAQSVDAQTKVMELRSKRQEMITRFAPTHPSIVALDRQIAGLTGDVNRIGNNIRQLPDLEQDVVRLVRDVRVNTELYTALLNNAQQLRLIRAGKVGNVRILDAAVQPDKPVRPKAAIIIGVATAFGLIFGMLCAFVRNALFGGLSEPDDVERHTGLPVLAAIPYSDMQDKLWRRSRRKNASVPALLAQSQGNAPPIESLRSFRNVLQASLRQSANNMVMFTGPVAGVGKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGVPKEDGLFEVLSGTIPLSRVRKHSVSEGVDFIATGAVTFDPSELLASPVFGETLRELASQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGLKLLPERFGFRSKYGNYRYSRAAYYGDFKQNGPK
>NZ_CP054569.1|WP_062685183.1|1403001_1404405_+|phosphomannomutase/phosphoglucomutase
MHGTFGWDTPQILDAVFKAYDIRGTVPDEIDARFAHSLGMAAGTRARELGARSMVVGRDGRLSSVELAAALQAGLRSAGMHVIDIGMATTPMVYFATRLMDTGSGIAVTGSHNPPAHNGFKIVLDGASLYGEGITALRDAMRLPIESAGVAGGRTQMQILPCYAARLMGDIRMARPMKIAIDCGNGVAGAVAPSLFRALGCEVTELFCEVDGTFPAHHPDPADPQNLQDLIYCLRYSDCEVGLAFDGDGDRLGVVTKSGQIIWPDRQLILFARDVLSRNPGAEILYDVKCSRHVARAITEAGGKPTMCRTGHSLIKARMRETGALLAGEMSGHIFFKERWYGFDDGIYAAARLLEILSAAPDPSALLENLPQSCATPEIKLGTAEGEQFDLVEALRAQGEFPGAVSISNLDGVRVDYADGFGLARPSNTTPTVVLRFEGDTVAALARIEEDFRNAFRRIAPHVRLPF
>NZ_CP054569.1|WP_088447429.1|1404418_1406086_+|glucose-6-phosphate-isomerase
MGKAKYAIEALRANSGLADSPEWQAFAQAAQGAELDAGALKVIEAAGLCVDLTMQRQSPALDAAALSLLQARGLADARRALFAGDPVNWTEGKPAWHTALRAGRTREQPDGQDADSVCEHSRMTDFVRKVDQTADFSTVLHIGIGGSDWGPRLAIQAFGGPSQRRQIRFVSNIDGHAFHDAVAGLDPRRCLVVVSSKSFTTAETLHNARAAIAWLKQGGVADVSEHLAAVTANPSAARALGVPASQVFKMCDWVGGRYSVWSVAGLSIALTVGADVLIGMRAGAEAMDQHFQQAPFASNAPVQLALSGLVNCSVLGHNSLNIAAYSARLLHLVTYLQQLEMESLGKRVAGDGAAVGVPTAPIIWGMPGTDGQHTFFQWLHQSEDGAPVDFIASLQGHADSPDAHRMLLANCLAQRQALLRGKCLEQALLDVAHIDDQERALSLAQHMVHPGGRPSTLIVLRQLDPRGLGALLALYEHKVFVQSVVWGINPFDQWGVELGKRLATGIERELAVPVSAGLVDWGHDASTSYWIDRYRSHAQAPRPRHAWVPGVAAHL
>NZ_CP054569.1|WP_062685185.1|1406100_1407150_+|UDP-glucose-4-epimerase-GalE
MPDLHVLVTGGAGYIGTHTLVAMLAAGQRPLVLDDFSNGSREAVRRVERLCGTEIPLVEGDIRSPGMVASVLAASAARGAPVEAVLHLAGSKAVGESVADPLKYYDNNVGGSMALLRAMREAGVRRLVFSSSATVYGEPQYLPFTEAHPLAPTNPYGRSKRMVEDMLRDLCAADPAFSAVTLRYFNPIGAHESGQIGESPRDTPNNLFPFITQVAVGRQPCLRVFGDDYDTVDGTGVRDYLHVMDLAQGHVRALAYSADHPGFVAVNLGTGQGTSVLELVRAFERVNGCRIPLLAQPRRPGDIERMWADPALAASLLGWRSTHDVDAMCADGWRWQQGNPQGYEPDAGA
>NZ_CP054569.1|WP_062685186.1|1407335_1408283_+|serine-acetyltransferase
MSGPTYIAPAHWNLDSIVSGLREARVAWRGPRGRLREDAGLREFPSQESLRQIIKDLCGALFPMRLGPIDLREEVEDFYVGHTIGAALDALLHQVCLELQYVGRPEQVASSGTRQRAIDIVREFGAELPRVRAALDLDVTAAYQGDPAAHSVDEVLLCYPGVSAMIHHRLANVLYRLGVPMLARMVAEIAHADTGIDIHPGATIGSSFFIDHGTGVVIGETAIIGDRVRLYQMVTLGAKRFPPGENGELKKGLARHPLIEDDVVIYAGATILGRVTIGKGSTIGGNVWLTRSVPPGSNVTQASLVSDMPDCGLGG
>NZ_CP054569.1|WP_062685187.1|1408340_1409159_+|NAD-dependent-protein-deacetylase
MDTRVSDLAALRGFVDRHPRLFVLTGAGVSTDSGIPDYRDTEGEWKRKPPMTLQTFMGGEPARARYWARSMVGWRRFGHVRPNASHRALARLESQGRVGLLVTQNVDGLHEAAGSREVVDLHGRLDQVRCMACDWRGDRHAWQEALQDANPDWTQLDASDAPDGDADLDGLDFTRFRVPPCPRCGGVVKPDVVFFGETVPRERVDRANAGLMSADAVLVLGSSLMVYSGYRFVTAASRNGMPIAAVNLGRTRADNMLTLKVELPCAVALDAL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054569_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054569_3

3727681-3727788

Orphan

Consensus_repeat	Method
AAAAAAAGCCCCCACGCCGCGCAAGC	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP054569_3

>merge|NZ_CP054569|3|3727681-3727788|CRISPRCasFinder
AAAAAAAGCCCCCACGCCGCGCAAGCTTCGCTTGCTTGCTGCCCCCCGAGGGGGCGCTTTTGTCTTGGGGCGGCCCGGCGACAAAAAAAGCCCCCACGCCTCGCAAGC

>NZ_CP054569|3|3|3727681-3727788|CRISPRCasFinder
AAAAAAAGCCCCCACGCCGCGCAAGC	TTCGCTTGCTTGCTGCCCCCCGAGGGGGCGCTTTTGTCTTGGGGCGGCCCGGCGAC
AAAAAAAGCCCCCACGCCTCGCAAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054569.1\|WP_087881462.1\|3720826_3721168_-\|integration-host-factor-subunit-alpha	unknown	unknown	gnl\|CDD\|178961
NZ_CP054569.1\|WP_174716669.1\|3727799_3728735_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|366166
NZ_CP054569.1\|WP_062680706.1\|3733209_3734964_-\|phosphoenolpyruvate--protein-phosphotransferase	unknown	unknown	gnl\|CDD\|224006
NZ_CP054569.1\|WP_088145674.1\|3735821_3736790_-\|glutathione-synthase	unknown	unknown	gnl\|CDD\|235371
NZ_CP054569.1\|WP_062680702.1\|3730447_3730750_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP054569.1\|WP_006218740.1\|3725077_3725275_-\|50S-ribosomal-protein-L35	unknown	unknown	gnl\|CDD\|234676
NZ_CP054569.1\|WP_043545226.1\|3731424_3731763_+\|P-II-family-nitrogen-regulator	unknown	unknown	gnl\|CDD\|366157
NZ_CP054569.1\|WP_174716670.1\|3728829_3729411_+\|CGNR-zinc-finger-domain-containing-protein	unknown	unknown	gnl\|CDD\|227803
NZ_CP054569.1\|WP_043545224.1\|3735022_3735292_-\|HPr-family-phosphocarrier-protein	unknown	unknown	gnl\|CDD\|376329
NZ_CP054569.1\|WP_174716672.1\|3731795_3733034_+\|ammonium-transporter	unknown	unknown	gnl\|CDD\|182630
NZ_CP054569.1\|WP_174716665.1\|3718587_3719865_-\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|366759
NZ_CP054569.1\|WP_006218741.1\|3724702_3725062_-\|50S-ribosomal-protein-L20	unknown	unknown	gnl\|CDD\|179959
NZ_CP054569.1\|WP_062680708.1\|3735403_3735805_-\|PTS-mannose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|225446
NZ_CP054569.1\|WP_062680692.1\|3723602_3724625_-\|phenylalanine--tRNA-ligase-subunit-alpha	unknown	unknown	gnl\|CDD\|234780
NZ_CP054569.1\|WP_088146538.1\|3717734_3718487_-\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|180993
NZ_CP054569.1\|WP_174716666.1\|3720337_3720769_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133393
NZ_CP054569.1\|WP_174716667.1\|3721171_3723589_-\|phenylalanine--tRNA-ligase-subunit-beta	unknown	unknown	gnl\|CDD\|234804
NZ_CP054569.1\|WP_043545227.1\|3727361_3727613_-\|accessory-factor-UbiK-family-protein	unknown	unknown	gnl\|CDD\|377337
NZ_CP054569.1\|WP_174716671.1\|3729421_3730384_-\|zinc-dependent-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|176233
NZ_CP054569.1\|WP_174716668.1\|3725663_3727190_-\|YifB-family-Mg-chelatase-like-AAA-ATPase	unknown	unknown	gnl\|CDD\|223679

Protein	Function_ID	Function_description	E-value
NZ_CP054569.1\|WP_087881462.1\|3720826_3721168_-\|integration-host-factor-subunit-alpha	gnl\|CDD\|178961	PRK00285, ihfA, integration host factor subunit alpha; Reviewed.	3.01792e-63
NZ_CP054569.1\|WP_174716669.1\|3727799_3728735_-\|alpha/beta-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	1.01546e-27
NZ_CP054569.1\|WP_062680706.1\|3733209_3734964_-\|phosphoenolpyruvate--protein-phosphotransferase	gnl\|CDD\|224006	COG1080, PtsA, Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism].	0
NZ_CP054569.1\|WP_088145674.1\|3735821_3736790_-\|glutathione-synthase	gnl\|CDD\|235371	PRK05246, PRK05246, glutathione synthetase; Provisional.	0
NZ_CP054569.1\|WP_062680702.1\|3730447_3730750_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.13323e-15
NZ_CP054569.1\|WP_006218740.1\|3725077_3725275_-\|50S-ribosomal-protein-L35	gnl\|CDD\|234676	PRK00172, rpmI, 50S ribosomal protein L35; Reviewed.	3.04598e-22
NZ_CP054569.1\|WP_043545226.1\|3731424_3731763_+\|P-II-family-nitrogen-regulator	gnl\|CDD\|366157	pfam00543, P-II, Nitrogen regulatory protein P-II. P-II modulates the activity of glutamine synthetase.	1.03349e-55
NZ_CP054569.1\|WP_174716670.1\|3728829_3729411_+\|CGNR-zinc-finger-domain-containing-protein	gnl\|CDD\|227803	COG5516, COG5516, Conserved protein containing a Zn-ribbon-like motif, possibly RNA-binding [General function prediction only].	1.36406e-21
NZ_CP054569.1\|WP_043545224.1\|3735022_3735292_-\|HPr-family-phosphocarrier-protein	gnl\|CDD\|376329	pfam00381, PTS-HPr, PTS HPr component phosphorylation site.	2.15381e-32
NZ_CP054569.1\|WP_174716672.1\|3731795_3733034_+\|ammonium-transporter	gnl\|CDD\|182630	PRK10666, PRK10666, ammonium transporter AmtB.	0
NZ_CP054569.1\|WP_174716665.1\|3718587_3719865_-\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|366759	pfam01694, Rhomboid, Rhomboid family. This family contains integral membrane proteins that are related to Drosophila rhomboid protein. Members of this family are found in bacteria and eukaryotes. Rhomboid promotes the cleavage of the membrane-anchored TGF-alpha-like growth factor Spitz, allowing it to activate the Drosophila EGF receptor. Analysis has shown that Rhomboid-1 is an intramembrane serine protease (EC:3.4.21.105). Parasite-encoded rhomboid enzymes are also important for invasion of host cells by Toxoplasma and the malaria parasite.	2.06121e-34
NZ_CP054569.1\|WP_006218741.1\|3724702_3725062_-\|50S-ribosomal-protein-L20	gnl\|CDD\|179959	PRK05185, rplT, 50S ribosomal protein L20; Provisional.	1.48123e-63
NZ_CP054569.1\|WP_062680708.1\|3735403_3735805_-\|PTS-mannose-transporter-subunit-IIA	gnl\|CDD\|225446	COG2893, ManX, Phosphotransferase system, mannose/fructose-specific component IIA [Carbohydrate transport and metabolism].	2.15782e-22
NZ_CP054569.1\|WP_062680692.1\|3723602_3724625_-\|phenylalanine--tRNA-ligase-subunit-alpha	gnl\|CDD\|234780	PRK00488, pheS, phenylalanyl-tRNA synthetase subunit alpha; Validated.	0
NZ_CP054569.1\|WP_088146538.1\|3717734_3718487_-\|glucose-1-dehydrogenase	gnl\|CDD\|180993	PRK07478, PRK07478, short chain dehydrogenase; Provisional.	1.49662e-119
NZ_CP054569.1\|WP_174716666.1\|3720337_3720769_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133393	cd04765, HTH_MlrA-like_sg2, Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators. Putative helix-turn-helix (HTH) MlrA-like transcription regulators (subgroup 2), N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.06066e-39
NZ_CP054569.1\|WP_174716667.1\|3721171_3723589_-\|phenylalanine--tRNA-ligase-subunit-beta	gnl\|CDD\|234804	PRK00629, pheT, phenylalanyl-tRNA synthetase subunit beta; Reviewed.	0
NZ_CP054569.1\|WP_043545227.1\|3727361_3727613_-\|accessory-factor-UbiK-family-protein	gnl\|CDD\|377337	pfam04380, BMFP, Membrane fusogenic activity. BMFP consists of two structural domains, a coiled-coil C-terminal domain via which the protein self-associates as a trimer, and an N-terminal domain disordered at neutral pH but adopting an amphipathic alpha-helical structure in the presence of phospholipid vesicles, high ionic strength, acidic pH or SDS. BMFP interacts with phospholipid vesicles though the predicted amphipathic alpha-helix induced in the N-terminal half of the protein and promotes aggregation and fusion of vesicles in vitro.	8.27007e-19
NZ_CP054569.1\|WP_174716671.1\|3729421_3730384_-\|zinc-dependent-alcohol-dehydrogenase-family-protein	gnl\|CDD\|176233	cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	1.57589e-163
NZ_CP054569.1\|WP_174716668.1\|3725663_3727190_-\|YifB-family-Mg-chelatase-like-AAA-ATPase	gnl\|CDD\|223679	COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones].	0

>NZ_CP054569.1|WP_043545227.1|3727361_3727613_-|accessory-factor-UbiK-family-protein
MNNRTQWMEDIQKNLSDLIARSPAADVERNVRAMMTQAFSKLDLVTREEFDVQADLLARTRARVDQLAAQVQQLESRLSALDK
>NZ_CP054569.1|WP_174716668.1|3725663_3727190_-|YifB-family-Mg-chelatase-like-AAA-ATPase
MTLAVLASRALCGLDTHAVRVETHLGPGLPGFNVVGLPDTEVRESRERVRAAILNSGFEFPPGRITVNLSPADLPKESGRFDLPIALGVLLASGQLAAQAERAPDARAPAPALADLVLAGELSLTGALVPVAAPLVIALGVAREAPGATLILPAGSAEQAAWVPDLRVLSARSLADVAAHAAGACRLPDAIPRPWPAAPPAACLSDVRGQPGARRALEVAAAGAHSLLMIGPPGAGKSMLAARLPGLLPPLARREALEAAAVAALAGLPDAPMGQPPFRAPHHSASVAALVGGGSRPRPGEISLAHRGVLFLDELPEFNRRTLEALREPLEAGRVVIARALHSARFPARFQLVAAMNPCPCGWRGHPARACACSPDQAARYVGRVSGPLLDRIDLHVALPPSDPDWMSGPPGEPSEPVRERVARCRERQLARQGKPNAALEGAELDEHCRMDGEARALLSQAMRRLAGSARALHRALRVARTIADLDGEERLAASHVAQAVQYRRPGV
>NZ_CP054569.1|WP_006218740.1|3725077_3725275_-|50S-ribosomal-protein-L35
MPKMKTKKSASKRFKVRGSGSIKRGQAFKRHILTKKTTKAKRQLRGSTAVHESNVASVKAMMPFA
>NZ_CP054569.1|WP_006218741.1|3724702_3725062_-|50S-ribosomal-protein-L20
MPRVKRGVTARARHKKVIAAAKGYRGRRGNVFRIAKQAVMRAGQYAYRDRRNKKRTFRALWITRINAAVREHGVSYSVFIAGLKKASIELDRKVLADLAVRDKAGFAAIVQQAKAALAA
>NZ_CP054569.1|WP_062680692.1|3723602_3724625_-|phenylalanine--tRNA-ligase-subunit-alpha
MTQTVDDLVSQAQERFAAAPDAAALENAKARFLGKEGALTVLLKALGKLDPEQKREMGARINQAKQKVEELLNLRRAALAQAELDARLASETIDVTLPGRGRAPGGIHPVIRTWERVEEIFRSIGFDVADGPEVENDWTNFTALNNPLDHPARSMQDTFYVDMNDADGLPLLLRTHTSPMQVRYARMNKPPIKVIAPGRTYRVDSDATHSPMFHQVEGLWIAEDISFADLKGVYTDFLRCFFESDDLVVRFRPSFFPFTEPSAEIDMMFTSGPNRGRWLEISGSGQVHPQVVRNFGLDPERYIGFAFGSGLERLTMLRYGVNDLRQFYEGDLRFLRQFNE
>NZ_CP054569.1|WP_174716667.1|3721171_3723589_-|phenylalanine--tRNA-ligase-subunit-beta
MQFPESWLRTLVNPPIATDELAHRLTMAGLEVEDTVPAAPAFSGVVVARIVEIAPHPDADKLRVCQVDDGSGERLQIVCGAPNAAAGLTVPLARVGAELPGGMKIGVAKMRGMQSSGMLCSARELGLSQDHAGLLELPAEMTPGQSIREALDLDDTLFTLKMTPNRADCLSILGVAREVAALTGAPLSVPTAAAVPVTLDERLPVKVEAPDLCGRFGGRVIRGVNARAATPDWMKTRLERAGQRSLSALVDISNYVMLELGRPSHVFDLDKIQGDLCVRWAREGETLELLNGQTVTLDPRVGVVAAGDQVESLAGIMGGEATSVTLDTQNIYLEAAFWWPESLAGRARRYKFSSEASHRGERGVDFATIPQHIEFITRLIVDICGGQVGPLDDQIVNLPKREPVRMRLARCHRVLGVPVTQAEVAKIFGSLGLEYAIEGDEFIVTPPSYRFDLELEEDLIEEVARIYGFENIPAVPPMARAKMYSQPEIRRGAHFLRRLTAAQDYQEVVNYSFVEADWERDYAGNETPVRLVNPIASHLSVMRSSLIGGLVANIRHNANRKQSRVRVFELGRVFMRDASAQDGPLEVAGVRQPLKLAGAAWGPAVEEQWGVATRHVDFYDVKMDVEALFGARGSRLRFAAAAHPALHPGRSARVELDGRQVGWIGELHPRWAQQADLAHAPVVFELDVTALSEGELPQVRELSRQPVVVRDLALWVDEGVSVQSMLDTVAAAVKADPQLAVVQDAQLFDVWREKPQHGEPATEKSLAFRFWLQDTEVTLDEARVADCLARIKDALVAAHGARQRA
>NZ_CP054569.1|WP_087881462.1|3720826_3721168_-|integration-host-factor-subunit-alpha
MGNSMLAEPRTLTKAELAELLFERVGLNKREAKDIVDTFFEEIRDALARGDSVKLSGFGNFQVRDKPPRPGRNPKTGETIPIAARRVVTFHASQKLKSVVEQAAPAASDDAAE
>NZ_CP054569.1|WP_174716666.1|3720337_3720769_-|MerR-family-transcriptional-regulator
MTRTESTVTLPPIPAKRYFTIGEVSDLCGVKPHVLRYWEQEFTQLKPVKRRGNRRYYQHHEVLLIRRIRSLLYEQGFTISGARNRLGDARDVPHDQDAAVRLSGAEMQALRTELGNVSTMLAEALDTAANAAGASNASTSSAV
>NZ_CP054569.1|WP_174716665.1|3718587_3719865_-|rhomboid-family-intramembrane-serine-protease
MALFQRTSPIKKILAGKITLLLIVSNIAVYLVAGYLDTRAFESLSQTSFLIDWGGNVPALTLSGEYWRLFTSMFLHVGFLHLAINMLALWSLGIILEARMRSWVFLGVYLLSGLCGSVVTALWHRDEFFLSCGASGAILGIFGAAIVYGLHDRRMGRPHIPPGNLLLSLALTFGAGFAFDVDNAAHLGGLLAGALLAGLALCAERLRPVAAAAVLAGAGMIGAAALAVVTLDNHDRDMQQQIAAARFEHTLGKMGLLQSAKAPASALILDACVDRALFEAAQGGSAAPDLRRCIKPGDREQALLATFMPRRYQDCLAQTVELQQLYPDAAARKALAGAEQYCAMQTGIYAALFQEQPVELEVEKALQTRLLMKFLVDGGRKFRTDSAPLQAQANAMQGILRRPGELASAIIGRSGCPYWSCARSR
>NZ_CP054569.1|WP_088146538.1|3717734_3718487_-|glucose-1-dehydrogenase
MSLSLAGKVALVTGASSGIGRAVALRLAAEGAALVLTARRRDLLERVADEIRGAGGRACVSAGDVAQPETHRQAVLDAQREFGGLDIAVNNAGTAGPIKPLAEVGLDEWERTLSVNLTAAFLGARHQIPVMLERGGGALVFVSSFVGTSVGLPGMAAYGTSKAALMGLVKGITADYGAQGIRANALLPGGVDTDMAGNQEQKDWAANLHAMKRIARADEIASAALFLASPMASFVTGSALYADGGNSAVK
>NZ_CP054569.1|WP_174716669.1|3727799_3728735_-|alpha/beta-hydrolase
MATNELQGAAGAAAASLTGGALAAGRQVHHRFEQVGDVKVFYRVAGDRRAPAVLLLHGYAASSFMYRNLIPLLADRYYVIAPDLPGFGFTEAPARGQYAYTFDQLARTIGQFTEQLRLERYAMQVFDYGAPVGWRLAAANPSRVSAIVSQNGNAYEEGLGPGWAQIQEYWKKPSQANRDALREFSTPASIEWQYLEGVPDATLVAPDAIALESFLVSRPGNAEVQLDLLLDYASNVEKYPEFQAYFRKHQPPLLAVWGKNDPFFLPAGAEAWKRDIPGADVRFYDTGHLALETHGVEIGAAIRAFLDENVK
>NZ_CP054569.1|WP_174716670.1|3728829_3729411_+|CGNR-zinc-finger-domain-containing-protein
MLENATAQKAPLFVGDDLALDFINSAFGVGPAHHECFTDDHAVLAWLKLAGVLPQGIEAPPEGLMKLALQLRESAKCLLNAAKLGGEADASVVNHVLKAGRRSKELEWDSASNAFKVVRRRLQEDAASLLEPVAQAVVMLLTDAPLDLVRQCEAHDCTLMFHDRTKSHRRRWCSMAVCGNRMKVAAFRSRKKG
>NZ_CP054569.1|WP_174716671.1|3729421_3730384_-|zinc-dependent-alcohol-dehydrogenase-family-protein
MKAIVLKSFGGPESFELRDVPKPVPRAGQVLVRVHATSINPLDYQVRRGDYPDLVPLPAITGHDVSGVVEAVGPGVTAFVPGDEVWYTPQIFDGPGSYAEYHVAAESIVGKKPASLSHLEAASLTLVGGTAWEALVVRAALRVGESILVHGGAGGVGHVAIQLAKAIGARVFTTVRDSNIEFARSVGADVVIDYEKEDYVDAVLRETGGRGVDVVFDTIGGNALSRSPDALAQLGRVVSIVDIAQPQNVLQAWGKNASYHFVFTRQNRGKLDELSALVARGQLRPHVGAVYPLADIPLAHARLERPNNGIQGKIAIAVEP
>NZ_CP054569.1|WP_062680702.1|3730447_3730750_-|winged-helix-turn-helix-transcriptional-regulator
MDLLEVFKALSNRTRLEILKGLKDPVNSFPPQDEGDVLTVGVCVSSIQEGVGLSQSTVSDYLATLQRAGLVEARRIGQWTYYKRNEAAISALAEIIGKEL
>NZ_CP054569.1|WP_043545226.1|3731424_3731763_+|P-II-family-nitrogen-regulator
MKLIIAIIKPFKLDEVRVALSGIGVQGLTVTEVKGFGRQKGHTELYRGAEYAVDFLPKLRVEAAVPDHLVDQVIEAIEMAARTGKIGDGKIFAAPLEQVIRIRTGEAGEAAL
>NZ_CP054569.1|WP_174716672.1|3731795_3733034_+|ammonium-transporter
MDKADISWLLVSTLLVLMMAVPGLAMFYGGLVRSKNVLSVLLQVLCTFVLGLVLWFTYGYSLAFTEGNAFFGGLSRAFFSGMFNPADGAYSMSNTLTELLFASFQATFAGITCALIVGSFAERARFSAVLVFTVIWFTFAYVPIAHMVWFASETAPGLLNAKGALDFAGGTVVHINAGVAGLVGAYVVGKRVGYGREAMQPHNLPMTFVGAALLWVGWFGFNAGSALAANENATLAFFNTMIATAGAVLAWLFTEWAIKGKPSMLGAASGAVAGLVGITPAAGLVGPVGALVIGVIAGAVCVWGVNGLKRLLRADDALDVFGVHGVGGIVGALLTGVFNAQILGGPGLAEPGMIGHQLWVQLEGVLLTIVWSGVVAWIAYKIANALCGMRVPEDQEREGLDVTSHGESAYHS
>NZ_CP054569.1|WP_062680706.1|3733209_3734964_-|phosphoenolpyruvate--protein-phosphotransferase
MDTHDGAGGASPVVCLYGKGVAKGYAIGRAVVMGAAALEVAHYRISPEDVPAESSRLTEALASAQQELLQLADTLPADAPRELGAMLNVHSLLLGDPLLAEQTLALIADRHYNAEWALTTQGQILGQQFDAMEDEYLRERGADVRQVIERVLHVLAGSSAILPDMSHMGGDDALVVVAHDISPADMLRLRGGRFAAFVTDLGGPTSHTAIVARSMGVPAVVAMGNVRELVRDGDMLIIDGGAGAVIVNPSDRILQEYRRRQSAYADERAELSLLRDEPSVTLDGIDIVLHANIELPEEAALALASGAHGIGLFRSEFLFMGRPDLPGEEEQYEAYSSVVKVMAGRPVTIRTLDIGSDKTLDGEATVATNPALGQRAIRYCLARPEMFATQLRAILRASAHGPVRLLIPMIAHMHEVVATKAAIESARRELDARGQAYAPHMEVGAMVEVPAIAIAIEPFAQALDFLSIGTNDLIQYTLAIDRGDHDVASLYDPLHPAVLRLVAHTINAGERAGKPVAVCGEMAGDSRMTRLLLGLGLTEFSMHPQQLLDVKREVRRAHSNALRVKVAAALNRALPVDLDALGPG
>NZ_CP054569.1|WP_043545224.1|3735022_3735292_-|HPr-family-phosphocarrier-protein
MPNTDIVISNKLGLHARAAAKLTQLASKFSSEIFISRGAQRVNAKSIMGVMMLAAGLGVTVRLEASGNDAEQALSEIETLFDSKFGEQE
>NZ_CP054569.1|WP_062680708.1|3735403_3735805_-|PTS-mannose-transporter-subunit-IIA
MTTGIVIVVHAPLGAAMRECASHVMGNLDGMLAIHDIQPADRPDDLAPDVLKDILEQEHGGGVLVLTDLIGATPANIAKRAVADAQAQGIQCCVLAGLNTPMLLRALTYRGLPLAETREKALAGGVQGVLRVD
>NZ_CP054569.1|WP_088145674.1|3735821_3736790_-|glutathione-synthase
MHVLFVLDPLPLLKAYKDSSVAMMRALVARGHTLSVAMQGDLYIEGGTVKAVATPIELVADADLHGHDWWRESAAQDLPLADFGAVVMRKDPPFDMEYVYSTHLLEYAEAQGARVFNGGAAIRNHPEKLAITEISEFTAPTLVTRNMARLRAFHEAHHDVIVKPLDGMGGTGVFRLQPKDPNLNAILETLTDNGARTIMAQRYIPDIVKGDKRILLIGGEPVPYSLARIPLAGETRGNLAAGGRGVAQALSPRDREIAEAVAPRLAARGLLLVGLDVIGDYVTEVNVTSPTCFVEIAEQTGFDVAGMFVTALEKAVAGKAAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054569_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054569_4

3994954-3995076

Orphan

Consensus_repeat	Method
TTTTCATCGCCGGGCCGCCCCAAGATGAAAACGCCCCCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054569_4

>merge|NZ_CP054569|4|3994954-3995076|CRISPRCasFinder
TTTTCATCGCCGGGCCGCCCCAAGATGAAAACGCCCCCTTGGGGGGCAGCGAGCCCGCGCAGCGGGCGCAGCGTGGGGGCATCTTTTCATCGCCGGGCCGCCCCAAGATGAAAACGCCCGCCT

>NZ_CP054569|4|4|3994954-3995076|CRISPRCasFinder
TTTTCATCGCCGGGCCGCCCCAAGATGAAAACGCCCCCTT	GGGGGGCAGCGAGCCCGCGCAGCGGGCGCAGCGTGGGGGCATC
TTTTCATCGCCGGGCCGCCCCAAGATGAAAACGCCCGCCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054569.1\|WP_062684405.1\|3985969_3987433_+\|ribonuclease-G	unknown	unknown	gnl\|CDD\|183285
NZ_CP054569.1\|WP_174716751.1\|3992676_3993648_+\|heptosyltransferase	unknown	unknown	gnl\|CDD\|366450
NZ_CP054569.1\|WP_062684406.1\|3987639_3988341_+\|DUF3053-domain-containing-protein	unknown	unknown	gnl\|CDD\|371434
NZ_CP054569.1\|WP_088445902.1\|3995751_3996912_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP054569.1\|WP_062684368.1\|3999084_3999837_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP054569.1\|WP_088147795.1\|3988831_3990637_-\|cation:proton-antiporter	unknown	unknown	gnl\|CDD\|235131
NZ_CP054569.1\|WP_062684371.1\|4001778_4005270_-\|DNA-polymerase-III-subunit-alpha	unknown	unknown	gnl\|CDD\|235554
NZ_CP054569.1\|WP_062684367.1\|3997978_3999088_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340846
NZ_CP054569.1\|WP_088147817.1\|3999833_4000682_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|213026
NZ_CP054569.1\|WP_174716755.1\|4005385_4006285_+\|lipid-A-hydroxylase-LpxO	unknown	unknown	gnl\|CDD\|380241
NZ_CP054569.1\|WP_088147816.1\|4000678_4001779_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP054569.1\|WP_174716752.1\|3993660_3994425_+\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP054569.1\|WP_174717564.1\|3978018_3979374_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP054569.1\|WP_174716756.1\|4006342_4010266_-\|ATP-dependent-RNA-helicase-HrpA	unknown	unknown	gnl\|CDD\|273900
NZ_CP054569.1\|WP_088445899.1\|3976009_3977968_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226654
NZ_CP054569.1\|WP_062684359.1\|3988478_3988709_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054569.1\|WP_174716753.1\|3994470_3994740_+\|YkgJ-family-cysteine-cluster-protein	unknown	unknown	gnl\|CDD\|308985
NZ_CP054569.1\|WP_174716754.1\|3995164_3995755_+\|ATP-phosphoribosyltransferase-regulatory-subunit	unknown	unknown	gnl\|CDD\|238396
NZ_CP054569.1\|WP_087881394.1\|3996886_3997612_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|213023
NZ_CP054569.1\|WP_174716750.1\|3990797_3992573_-\|lipid-A-export-permease/ATP-binding-protein-MsbA	unknown	unknown	gnl\|CDD\|131258

Protein	Function_ID	Function_description	E-value
NZ_CP054569.1\|WP_062684405.1\|3985969_3987433_+\|ribonuclease-G	gnl\|CDD\|183285	PRK11712, PRK11712, ribonuclease G; Provisional.	0
NZ_CP054569.1\|WP_174716751.1\|3992676_3993648_+\|heptosyltransferase	gnl\|CDD\|366450	pfam01075, Glyco_transf_9, Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.	7.11116e-47
NZ_CP054569.1\|WP_062684406.1\|3987639_3988341_+\|DUF3053-domain-containing-protein	gnl\|CDD\|371434	pfam11254, DUF3053, Protein of unknown function (DUF3053). Some members in this family of proteins are annotated as the membrane protein YiaF. No function is currently known.	3.80953e-73
NZ_CP054569.1\|WP_088445902.1\|3995751_3996912_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.57118e-41
NZ_CP054569.1\|WP_062684368.1\|3999084_3999837_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	6.6342e-109
NZ_CP054569.1\|WP_088147795.1\|3988831_3990637_-\|cation:proton-antiporter	gnl\|CDD\|235131	PRK03562, PRK03562, glutathione-regulated potassium-efflux system protein KefC; Provisional.	0
NZ_CP054569.1\|WP_062684371.1\|4001778_4005270_-\|DNA-polymerase-III-subunit-alpha	gnl\|CDD\|235554	PRK05673, dnaE, DNA polymerase III subunit alpha; Validated.	0
NZ_CP054569.1\|WP_062684367.1\|3997978_3999088_-\|glycosyltransferase	gnl\|CDD\|340846	cd03819, GT4_WavL-like, Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.	1.06416e-60
NZ_CP054569.1\|WP_088147817.1\|3999833_4000682_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|213026	cd10969, CE4_Ecf1_like_5s, Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.	1.11296e-85
NZ_CP054569.1\|WP_174716755.1\|4005385_4006285_+\|lipid-A-hydroxylase-LpxO	gnl\|CDD\|380241	NF033391, lipid_A_LpxO, lipid A hydroxylase LpxO. Members of this family are LpxO, an enzyme that modifies one of the lipid chains in lipid A by hydroxylation, with resulting changes in resistance to the host immune response and to the antibiotic colistin. This family, as built, includes LpxO1 from Pseudomonas aeruginosa, but not its paralog LpxO2.	0
NZ_CP054569.1\|WP_088147816.1\|4000678_4001779_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	4.56646e-67
NZ_CP054569.1\|WP_174716752.1\|3993660_3994425_+\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	5.38994e-42
NZ_CP054569.1\|WP_174717564.1\|3978018_3979374_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	0
NZ_CP054569.1\|WP_174716756.1\|4006342_4010266_-\|ATP-dependent-RNA-helicase-HrpA	gnl\|CDD\|273900	TIGR01967, ATP-dependent_RNA_helicase_HrpA, RNA helicase HrpA. This model represents HrpA, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria. HrpA is about 1300 amino acids long, while its paralog HrpB, also uncharacterized, is about 800 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing. The HrpA/B homolog from Borrelia is 500 amino acids shorter but appears to be derived from HrpA rather than HrpB. [Unknown function, Enzymes of unknown specificity].	0
NZ_CP054569.1\|WP_088445899.1\|3976009_3977968_+\|sensor-histidine-kinase	gnl\|CDD\|226654	COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms].	6.37194e-180
NZ_CP054569.1\|WP_174716753.1\|3994470_3994740_+\|YkgJ-family-cysteine-cluster-protein	gnl\|CDD\|308985	pfam03692, CxxCxxCC, Putative zinc- or iron-chelating domain. This family of proteins contains 8 conserved cysteines. It has in the past been annotated as being one of the complex of proteins of the flagellar Fli complex. However this was due to a mis-annotation of the original Salmonella LT2 Genbank entry of 'fliB'. With all its conserved cysteines it is possibly a domain that chelates iron or zinc ions.	3.67907e-06
NZ_CP054569.1\|WP_174716754.1\|3995164_3995755_+\|ATP-phosphoribosyltransferase-regulatory-subunit	gnl\|CDD\|238396	cd00773, HisRS-like_core, Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain. HisRS is a homodimer. It is responsible for the attachment of histidine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs. This domain is also found at the C-terminus of eukaryotic GCN2 protein kinase and at the N-terminus of the ATP phosphoribosyltransferase accessory subunit, HisZ. HisZ along with HisG catalyze the first reaction in histidine biosynthesis. HisZ is found only in a subset of bacteria and differs from HisRS in lacking a C-terminal anti-codon binding domain.	7.36875e-24
NZ_CP054569.1\|WP_087881394.1\|3996886_3997612_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|213023	cd10918, CE4_NodB_like_5s_6s, Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.	2.05329e-58
NZ_CP054569.1\|WP_174716750.1\|3990797_3992573_-\|lipid-A-export-permease/ATP-binding-protein-MsbA	gnl\|CDD\|131258	TIGR02203, Lipid_A_export_ATP-binding/permease_protein_msbA., lipid A export permease/ATP-binding protein MsbA. This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Transport and binding proteins, Other].	0

>NZ_CP054569.1|WP_174716753.1|3994470_3994740_+|YkgJ-family-cysteine-cluster-protein
MSVQACRPGCGACCIAPSISSPIPGMPDGKPAGVRCAQLDEENRCRIFGHPERPAVCGSLPPSLEMCGDSAGEAMSRLTWLEKATAVSP
>NZ_CP054569.1|WP_174716752.1|3993660_3994425_+|YdcF-family-protein
MPFSSYLANLIIPYNLCMTLVVIGLALGWFRLRKTGGVLIGTGLLWALFWSLPATSLWLGGALESRYPHLPPADSPTADAIVVLGGNTANGRANWFLPYDKDTAVVRVDTAAQLYLAGRAPKVLLSGGALEGDVSEARGMAYAIRQQGVPESALILENSSRTTYENATLTEDQLKARGIDKVLLVTSALHMPRAMAAFSKQGVQVIAAPAPPQIVPPTDGSLPLWLPDQRTFDASRSIIKEYAGLFVYWLRGWV
>NZ_CP054569.1|WP_174716751.1|3992676_3993648_+|heptosyltransferase
MSDISCLYVRLPNWVGDVCMSLPSLRALQASGLPLVICARPWARDLLDGVAKRDFIPMRGKVGPDRAAVSAHRRSLGALGRRARGLLLPDSLSSALVFRLAGLPSAGYRDDGRSFLLRWPVSKPDDSLHAVQSWHYLTREALMRWGLPSGPAEPGPTLDLPLTAAHQGAAEQALEAAGLASGRFVLIAPTATGLHKGKIKVWPGFDTLTRALQAQGHTVVMCPPPAETEEARRNAPTALLLPPLSLGAFAALTARAALVICNDSGVSHVAAAAAARELTLFGVTRPGRTGPWSPRAVCVGSENAWPTVEEVAQQATILLDETQ
>NZ_CP054569.1|WP_174716750.1|3990797_3992573_-|lipid-A-export-permease/ATP-binding-protein-MsbA
MNSAARHAPAGSQPVKAELWKRIYSRVGSYWKGLLLAILLMAGAAATQPVLAVIMKPLLDGGFSGAKPYYVWALPLAVVGLILLRGICNFFSDYLLAWVANNVLLGMRRDMFERLLGLPDADFKQGDTGRLLNRFTIDAGNVTGYATDVITVLVRETLVVIALICVLLYMSWVLTLIILIMLPVSVLISRFFIQRLRRINRETVNMNAELTRVVGEGIDGQRVIKLFDGYEVERGRFDFVSRRLRRFAMRTATADAALTPLTQVCISISVGAVIAVALSQANSGALTVGSFASFMAALAQIFDPIKRLTNVAARMQKMLVSAESVFTLIDQVPECDTGTRELPEPVRGKVEFRNVSHRFPDADRDTVNDVSFVVEPGQTVALVGRSGSGKTTLVNMLPRFVLADSGQILVDDVPIGDLTLRSLRSHLSLVSQDVVLFDDTIAANVGYGALGKSSEQKVRDALAAANLLEFVDGLPQGMNTPVGENAARLSGGQRQRLAIARALIKNAPILILDEATSALDNESERQVQASLERLMKGRTTLVIAHRLSTVQNADRIIVLDAGKIVEHGGHAELLAAGGLYASLYKMQFRED
>NZ_CP054569.1|WP_088147795.1|3988831_3990637_-|cation:proton-antiporter
MSLPSDGNQLVNVVVLLGAAVVAVPLFKRLGLGSVLGYLAAGLAIGPFGMGLFSDPRSILHVAELGVVMFLFIIGLEMQPSRLWKLRGEIFGLGVAQVLACGALLTGVGLLAGLSGPAAFMAAMGFVLSSTAIVMQILAERGETASAQGQRIVSILLLEDLAIVPLLALASLLAPAGGAEHGDPWLQAAIAIGCILALLAAGRWLLNPLFRLLAAAHAREVMTAAALLVVLGAALLMELGGLSMAMGAFLAGVLLSESTFRHQLEAEVEPFRGILLGLFFLGVGMSLDLSAVVREWPLILAAVVVFMLVKSAGVYAVARILRATHAEATTRAALLAQGGEFAFVLYGAAAAAGIFDAHTAAVLTAVVIISMAFTPLCVLALRWLLPKPAPSMEGVDVAKDLDGCVLIVGFGRFGQIVTQAMLARDLKVSILDTDTDAIRAAAKWGVKVYYGDGTRVDMLRTAGAEHACIILICIDNPVSVNHMVKLVKAEFPLVRVAVRAYDRIHSLALAKEGVDYQVRETLESALAFGEGALRVIGVPADEAAEVVQDVRKRDTDRFELEVAGGLFAGRSLLYGNMSSPADGRNDKPDREAGETAASPSA
>NZ_CP054569.1|WP_062684359.1|3988478_3988709_-|hypothetical-protein
MLQSDRISTTPQAVGVELARRQALALRCGFSAGSMRRLLSQTGGAGPAWSIGAHREADRARGARAFPFRIAAVAAS
>NZ_CP054569.1|WP_062684406.1|3987639_3988341_+|DUF3053-domain-containing-protein
MKSLFRPFLVLAAALPLLLAACGDKEPEQRAAFTQFLQTRIVDKPGVRVPKLTDEEKKSFGDYAAHYAVITDFNAGMDASVKPLSGIMQKGAVRSLNDIVTRRDDFKAVQASLNEMGTALQAQQAKADAAHAQLKQPEDLKAVYDKAYEKTVSLPADTFRDTLPQLNATFDASLKIADYVAAHASQIEMSGAIVKVKDPAVQAELNQLLQDLNTQAKNVQQAHTRMQAVMMGR
>NZ_CP054569.1|WP_062684405.1|3985969_3987433_+|ribonuclease-G
MSEDILINVTPFETRVALVEQGSVQELHVERSIQRGHVGNIYLGRVVRVLPGMQSAFIDIGLERAAFIHIADLRENRGERSQGLTPTPIEKLLFEGQTIMVQVVKDPLGTKGARLSTQISMAGRMLVYLPHDPHIGISQKIDTESERIQLRERLQALMPAEEKGGFIVRTQAEGANDEELTADLEYLRKLWTSVQAAARTQPAPALLHQDLTLAQRVLRDMVGPGTGAILVDSRTTSAAMLEWARIYTPSVVDRIQHYSGERPLFDTANVDEEISRALSRRVDLKSGGYLIIDQTEALTTVDVNTGGFVGGRNFDDTIFKTNLEAAQAIARQLRLRNLGGIVILDFIDMEDQEHRETVLAELKKALSRDRTRMTVNGFTQLGLVEMTRKRTRDSLAHQLCEPCPMCEARGNVRTPRTVCYEILREILREARQFNPKEFRILASQEVVDLFLEEESQHLAMLGDFVGKRVSLEVEGRYSQEQYDIILV
>NZ_CP054569.1|WP_174717564.1|3978018_3979374_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MRQPLPPHAIFIDDDDELRRANAQTLKLHGISVDAHASARAALPALTRAFDGVVVSDIRMPDIDGLQLFRRVREIDPDIPVILITGHGDIATAVQCMHDGAYDFLAKPYAADRLITAITHAAEKRRLVLENRRLREAAFAVEADEVPFIGTTPAMQRIKQTLRHIADADVDVLVEGETGTGKEVVATALHRLSRRRDRPLVAINCGALPESVIESELFGHEAGAFTGAQKKRIGRIEHASGGTLFLDEIESMPLAVQVKLLRVLESRQITPLGSNDVRNLDLRVVAATKEDLGSPAIRATFREDLFYRLNVVTIRIPPLRERREDIPLLFAHYLGHASRRFQRDIPEMPAAIKQHVMTHDWPGNVRELAHFAERVVLGVLNTPVPDAAAATAAALSLPERMERFEAQLIRETLEAHRGDLKATLESLGIPRKTFYDKLQRHGIDRQQYLPQ
>NZ_CP054569.1|WP_088445899.1|3976009_3977968_+|sensor-histidine-kinase
MSRPDFSPPRASQAGEPPSLSVPRRRKHAWPWRVAAILLGVGVVFGVLHAATLWARDGALKNAATQARGTAQVNAALLRNNLDKFRALPFVLTRDVDVRAALQNPAPGQIESLDEKLDTLSRGVGASAIYVLDKKGWAIAASNWREPATFVGVDYQFRPYFQGAVTHGSAEHFALGTISHEAGLYLSRRVDDVGGAMLGVVVLKVDFRELEADWRQSNAPIFVTDEHGVVLLGSIADWRFDVLAPLPPGLAQTLRTSLQFGDARFQPLPVQPPLQAVSTGQLVRADTALPQIPAAAPLLHTTLPIVESPGWTLHLLSPVQAAINQATANAQLGALLAQSALAALIGIVLLRRHRQRERAHQQAAIHEQLTSLVDERTSQLLRVNEQLVDEMDERQRTAARLHTMQEELVQASKLALLGQVAAGVAHEINQPVAAIRAYADNAAEFLRRHDDGSARENLGTIAALTDRIGHITGELRAFSRKAGASVGPTSLKDCLEGALLLVGPRARRQGVALQRPPEMQNDLVQANRIRLEQVLVNLLQNALEALEGRTDGRIVITQQDLGATIRIQVADNGPGLSAQARARLFTPFHTTKPEGLGLGLVICRDIVAEFGGELNVAPPASASSDSQAPDGGALFVLTLRKAPGQDTASSPS
>NZ_CP054569.1|WP_174716754.1|3995164_3995755_+|ATP-phosphoribosyltransferase-regulatory-subunit
MKTDSGAIFIDAGAEEAIVPALWSQDTFVQKTGGSEIIDQMWAFPDKKGRPCCLIPEATALFQERCKDLLGRRQERLLFYVARCYRYERPQAGRYREFSQLGFEYLGPNPRSAAERSQEIAVGFLDSLGLRYELDDAAKRGLSYYLDGQGFEIRCAELGAQQQVLGGGAYREGAGFAIGAERLLLAMEAQALIGRA
>NZ_CP054569.1|WP_088445902.1|3995751_3996912_-|glycosyltransferase-family-4-protein
MKTPAGAVERRLRIALLVDRFGNRFGGAEAYGVELMRVLGQRHDVSVVARDFDSDLPFPFLPVRFPAWLPSWMRVLYFAWRADRLTRGRYDIVHSHMNGWAGEIQVMHVTPVRYNRLTRVKPLQRLTAWLSPRLATYLLLEKLRVRAVPARRVVAVSGLIMDQLHRSYGPQLPVDIIAPGVKLPTAAQREGREETRARLGWDAETIGCLLVARNPLRKGLPALLDALGQLPPQYRLLVVGADEPTRERVRAAGAIASRVTLIDPTPDVARYFSAADIYAHPTLNDSYGMAPLEAMSHGLPVVVSSPAYCGFAQYLSAGKDALILQDPRNGAQLAQALERLGSEPDLRAALAERGLAIAREQSWEAVASRYEDLYAQVLRERGQAGA
>NZ_CP054569.1|WP_087881394.1|3996886_3997612_-|polysaccharide-deacetylase-family-protein
MSIPILMYHQIGEPNPKGTPYRGLTVHPASFARQMRWMRRLGYRGLSMRDIMPYVRGERQGKVFGITFDDGYRNVHHNAMPVLSELGFTATNYFVAHQFDGGNVWDLQKGIPFSALMTVNEMREWAQAGNEVGSHTLDHVHLPKIAPEEARRQIVESKDELEQALGGPVTAFCYPYGDHGPEHRVMVREAGYDNATLTQRGLAAVSDDPYGLPRVTVARSTNIIRFLQKCLTRYEDSRRRR
>NZ_CP054569.1|WP_062684367.1|3997978_3999088_-|glycosyltransferase
MKILYTNFHAGNGGGHVTYIINLAKALAREHQITVAAPSTSRLYRYAQAIPGVTVEPMQYTTRPSSWFKDRAQLRRLIKAGRYDIIHANGSADHKQVMLATLGMSRRPRIVFTKHNDHPLTSFGHKLRVALATDHSIAVSDYIHGLMANSPYGKRPITTIRHGIDTDFFAPPPPESLDKLRALIFGPDWQGKLLLGSAGGTDYDKGWLDLVAAAAALPPADKARVLLMVAGDAPSEAKLARVRELGMIDQVRFPGLLDDVRASLAACHAGFVLSYREALSFACREIMGLGLPALVSDAGGLPENVTDGVDGWIVPVRDVPAITAKLRFMLDHPDAVRTMGAQARETAVRDFNLQRFAAATLDVYRRTLA
>NZ_CP054569.1|WP_062684368.1|3999084_3999837_-|glycosyltransferase-family-2-protein
MKLSVIIITKNEAANIAACLKSVAFADEFIVVDSGSTDGTVELAQALGARVEVTSDWPGFGPQKNRALDLATGDWVLSIDADERVTPELAQEIQEALSAPRADAYEIARLSNFCGRDIRHSGWWPDYVLRLFKRGTARFTDAAVHERVVPANGQPLKMRGYFHHYPYDNLDALITKVNRYSSDAAAMMYAKGKRTSIFGALGHGFWTFVRIYLIRRGFLDGKHGLVLAVTAAAGSFFRYSKLMFLADKQK
>NZ_CP054569.1|WP_088147817.1|3999833_4000682_-|polysaccharide-deacetylase-family-protein
MNAPNVPVLMYHHVTPAGGMIAATPDVFEAQISRLARAGYHSLSAAQFAAYLAGGEAPERSVLITFDDGYLNNWVHAHPVLARHGMRAVLFTITGWIGDGPLRPHAGQGGPLPATPDHDACKQLVASGRADDAMLRWSEIEAMQAAGTFEFHSHTHTHTRWDKVCGADTDAKRAHIAQELRDSRETLVRRLGQASDHLCWPQGYFDADYVAAAREAGFRHLYTTDPFGQNSPGADPEHIYRFAVRNQAGSWLNRRIWLSRDPFWGPRFHAWKAWKKRLRNRG
>NZ_CP054569.1|WP_088147816.1|4000678_4001779_-|glycosyltransferase-family-4-protein
MRSLRIVHSEAATSFGGQEGRIFKEMTAMRARGHHMEAICQPQALLAERLSDAGFTVHTLEMDGVANYLKGVATIRGILREGRFDVLNTHSRRDTVIAAAAGRLAGTPLIVRTRHLSNKVGSLWSYTRLPHRVTTVSDHVRQHLIDRGVPADRVATVYSPIVLPPPVERSTLREELGLADDDIVVGCVAVMRATKGHKDLIDAIAPLMASRPKLHLVFVGGGSPVFEQTQAYVVELGLQDRIHLMGMRRDVPNLLAGFDLFALATQQEASGTVYVEAQASGLPVIGTDVGGVSEMFRDGETGILVPPKDARALTEALQRLIDDADLRRRMGEAGRKMVWDEGVFSPARLAETTEAVYARWLGERAK
>NZ_CP054569.1|WP_062684371.1|4001778_4005270_-|DNA-polymerase-III-subunit-alpha
MSEAVTNPSPFVHLRVHSEFSVVDGIVRIPDLIKRVAKLGQPAVALTDLSNLFGLIKFYKGARGAGVKPIAGCDVWLSNDDDPAKPFRLLLLVRNHQGYLNLCELLTKAFLTNQGKGRAEIRREWLQGQDGLIVLSGGRGGDVGQALDAGNAVSALALARQWAHLFPGSFYIELQRAGMDGDEAYTQAAMRLAAEAGLPVVATHPVQFLDEFEFQAHEARVCIAEGEILANPRRVRRFSKEQYLLSSEEMARRFADVPSALANTVEIAKRCNLSLVLGKPRLPNFPTPEGVTLDDYLVQLSEEGLEKRMRFLFPDDAERESKREQYYERLRWECKTIIQMGFPGYFLIVQDFINWGKNNGVPVGPGRGSGAGSLVAYALGITDLDPIRYDLLFERFLNPERVSMPDFDIDFCQDNRERVIDYVKEKYGRAAVSQIATFGTLGAKAVVRDAGRVLDMPYMFCDGLSKLIPFNPMDPWTLERTLKDEPAFKDRYEQEEEVRALVDLAKPLEGLTRNIGMHAGGVLIAPGKLTDFCPLYCQPGQENSAVSQFDKDDVEAAGLVKFDFLGLRNLTILDWAVRYVRQFNEDKRDFDVMALALDDPAAYKILCDANTTAVFQLESRGMKELLKKLRPNTFEDIIAMLALYRPGPLESGMVDDFVNRKHGRAAVDYFHSDLESTLKSTYGVIVYQEQVMLISQIIGGYSLGGADLLRRAMGKKKPEEMAKHRELFEQGAKEKGHDPDLAVKLFDLMEKFAGYGFNKSHSAAYALISYQTAWLKAYHPTEFLAATMSSDMDDTDKVQIFCRDAQDNGVEVLPPDVNFSGYRFEPVADKHTKNGKPPRTMRYGLGAVKGTGQGAVEDILRARKEGGPFLNLFDFCRRVSKHAVNRRTIEALIKAGAFDTIEPNRAAMLASVPTAMEAAEQAARSANQASLFGDDSSDVVAGELAKVAPWDLHKKLTEEKTALGYYYSGHLFDAWRDEVRRIVPMQLARVEPQRDLQWMCGVLASVRVMMTRRGKMVFAVLDDGTAQVEISVFNELYEKHRNRLREDQLVIVQGKVSNDDYSGGMRIVAEQLYDLQLAREARAKSLRVKLNGSADAARLRQMLNPFRAEPENGIPGVPVDIVYSKNNFLCTVRLGEEWRVRMADTLLANLNEWTKPDGVEVTY
>NZ_CP054569.1|WP_174716755.1|4005385_4006285_+|lipid-A-hydroxylase-LpxO
MKWLIPGIWLAAILFAHFRGRVKLPLGRQMLDHSVLLAPINAFMVLASRVPPTPYLTTSEIAELKVLDDNWETIREEAVQMAELRRIKAADTHNDIGFNSFFKYGWKRFYLKWYDARHPSAEELCPKTVAILKTLPKVKAAMFAELPPGGHLNRHRDPFAGSLRYHLGLVTPNDDRCHIIVDGEPYSWRDGESVVFDETYVHEAYNRSEQNRIILFCDVERPLKWRWAEAFNRWFGRVVMSAASSPNDGGDQTGAINKLTHAHWVIDQKRKAFKAWNRKVYKATKFGLIALVIVGFLAL
>NZ_CP054569.1|WP_174716756.1|4006342_4010266_-|ATP-dependent-RNA-helicase-HrpA
MPESSSPRAPKAADAAAPEAAAAQNARRAPRPERPIPAVTYPEDLPVSARRQEIARAIANHQVVIVSGETGSGKTTQLPKICLELGRGRQKMIGHTQPRRLAATSVAKRIAEELNTPMGEVVGYQVRFNDRTGPNASIKLMTDGILLAESQRDPLLRRYDTIIIDEAHERSLNIDFLLGYLKQLLPRRPDLKVIITSATIDAERFARHFAASEDKPAPVIEVSGRLYPVEIRYRPVREEAGPDEAPAAGKPGRERMSGDEERDLIDAIVDAVDECARHGPGDVLVFLPGEREIRESAEALRKRHPAGTEVLPLYARLSQAEQEQIFHPRTNARRIVLATNVAETSLTVPGIRFVVDSGLARIKRYSWRNKVEQLRIEPISRASANQRAGRCGRVGPGVCIRLYDELDFNNRAPFTDPEVLRSSLASVILRMKSLKLDDIEQFPFVEAPPGRAVADGYHLLQELGAIEMASASGEEADGARTGASFALTRSGQELAKLPVDPRIGRMILAAREQQCLAEMLIIASALSVQDPRDRPMQEREAAEAAHAKFGDDKSEFISFLKLWRWYGEQVQHKASQRKLVALLRQNFLSPIRLREWHDVHTQLAALVGEQGWRVNQTEATYEQLHLALLSGLLGNIGFKSDEGGHYQGAREIRFHIHPGSRLVKKAGRWIVAAELVETTRLYARCVARIEPPWLEKVGAHLIRRNWSDPRWEKKAGQVVANERATLYGLVIYAGRRIHYGRVNPAHARELFIRQALVPGEIDTRLAFVAHNRKLIAGIEKLEHQTRRPDILVDDELIYAFYDRQLPEGISQTATLEKWVSGLDKAAAAQLMLTRDELMRHEAAGVTTDVFPKKVEWQGVSMALDYHFEPGSARDGVTLSVPLFALNQIDPARCEWLVPGMLKEKVHLLLKSLPQKLRRHCVPLPDYAAGFYERWFDRLGDPQQGLVDAIIADMWDQVQVRPAVGDFKLETLPAHLFMNFRVVDEHGRMLAAGRNLAQLRAEFGKQAQATFQQLAASDTQVAQALAHENLTSWSFGPLPEIMEIKRRGQSVIGYPALVDRGAHCDLDVFDDPDEARKHHRAGLLKLFRLGLREQVKFLEKNLTDLTRISMLYMTLGTQEELRDQIVDCALGQACLAEPWPVDEQQFEARRAEGKGRLGLLAQEVARLAGAVLTEYAAVQRKLPQAKPHATAYADLQAQLGALMPKWFIRDTPYAQLAHFPRYLKAVQARIDKLRADPARDARLVAEMAPLLTQYQRARSALKGAPDPRLDEFRWLLEELRVALFAQELRTPMPVSVKRLMKSWESLQR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054569_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054569_5

4250560-4250673

Orphan

Consensus_repeat	Method
GGGGGGAAGCTAGCCCGCGCAGCGGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054569_5

>merge|NZ_CP054569|5|4250560-4250673|CRISPRCasFinder
GGGGGGAAGCTAGCCCGCGCAGCGGGCGTGGCGTGAGGGGCAACGCCCCGCCGCCGGGCCGCCCCAAGGCGGGGCAGCCCCCCTCGGGGGGGCAGCTAGCCCGCGCAGCGGGCG

>NZ_CP054569|5|5|4250560-4250673|CRISPRCasFinder
GGGGGGAAGCTAGCCCGCGCAGCGGGCG	TGGCGTGAGGGGCAACGCCCCGCCGCCGGGCCGCCCCAAGGCGGGGCAGCCCCCCTCG
GGGGGGCAGCTAGCCCGCGCAGCGGGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054569.1\|WP_062683872.1\|4252596_4253385_-\|2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA-isomerase	unknown	unknown	gnl\|CDD\|236163
NZ_CP054569.1\|WP_062683877.1\|4245933_4246782_+\|tryptophan-2,3-dioxygenase	unknown	unknown	gnl\|CDD\|188272
NZ_CP054569.1\|WP_062683879.1\|4244331_4245009_+\|DNA-repair-protein-RadC	unknown	unknown	gnl\|CDD\|178801
NZ_CP054569.1\|WP_088445967.1\|4250701_4252015_-\|phenylacetate--CoA-ligase	unknown	unknown	gnl\|CDD\|131210
NZ_CP054569.1\|WP_062683907.1\|4240655_4242098_+\|DegQ-family-serine-endoprotease	unknown	unknown	gnl\|CDD\|273938
NZ_CP054569.1\|WP_062683870.1\|4255230_4256319_-\|phenylacetate-CoA-oxygenase/reductase-subunit-PaaK	unknown	unknown	gnl\|CDD\|131215
NZ_CP054569.1\|WP_082775872.1\|4243804_4244281_-\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|223976
NZ_CP054569.1\|WP_062683876.1\|4247368_4249099_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224720
NZ_CP054569.1\|WP_062683866.1\|4259262_4260192_+\|phenylacetic-acid-degradation-operon-negative-regulatory-protein-PaaX	unknown	unknown	gnl\|CDD\|274064
NZ_CP054569.1\|WP_174716814.1\|4249095_4250496_+\|MATE-family-efflux-transporter	unknown	unknown	gnl\|CDD\|240536
NZ_CP054569.1\|WP_174716813.1\|4242827_4243805_-\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	unknown	unknown	gnl\|CDD\|234893
NZ_CP054569.1\|WP_062683867.1\|4258099_4259089_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-A	unknown	unknown	gnl\|CDD\|184320
NZ_CP054569.1\|WP_062683868.1\|4256835_4257600_-\|phenylacetate-CoA-oxygenase-subunit-PaaC	unknown	unknown	gnl\|CDD\|368300
NZ_CP054569.1\|WP_062683878.1\|4245104_4245731_+\|arylformamidase	unknown	unknown	gnl\|CDD\|132080
NZ_CP054569.1\|WP_174716815.1\|4253518_4255183_-\|phenylacetic-acid-degradation-protein-PaaN	unknown	unknown	gnl\|CDD\|143445
NZ_CP054569.1\|WP_062683873.1\|4252126_4252597_-\|hydroxyphenylacetyl-CoA-thioesterase-PaaI	unknown	unknown	gnl\|CDD\|131339
NZ_CP054569.1\|WP_006388300.1\|4257618_4257903_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-B	unknown	unknown	gnl\|CDD\|237504
NZ_CP054569.1\|WP_062683882.1\|4242130_4242775_-\|maleylacetoacetate-isomerase	unknown	unknown	gnl\|CDD\|273527
NZ_CP054569.1\|WP_062683869.1\|4256332_4256839_-\|phenylacetate-CoA-oxygenase-subunit-PaaJ	unknown	unknown	gnl\|CDD\|131214
NZ_CP054569.1\|WP_043549053.1\|4246977_4247244_+\|type-B-50S-ribosomal-protein-L31	unknown	unknown	gnl\|CDD\|234969

Protein	Function_ID	Function_description	E-value
NZ_CP054569.1\|WP_062683872.1\|4252596_4253385_-\|2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA-isomerase	gnl\|CDD\|236163	PRK08140, PRK08140, enoyl-CoA hydratase; Provisional.	2.56032e-165
NZ_CP054569.1\|WP_062683877.1\|4245933_4246782_+\|tryptophan-2,3-dioxygenase	gnl\|CDD\|188272	TIGR03036, trp_2_3_diox, tryptophan 2,3-dioxygenase. Members of this family are tryptophan 2,3-dioxygenase, as confirmed by several experimental characterizations, and by conserved operon structure for many of the other members. This enzyme represents the first of a two-step degradation to L-kynurenine, and a three-step pathway (via kynurenine) to anthranilate plus alanine. [Energy metabolism, Amino acids and amines].	2.13703e-176
NZ_CP054569.1\|WP_062683879.1\|4244331_4245009_+\|DNA-repair-protein-RadC	gnl\|CDD\|178801	PRK00024, PRK00024, DNA repair protein RadC.	8.55716e-108
NZ_CP054569.1\|WP_088445967.1\|4250701_4252015_-\|phenylacetate--CoA-ligase	gnl\|CDD\|131210	TIGR02155, Phenylacetate-coenzyme_A_ligase, phenylacetate-CoA ligase. Phenylacetate-CoA ligase (PA-CoA ligase) catalyzes the first step in aromatic catabolism of phenylacetic acid (PA) into phenylacetyl-CoA (PA-CoA). Often located in a conserved gene cluster with enzymes involved in phenylacetic acid activation (paaG/H/I/J), phenylacetate-CoA ligase has been found among the proteobacteria as well as in gram positive prokaryotes. In the B-subclass proteobacterium Azoarcus evansii, phenylacetate-CoA ligase has been shown to be induced under aerobic and anaerobic growth conditions. It remains unclear however, whether this induction is due to the same enzyme or to another isoenzyme restricted to specific anaerobic growth conditions. [Energy metabolism, Other].	0
NZ_CP054569.1\|WP_062683907.1\|4240655_4242098_+\|DegQ-family-serine-endoprotease	gnl\|CDD\|273938	TIGR02037, Probable_periplasmic_serine_protease_do/HhoA-like, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides].	9.62223e-170
NZ_CP054569.1\|WP_062683870.1\|4255230_4256319_-\|phenylacetate-CoA-oxygenase/reductase-subunit-PaaK	gnl\|CDD\|131215	TIGR02160, 12-phenylacetyl-CoA_epoxidase_subunit_E, phenylacetate-CoA oxygenase/reductase, PaaK subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other].	1.35255e-155
NZ_CP054569.1\|WP_082775872.1\|4243804_4244281_-\|peptidylprolyl-isomerase	gnl\|CDD\|223976	COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones].	5.98859e-36
NZ_CP054569.1\|WP_062683876.1\|4247368_4249099_+\|hypothetical-protein	gnl\|CDD\|224720	COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane].	3.79047e-16
NZ_CP054569.1\|WP_062683866.1\|4259262_4260192_+\|phenylacetic-acid-degradation-operon-negative-regulatory-protein-PaaX	gnl\|CDD\|274064	TIGR02277, Transcriptional_repressor_PaaX, phenylacetic acid degradation operon negative regulatory protein PaaX. This transcriptional regulator is always found in association with operons believed to be involved in the degradation of phenylacetic acid. The gene product has been shown to bind to the promoter sites and repress their transcription. [Regulatory functions, DNA interactions].	9.80739e-125
NZ_CP054569.1\|WP_174716814.1\|4249095_4250496_+\|MATE-family-efflux-transporter	gnl\|CDD\|240536	cd13131, MATE_NorM_like, Subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins similar to Vibrio cholerae NorM. The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. This subfamily includes Vibrio cholerae NorM and functions most likely as a multidrug efflux pump, removing xenobiotics from the interior of the cell. The pump utilizes a cation gradient across the membrane to facilitate the export process. NorM appears to bind monovalent cations in an outward-facing conformation and may subsequently cycle through an inward-facing and outward-facing conformation to capture and release its substrate.	3.81907e-104
NZ_CP054569.1\|WP_174716813.1\|4242827_4243805_-\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	gnl\|CDD\|234893	PRK01045, ispH, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed.	0
NZ_CP054569.1\|WP_062683867.1\|4258099_4259089_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-A	gnl\|CDD\|184320	PRK13778, paaA, phenylacetate-CoA oxygenase subunit PaaA; Provisional.	0
NZ_CP054569.1\|WP_062683868.1\|4256835_4257600_-\|phenylacetate-CoA-oxygenase-subunit-PaaC	gnl\|CDD\|368300	pfam05138, PaaA_PaaC, Phenylacetic acid catabolic protein. This family includes proteins such as PaaA and PaaC that are part of a catabolic pathway of phenylacetic acid. These proteins may form part of a dioxygenase complex.	1.2425e-120
NZ_CP054569.1\|WP_062683878.1\|4245104_4245731_+\|arylformamidase	gnl\|CDD\|132080	TIGR03035, trp_arylform, arylformamidase. One of several pathways of tryptophan degradation is as follows: tryptophan 2,3-dioxygenase (1.13.11.11) uses 02 to convert Trp to L-formylkynurenine. Arylformamidase (3.5.1.9) hydrolyzes the product to L-kynurenine and formate. Kynureninase (3.7.1.3) hydrolyzes L-kynurenine to anthranilate plus alanine. Members of the seed alignment for this model are bacterial predicted metal-dependent hydrolases. All are supported as arylformamidase (3.5.1.9) by an operon structure in which kynureninase and/or tryptophan 2,3-dioxygenase genes are adjacent. The members from Bacillus cereus, Pseudomonas aeruginosa and Ralstonia metallidurans were characterized. An example from Pseudomonas fluorescens is given the gene symbol qbsH instead of kynB because of its role in quinolobactin biosynthesis, which begins with tryptophan. All members of this family should be arylformamidase (3.5.1.9). [Energy metabolism, Amino acids and amines].	1.08527e-113
NZ_CP054569.1\|WP_174716815.1\|4253518_4255183_-\|phenylacetic-acid-degradation-protein-PaaN	gnl\|CDD\|143445	cd07127, ALDH_PAD-PaaZ, Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like. Phenylacetic acid degradation (PAD) proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida) are putative aromatic ring cleavage enzymes of the aerobic PA catabolic pathway. PaaZ mutants were defective for growth with PA as a sole carbon source due to interruption of the putative ring opening system. This CD is limited to bacterial monofunctional enzymes.	0
NZ_CP054569.1\|WP_062683873.1\|4252126_4252597_-\|hydroxyphenylacetyl-CoA-thioesterase-PaaI	gnl\|CDD\|131339	TIGR02286, Acyl-coenzyme_A_thioesterase_PaaI, phenylacetic acid degradation protein PaaD. This member of the domain family TIGR00369 (which is, in turn, a member of the pfam03061 thioesterase superfamily) is nearly always found adjacent to other genes of the phenylacetic acid degradation pathway. Its function is currently unknown, but a role as a thioesterase is not inconsistent with the proposed overall pathway. Sequences scoring between trusted and noise include those from archaea and other species not known to catabolize phenylacetic acid and which are not adjacent to other genes potentially involved with such a pathway.	1.208e-54
NZ_CP054569.1\|WP_006388300.1\|4257618_4257903_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-B	gnl\|CDD\|237504	PRK13781, paaB, phenylacetate-CoA oxygenase subunit PaaB; Provisional.	1.43346e-65
NZ_CP054569.1\|WP_062683882.1\|4242130_4242775_-\|maleylacetoacetate-isomerase	gnl\|CDD\|273527	TIGR01262, Maleylacetoacetate_isomerase, maleylacetoacetate isomerase. Maleylacetoacetate isomerase is an enzyme of tyrosine and phenylalanine catabolism. It requires glutathione and belongs by homology to the zeta family of glutathione S-transferases. The enzyme (EC 5.2.1.2) is described as active also on maleylpyruvate, and the example from a Ralstonia sp. catabolic plasmid is described as a maleylpyruvate isomerase involved in gentisate catabolism. [Energy metabolism, Amino acids and amines].	1.59e-117
NZ_CP054569.1\|WP_062683869.1\|4256332_4256839_-\|phenylacetate-CoA-oxygenase-subunit-PaaJ	gnl\|CDD\|131214	TIGR02159, Putative_12-phenylacetyl-CoA_epoxidase_subunit_D, phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other].	4.14089e-62
NZ_CP054569.1\|WP_043549053.1\|4246977_4247244_+\|type-B-50S-ribosomal-protein-L31	gnl\|CDD\|234969	PRK01678, rpmE2, type B 50S ribosomal protein L31.	2.45638e-42

>NZ_CP054569.1|WP_174716814.1|4249095_4250496_+|MATE-family-efflux-transporter
MTPASLAPMTFGATLRGIAKQAWPVLVSQWAGISFGVLDTAMTGHSSATDLAAMALSASIYITIFVGLMGVVHALIPILAQHFGAGQNLEVGRSWGQGVWLALGLSVVGAILMLFPDVWLSFSGEVDPAVRARIASYLQALVLALPAALVFRTIYALGTSVSRPKLVMAINLTAIGFKAFFNWLLIYGNLGLPSMGATGAGLATAIVSWISLGLGLWVITHDRYYRRFKLRVGRPDWKTLKELLRLGIPMGGSYLVEVSAFTFMALLVAREGTFVTGGHQIMSNLAALCYMMPMALGVATAALTAQAIGAGNLEHAHRTGMAGLALGVAGALLTAAVLLAGRPLILAAYTDNPGVAAVATTLLAVLPLFHLFDSMQCINSYLLRAYKVAVVPLLLQMVALAGVGLVGGWWFGFGPGRGGLDGIRAVLVPGSPEGAGSMWLMAMAGLALSAALLHFWYRRIVRGAIR
>NZ_CP054569.1|WP_062683876.1|4247368_4249099_+|hypothetical-protein
MSPLSFSTPARLTSVATAKLPRLILLGLLLAYIVAGLFMRDPWKTDDAVGLATMITAIREGGITWLLPQVGLLAHAEEGPLITWVGAICIWLFGPFIGDITAGRLPNLLWFAITTTSVWYGTYLLGRRAEAQPLALPFGGEPEPRDYGRMLADAALLLLLATVGILQRTHETTVVPAIMAWQALAFYSLARSVDRPFTGCTTLGIALAASFLTRGWVGAIPIMVGALLAFYPRGQLWRCRRWLPWAALVTLVLILAWWIPASQGSEYWIRNWKIWNLSSFAAPNWHDMGRTLRDLPWYLWPTWPLALLAIWRWRSWIYAPHIWLPLALLVCSALVLFGLEEATDSEYVLLAVPCAVLAAFSLPTLRRGVVNTLDWFAVMCFSLTAATVWLGWVALHFHWPAQISRNIARQTTGYEPVISWVAFALALVFTLAWIALVVWRLRVKPQALWRGTVLSAGGLTVTWILLVLLWQPAVDYARSYRTVSGQLAQALEQNVRPGECVRGLSLGSGQRASFLIFNNLTFTFDAKCTLILQQTSNQSLRDNTAAYSEGADVLWQGGRRADRQEVFRLLRVGTNR
>NZ_CP054569.1|WP_043549053.1|4246977_4247244_+|type-B-50S-ribosomal-protein-L31
MKEGIHPEYREVVFADLQTGNKFITRSTVQTRETIDLDGKTYPLFKCDVTSESHPFYTGAQTRIVETGRVEKFRARFARTAGTVKSAS
>NZ_CP054569.1|WP_062683877.1|4245933_4246782_+|tryptophan-2,3-dioxygenase
MNQNERPEDIVREEKAQLDFARDMTYGDYLHLDALLGAQHPLSPEHNEMLFIIQHQTSELWMKLMLHELRGAIANVAADRLPPAFKMLARVSKIMEQLVHAWDVLATMTPPEYSALRPYLARSSGFQSYQYRQIEFLLGNKNAAMLKPHEHRADLLAQVQSAYEAPSLYDEALRLLARQGLNVPADHLQRDWTQPYQSSEGVEAAWLEVYRHPDRYWDLYQLGEKLTDLEDAFRLWRFRHVTTVERVIGFKRGTGGTSGVSYLRRMLEVVLFPEIWKLRTDL
>NZ_CP054569.1|WP_062683878.1|4245104_4245731_+|arylformamidase
MKRLWDISPPVSAASPVFPGDTPYRQQWKWSLAPGCPVNVSEITLSPHIGAHADAPLHYQNGAAAIGAVSLEPFLGPCRVIHAIDCGPLITVDHLAHAALNLPPRVLVRTAKHAAQDWWTDDFSAYAPQTIEWLAERGVMLIGLDTASIDPASSKTLDSHHTILRHDMRVLENLVLDAVPEGDYELIALPLALVQADASPVRAVLREL
>NZ_CP054569.1|WP_062683879.1|4244331_4245009_+|DNA-repair-protein-RadC
MKLSVRLPKHERPRERLMRHGAAALQDSELLAIALRTGIPGLHVVELCNRLLRQFGGLRGLLGAAPEELMAVPGLGAAKACMLAALLELARRAVEEELPRVNNLDHPLQVKQYCKLALGHRRVEHCIALYLDNQLRLIATGELARGTLSQASVYPREVVREALRHHAAALIVAHNHPSGVAEPSAADHSFTQHLKQALALVDIKLVDHLIVAGDAVVSMAERGSL
>NZ_CP054569.1|WP_082775872.1|4243804_4244281_-|peptidylprolyl-isomerase
MSTASNEVNVLVRPDSYLTLHYRITLASGPGKDSVFADTFDGRPGTLQLGSGQWAPGLEAALIGRAEGERFSVTVAPADAYGERNPELIQRVTRGMLAEHAGADATFEPGDLVEFTAPNGGRYSGVLKEINEESALFDFNHPLAGISLRVDVALLGVL
>NZ_CP054569.1|WP_174716813.1|4242827_4243805_-|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase
MSQVVTASDAEVLLAQPRGFCAGVDRAIDIVERALELHGAPIYVRHEIVHNRYVVEDLRAKGAVFIDELDDAPSGSIVVFSAHGVSKAVRAEAEARGLQVFDATCPLVTKVHIEVARMRAAGREIIMIGHKGHPEVEGTLGQAQGGMYLVETVEDVASLEVTDPENLAYVTQTTLSVDDAAAVSRALKARFPSIVEPKKSDICYATQNRQDAVKVMAPDCDLVLVVGSPNSSNSNRLREVAERKGVASYLIDGAQSIDPAWLVGRKRIGVTAGASAPEILVQQVIDRVKELGAVSVRTMPGLEENVAFPLPKGLSRKSAQTESLE
>NZ_CP054569.1|WP_062683882.1|4242130_4242775_-|maleylacetoacetate-isomerase
MQLYSYFRSSAAYRVRIALNLKGLAYEYLPVHLLKDGGQQLSADYRKMNPTGLVPTLVDGDAVIGQSLAIIEYLEETHPEVPLLPADAIGRARVRDLALGIACDTHPLNNLRVLKYLKHTLGVDEDAKNAWYRHWVRQGLEALEAQLAHSSATGRYCHGDTPTIADICLVPQVANAQRFGCDLSAMPNIVRIDAACRELPAFDAAAPGKQPDAE
>NZ_CP054569.1|WP_062683907.1|4240655_4242098_+|DegQ-family-serine-endoprotease
MKTSQMKPSRLVMALLAAGAIGGAGATAVIGGVSMAADAPAISAPAQAALPSTPSNFAQITRDYGPAVVNISVSGTRKVSAAEGDPFAQFFGQFPGGRGQMPSREVPMRGEGSGFIVSSDGIILTNAHVVQDAKEVTVKLTDRREFKAKVLGSDPQTDVAVIKIDAKNLPMVKVGDVNRLQVGEWVLAIGSPYGLENTATAGIVSAKGRSLPDDTSVPFIQTDVAVNPGNSGGPLFNDRGEVVGINSQIYSRTGGFQGLSFSIPIDVAYKIKDQILEHGKVQHARLGVTVQEVNQDLADSFKLDSPSGALVSSVEKGSAAAKAGLQPGDVVRQIDGKTIVSSGDLASTITLASPGEKIKLDIWRNGAHKELVATLGGIPADKTQASAGDQEVQRGQLGLALRPLSPQEQQAAGAEGLLIERSVGPAAKAGIEPGDVLLSLNGVPVHNVGQVKEALSKAGKTVALLVQRGEDKIFVPVQIG
>NZ_CP054569.1|WP_088445967.1|4250701_4252015_-|phenylacetate--CoA-ligase
MSNTMSKPGLDPIEHASEDELRALQLERLKWSLKHAYENVPHYKKAFDEVGVHPDDLKQLSDISKFPFTTKKELRENYPFGMFAVPRERISRIHASSGTTGKPTVVGYTKGDLDNWANLVARSIRAAGGKPGDTVHVAYGYGLFTGGLGAHYGAERLGCTVIPMSGGQTEKQVQLINDFRPDIIMVTPSYFCNILEEQRRQGIDPRQSSLRIGIFGAEPWTGQMRADIETEAGIDAVDIYGLSEVMGPGVASECVETKDGPVVWEDHFYAEIINPDTGEPVADGEPGELVFTSLTKEAMPIIRYRTRDLTRLLPPTARSMRRIGKITGRSDDMLIVRGVNMFPTQVEELVLKIAQLAPHYQLVLSRTGNMDELEILTELRAEFSGLSDADRSNLGKQLQHAVKTHIGVSARIQVSDAGHVERTLTGKARRVIDKRPK
>NZ_CP054569.1|WP_062683873.1|4252126_4252597_-|hydroxyphenylacetyl-CoA-thioesterase-PaaI
MNAHVPAVDVPADPQELAQAVGTVMYAGDAASQGLDMKVEEMAPGYARLTMRVRPDMLNGHKTCHGGFIFALADSAFAFSCNSRNVSTVASGCTIDYLAPGFEGDLLTAVAQERSLAGRTGVYDVTVTNQEGRNVALFRGRSYRIKGQIVGVPADA
>NZ_CP054569.1|WP_062683872.1|4252596_4253385_-|2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA-isomerase
MSYQDIQFDLSGGIARLTLNRPDKLNSFTANMHGEVADALTRVETEGARVLVLTGAGRGFCAGQDLSERTPAADGTPPDLGETVDKFYAPLVRRLNALPMPVVVGVNGVAAGAGANLAFAGDIVVAKASASFIQSFCRLGLIPDTGGTFALPRLVGRARAMGLAMLGDKLSAQQAQDWGLIWKCVPDEEFDTALEQLAQHFSKAPTKGLAFTKQAIQASLGNDLSTQLDLERDMMRELGRSADYAEGVAAFLGKREPQFKGQ
>NZ_CP054569.1|WP_174716815.1|4253518_4255183_-|phenylacetic-acid-degradation-protein-PaaN
MSEKFFERHQPLLEQAMAAAALRGYWSPYAESPSPRNYGETANDDGRAAFEALRGKPFPLNLHDVDGTVGGEQSPYGFDLGITYPHVPADKLVAASKRALESWRRAGPRAWVGVSLEILARLNKRSFEIAYAVQHTTGQGFMMAFQAGGPHAQDRGFEAVTYAWQEMSRIPGVAIWEKPQGKNDPIRMEKQFTVVPRGVALVIGCSTFPTWNGYPGLFASLATGNTVIVKPHPGAILPLAITVKVAREVLQEAGFDPDVVLLAAHEAGDDTAQKLALDPAVKIIDFTGSSANGNWLEENARQALVYTEKAGVNQVIIDSTADLKGVARNLAFSLALYSGQMCTAPQNIYVPRDGIQTPEGRVSFDDVATALGTALEKVGADAAKAVELTGAIQNEGVVARIEKARALGLPVVADSKALAHPQFENARVRTPLLLRTEAGNAAISQEWFGPIAFVVATDSTAHSIQLARDSVIEHGALSLSAYTTDDTVAEQVQDAAEVSGVSLSLNLTGAVFVNQTAAFSDFHGTGANPAANAALSDSAFVSNRFRVVQTRRHI
>NZ_CP054569.1|WP_062683870.1|4255230_4256319_-|phenylacetate-CoA-oxygenase/reductase-subunit-PaaK
MSQNQFHSLTVASVARNTRDAVVVTFDLPEALAQEFAFLPGQYLTLRTRLDGEELRRSYSICSAPHDKLLRVAIKKVDEGAFSSWANHELQPGQTLEVMAPAGNFTVDFSPENERHYVAFAVGSGITPVFSLVKTALSTEPRSKFTLFFGNRASSAVLFREEIEDLKNLYMERFSLVYIMSRETQDIELFNGRLDGDKVDQLMSAWMSPEDIDYAFVCGPQTMTESVVERLQARGIPKSNIKFELFGAPKGPRALRTGQDARQAPGKGQCEVTVVQDGHSRMFVIDKNKDSVLDSALAQGIELPYSCKGGVCSTCRCKVIEGEVDMDANFALEDYEVARGFILSCQSFPVSDRLVIDFDQET
>NZ_CP054569.1|WP_062683869.1|4256332_4256839_-|phenylacetate-CoA-oxygenase-subunit-PaaJ
MNALAPVSADQVYAWLQEVPDPEIPVLSVVDLGVVREVSWDGDVCVVVITPTYSGCPAMREITQDIEQTLAGHGIAEVRVETRLAPAWTTDWMSEKGREALKGYGIAAPAERAVDISGISRRAPGPAIACPRCGSSDTRLVSNFGSTSCKALYRCVSCREPFDYFKTH
>NZ_CP054569.1|WP_062683868.1|4256835_4257600_-|phenylacetate-CoA-oxygenase-subunit-PaaC
MDKTLFEYLLRLGDSSLILSQRLGAWTGHGPILEEDLALTNTALDLLGQARMWLTLAGEVENAGRDEDALAYLRDTHQFHNVLLAERPNGNYADTMARQFLFDVWHYFLLQRLEQSSDERVAAIAAKAIKEVTYHVRRSSDMVVRLGDGTAESHAKMQAAIDDAWRFTGELFADDAIDQDVAARGIGCELAALRQPWLAHVREVLEEATLTVPDEAAANHLAHRGGRQGRHTEELGYVLAEMQFLPRAYPGAKW
>NZ_CP054569.1|WP_006388300.1|4257618_4257903_-|1,2-phenylacetyl-CoA-epoxidase-subunit-B
MSKDWPLWEVFIRSQHGLAHKHVGSLHAPDAEMAINHARDVYTRRNEGLSIWVVRASDISASSPGDKDPLFEPANSKVYRHPTFFPMPEEIKHM
>NZ_CP054569.1|WP_062683867.1|4258099_4259089_-|1,2-phenylacetyl-CoA-epoxidase-subunit-A
MYAQLVETGVKQVKTADQLEGQEQAFQRRIDDGIRIEAKDWMPEAYRKTLVRQISQHAHSEIVGMLPEGNWITRAPSLKRKAILLAKVQDEAGHGLYLYSAAETLGVSRDDLIDDLHAGRAKYSSIFNYPTLSWADIGMIGWLVDGSAIINQIPLCRCSYGPYARAMVRVCKEESFHQRQGYDLLMQMCLHGTPEQKAMVQDSLNRWWWPALMMFGPSDADSPNSAQSMAWKIKLFSNDELRQKMVDQTVPQAEFLGLTVPDPELKWNAERGHYDFGEIDWSEFYAVLKGNGPCNRERLAARVKAHEDGAWVRDALVAYADKQAERKAA
>NZ_CP054569.1|WP_062683866.1|4259262_4260192_+|phenylacetic-acid-degradation-operon-negative-regulatory-protein-PaaX
MANPQSPLDRFLSRLIKNDPPRAKSLCVSLLGDALAPHGGAIWLGDLIELLAPLGINERLLRTSVFRLVAQNWLQSERHGRRSLYLISEQGLRHTAHASQRIYEGPPQEWNGEWTLVALPRTGNGLAERAELRRELVWEGFGMIAPGLFAHPHTEARAAHDILEKLGIPDRALVLSARDLAGAGGLPIASLASQCWNLDDVAEQYRQFTKNFGPLEKLLETPPAPSEAFIVRVMLLHSWRRIVLHDPQLPGPMLPDNWPGHAAREICGRIYWRVFDASEAHLNALAGRDNERYAPLAADIASRFGGKPA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054569_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054569_7

4775170-4775240

Orphan

Consensus_repeat	Method
CCGGCGTTCTTGCCCTGCGCCAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054569_7

>merge|NZ_CP054569|7|4775170-4775240|CRISPRCasFinder
CCCGCGCCGTTGCCCAGGGCCACGTTATTGCTGCCGGTCACGTTGACGCCCGCGCTCTTGCCGATCGCGTG

>NZ_CP054569|7|7|4775170-4775240|CRISPRCasFinder
CCCGCGCCGTTGCCCAGGGCCAC	GTTATTGCTGCCGGTCACGTTGACG
CCCGCGCTCTTGCCGATCGCGTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054569.1\|WP_088446147.1\|4769171_4770161_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP054569.1\|WP_157672696.1\|4765443_4765824_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054569.1\|WP_062679717.1\|4770270_4771446_-\|alpha-hydroxy-acid-oxidizing-protein	unknown	unknown	gnl\|CDD\|376451
NZ_CP054569.1\|WP_174716940.1\|4781087_4781933_+\|HAD-hydrolase-like-protein	unknown	unknown	gnl\|CDD\|319832
NZ_CP054569.1\|WP_125283599.1\|4779047_4779896_-\|phosphonate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213223
NZ_CP054569.1\|WP_062679868.1\|4781926_4782760_-\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
NZ_CP054569.1\|WP_088446144.1\|4764506_4765376_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP054569.1\|WP_088446142.1\|4758742_4759444_-\|SLATT-domain-containing-protein	unknown	unknown	gnl\|CDD\|375597
NZ_CP054569.1\|WP_174716941.1\|4782887_4783385_-\|preprotein-translocase-subunit-SecG	unknown	unknown	gnl\|CDD\|235881
NZ_CP054569.1\|WP_088448423.1\|4766470_4766827_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|376540
NZ_CP054569.1\|WP_062679726.1\|4783406_4784153_-\|triose-phosphate-isomerase	unknown	unknown	gnl\|CDD\|234589
NZ_CP054569.1\|WP_088446152.1\|4778046_4779051_-\|phosphonate-ABC-transporter,-permease-protein-PhnE	unknown	unknown	gnl\|CDD\|273441
NZ_CP054569.1\|WP_174716937.1\|4775493_4777749_-\|phospholipase-C,-phosphocholine-specific	unknown	unknown	gnl\|CDD\|274561
NZ_CP054569.1\|WP_157672697.1\|4767118_4768318_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|225110
NZ_CP054569.1\|WP_174716939.1\|4779919_4780858_-\|phosphate/phosphite/phosphonate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270232
NZ_CP054569.1\|WP_062679727.1\|4784273_4785251_-\|NAD(P)H-quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176180
NZ_CP054569.1\|WP_088147036.1\|4771442_4772840_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319958
NZ_CP054569.1\|WP_174716938.1\|4777786_4777957_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054569.1\|WP_174716935.1\|4759657_4764301_-\|autotransporter-domain-containing-protein	unknown	unknown	gnl\|CDD\|377133
NZ_CP054569.1\|WP_088147035.1\|4772921_4773863_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990

Protein	Function_ID	Function_description	E-value
NZ_CP054569.1\|WP_088446147.1\|4769171_4770161_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	1.4094e-146
NZ_CP054569.1\|WP_062679717.1\|4770270_4771446_-\|alpha-hydroxy-acid-oxidizing-protein	gnl\|CDD\|376451	pfam01070, FMN_dh, FMN-dependent dehydrogenase.	9.31747e-138
NZ_CP054569.1\|WP_174716940.1\|4781087_4781933_+\|HAD-hydrolase-like-protein	gnl\|CDD\|319832	cd07530, HAD_Pase_UmpH-like, UmpH/NagD family phosphatase, similar to Escherichia coli UmpH UMP phosphatase/NagD nucleotide phosphatase and Mycobacterium tuberculosis Rv1692 glycerol 3-phosphate phosphatase. Escherichia coli UmpH/NagD is a ribonucleoside tri-, di-, and monophosphatase with a preference for purines, it shows peak activity with UMP and functions in UMP-degradation. It is also an effective phosphatase with AMP, GMP and CMP. Mycobacterium tuberculosis phosphatase, Rv1692 is a glycerol 3-phosphate phosphatase. Rv1692 is the final enzyme involved in glycerophospholipid recycling/catabolism. This subfamily belongs to the UmpH/NagD phosphatase family, and to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	5.30433e-40
NZ_CP054569.1\|WP_125283599.1\|4779047_4779896_-\|phosphonate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213223	cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only prokaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	7.67651e-107
NZ_CP054569.1\|WP_062679868.1\|4781926_4782760_-\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	3.42876e-78
NZ_CP054569.1\|WP_088446144.1\|4764506_4765376_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	4.25194e-15
NZ_CP054569.1\|WP_088446142.1\|4758742_4759444_-\|SLATT-domain-containing-protein	gnl\|CDD\|375597	pfam18160, SLATT_5, SMODS and SLOG-associating 2TM effector domain family 5. The SLATT domain contains two transmembrane helices. SLATT domains are generally predicted to function as pore-forming effectors in a class of conflict systems which are reliant on the production of second messenger nucleotide or nucleotide derivatives. SLATT domains are predicted to initiate cell suicide responses upon their activation. This SLATT family contains an additional C-terminal alpha-helix, and strictly associates with a reverse transcriptase domain, part of a predicted retroelement with diversity-generating potential.	1.71707e-39
NZ_CP054569.1\|WP_174716941.1\|4782887_4783385_-\|preprotein-translocase-subunit-SecG	gnl\|CDD\|235881	PRK06870, secG, preprotein translocase subunit SecG; Reviewed.	4.7531e-25
NZ_CP054569.1\|WP_088448423.1\|4766470_4766827_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	1.47734e-12
NZ_CP054569.1\|WP_062679726.1\|4783406_4784153_-\|triose-phosphate-isomerase	gnl\|CDD\|234589	PRK00042, tpiA, triosephosphate isomerase; Provisional.	9.40581e-131
NZ_CP054569.1\|WP_088446152.1\|4778046_4779051_-\|phosphonate-ABC-transporter,-permease-protein-PhnE	gnl\|CDD\|273441	TIGR01097, PhnE, phosphonate ABC transporter, permease protein PhnE. Phosphonates are a class of compound analogous to organic phosphates, but in which the C-O-P linkage is replaced by a direct, stable C-P bond. Some bacteria can utilize phosphonates as a source of phosphorus. This family consists of permease proteins of known or predicted phosphonate ABC transporters. Often this protein is found as a duplicated pair, occasionally as a fused pair. Certain "second" copies score in between the trusted and noise cutoff and should be considered true hits (by context). [Transport and binding proteins, Anions].	1.32393e-75
NZ_CP054569.1\|WP_174716937.1\|4775493_4777749_-\|phospholipase-C,-phosphocholine-specific	gnl\|CDD\|274561	TIGR03396, PC_PLC, phospholipase C, phosphocholine-specific, Pseudomonas-type. Members of this protein family are bacterial, phosphatidylcholine-hydrolyzing phospholipase C enzymes, with a characteristic domain architecture as found in hemolytyic (PlcH) and nonhemolytic (PlcN) secreted enzymes of Pseudomonas aeruginosa. PlcH hydrolyzes phosphatidylcholine to diacylglycerol and phosphocholine, but unlike PlcN can also hydrolyze sphingomyelin to ceramide ((N-acylsphingosine)) and phosphocholine. Members of this family share the twin-arginine signal sequence for Sec-independent transport across the plasma membrane. PlcH is secreted as a heterodimer with a small chaperone, PlcR, encoded immediately downstream. [Cellular processes, Pathogenesis].	0
NZ_CP054569.1\|WP_157672697.1\|4767118_4768318_-\|EAL-domain-containing-protein	gnl\|CDD\|225110	COG2200, Rtn, c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms].	6.91242e-45
NZ_CP054569.1\|WP_174716939.1\|4779919_4780858_-\|phosphate/phosphite/phosphonate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270232	cd01071, PBP2_PhnD_like, Substrate binding domain of phosphonate uptake system-like, a member of the type 2 periplasmic-binding fold superfamily. This family includes alkylphosphonate binding domain PhnD. These domains are found in PhnD-like proteins that are predicted to function as initial receptors in hypophosphite, phosphonate, or phosphate ABC transport in archaea and eubacteria. PhnD is the periplasmic binding component of an ABC-type phosphonate uptake system (PhnCDE) that recognizes and binds phosphonate. PhnD belongs to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. The PBP2 have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.35522e-71
NZ_CP054569.1\|WP_062679727.1\|4784273_4785251_-\|NAD(P)H-quinone-oxidoreductase	gnl\|CDD\|176180	cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP054569.1\|WP_088147036.1\|4771442_4772840_-\|VOC-family-protein	gnl\|CDD\|319958	cd16348, VOC_YdcJ_like, uncharacterized metal-dependent enzyme similar to Shigella flexneri YdcJ. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	0
NZ_CP054569.1\|WP_174716935.1\|4759657_4764301_-\|autotransporter-domain-containing-protein	gnl\|CDD\|377133	pfam03797, Autotransporter, Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type V pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different protease is used and in some cases no cleavage occurs.	4.58956e-44
NZ_CP054569.1\|WP_088147035.1\|4772921_4773863_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	6.66378e-87

>NZ_CP054569.1|WP_088147035.1|4772921_4773863_-|LysR-family-transcriptional-regulator
MEKRLMPSMMALQCFEAVARHMSFTRAAEELHMTQSAISKQIAQLEALLRNPLFLRVRRRLQLTPAGALYQSEVRAILNQVDMSSRYILTYGSETQVLTIGTQPTFGARWLIPRLQRFLSAHPDIQVKVRSETRPFDLMQAKIDISFFFGHGTLPGAQCRELFEAEVVPVCAPGFLPGDRVDSLEALSGQALIQCASRPEAWHDYFSRQQFQSDRSYHGPRFDTFYMCVRAAEGGCGIALTPRLLAEEELQAGKLVIPWGYVQPSDGAYFVAYSEHSAEVPKIKQFVAWVEEEAARKRAGDAQRKRSMKKRTD
>NZ_CP054569.1|WP_088147036.1|4771442_4772840_-|VOC-family-protein
MSQNFVSPDQIRAWFSRAMSDMYKSEVPLYDTLLDLVAQVNARTLAEQPELAEQLARTGEIERLDIERHGAIRVGTAEELANMRRVFAVMGMQPVGYYDLSPAGVPVHSTAFRATHEAALQASPFRVFTSLLRLELIDDVALREKAARILAARQIFTARALELAARFEAEGGLDEACAREFVGEALHTFRWHGEATVSLEDYRELHGQHRLIADVVAFKGPHINHLTPRTLDIDEAQAEMPRRGVSAKAVIEGPPPRKCPILLRQTSFKALEEAVSFTGADGRAAVGSHTARFGEIEQRGVALTRKGRALYDRLLDLARTRIDGAPSEGNAAAYMQNLQACFAEFPDDYATLHDQGLAYFRYYLTGKEDAPADADPGTLIAQGYIRFEPLVYEDFLPVSAAGIFQSNLGDKAQAEYAQNASQTAFEQALGAPVLDELALYQDTQDRSLAACLQALGAQAGASVAA
>NZ_CP054569.1|WP_062679717.1|4770270_4771446_-|alpha-hydroxy-acid-oxidizing-protein
MSRLGRCLSVRDFEREARRIMPRCVEGYVCGGTEDGASLDESVRALRDIGFRPRGLRVVDQRSSQVSLFGQDYAMPMGFAPTGFSAIVMHECDLALARAAQDARIPFIISGASSVPLERLQQATGKRCWYQAYLPGNTDRIAKLLARLRQAEIPVLVVTIDTCVGANRENLQRLAFTVPFKMSPSVVLDGMLHPRWTLNVFLRTLFGSGVPRFSNLYEEIGPPITQDPPNGFRGERDKLSWEHIRWIRDNWPGKLVLKGVMHADDARQAWAVGADGVIVSNHGGRQLDGCISPLQALPDVAAAVPPGFPVMVDGGFRRGSDVLKAVALGARLVFTGRPQLFGAAVGGDAGIRKVAEIFRSEISTNMALLGCRTLADVTPDLIAPIRPAGSA
>NZ_CP054569.1|WP_088446147.1|4769171_4770161_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKKIYTKLAGVAAVLACVASGPVQAQAGAYPTKPVRLVVGYAPGGTTDISARMIADVLGKEFGQTFVVENKPGANSNIGAESVARSPADGYTLFVGSISTAINQSLYSKMSYDALKDLDAVALLNVVPNILAVNASVPVKTVQEYIDYAKKNPGKLTCASPGNGSSAHLGCELFKMKTGIDILHVPYRGSGPAVADLLGGQVDSIFDNLPPLLPHVRAGKLTGLAVTTGSRVPFAPEIPTIAESGVEGFDVAAWFGLFAPAGTPPEIVQKVNAAINKALTSDAALAASYQTNGFLMPPPPNTPQAFKAFMESETRKWGEVVKATNLQIN
>NZ_CP054569.1|WP_157672697.1|4767118_4768318_-|EAL-domain-containing-protein
MIPSIETSWMDDQGDACPYLSVQVVNMRDIELAYGLDAGIVVRRELWTRLAAVGGPEAPVWQGCDVLTVSLRYAAQARKVSVDGILNYELSQRTALSMPIEIGPRSWVCPLIATELTSAGCLGGCGALRREGSKEGTNGEPLWARRFRDDMVQVSCLLQDLRTRRLPLAFQPVVLVQDLSSVLYDELLLRPPGGGPGQITVALERLGAAWLLDRSIVWTAIEVLESHPARHLACNVSAFSFHPDPWWSEVVDYLQSRPSIAARLVIEITETGVLQDMQKALGLISRLKKVGVRVALDDVGKGNCTLAFLLEASPGVIKIDRSMLQRAARSKEGRRQFQALVRLCASCSPCVVVEGIENEAELNLARAGDEVFAVQGYAIATPDSAPEWLNCSSQFVSLR
>NZ_CP054569.1|WP_088448423.1|4766470_4766827_-|helix-turn-helix-transcriptional-regulator
MRLRLGWTQKDLALASGLTQSAIGNYESGQRVEPSGQALVGLAEALKVSPGWLSHGDEGAGADGAGAGKASRSSSESSSVRWPFREVSLEEYLSLSASEKKVLSSMVTTYIQACQHKR
>NZ_CP054569.1|WP_157672696.1|4765443_4765824_-|hypothetical-protein
MPDIEINGDKVTVGNMGIGDEFSEPRGGRFDRATYEAASRRKLDAVPLLQTLETTRNLACGVASLLVLLKAHGVPEVGHSTDVLINHIQVDELLSLCIESMGLLNDRIEKLADHMTHKHEPEYGGD
>NZ_CP054569.1|WP_088446144.1|4764506_4765376_+|response-regulator-transcription-factor
MKMISEDQSAVGTSAANNGGLQGSWLPSSPRPGDDALGRGLRQPARETPFPLLGGRGSNVSYFAVGDVDSQRHIEGLKLLGFDVKVCSDKLLAGLETIEPDGIPIVVLHASPATALLGVARLRSLLPSAWLIVTSEFPDKVSRVAAMLAGADTCADASLDSLELAATVLAATRRREPRPAGRKVPPHTGENRQSKAWSLTNDGWTLNSPNGKAIELNQIEREIMRDLIEKSNEPLMRSSHAASGANDRVSRNLDVAVSRLRKKAAEHSVHLPIKSIRGVGYVFVAEEAL
>NZ_CP054569.1|WP_174716935.1|4759657_4764301_-|autotransporter-domain-containing-protein
MSRIYWSKSAPTLVLSTLTAALLVAFPHAHAEPSSRDVTASGRDRVTLKRGNDYTSLTATRGGLIRGSRVDVEGRSGELVRAIDGGKIELTDTDISADRASRHSHHLEQGPAVSASSDDGRHSRHRETEVSLKGGSVTTRASNSPALQASGRGATVSADGTRLKTLGSGSDVVKLRSGGTAELRNVSIESQGRGADGVAVQGNRSNATLYRTRIETRGAGADGVEVTEGGQARVDRSAIKTSGTDAAGLRVDGRHSDAVLTRSEIRTRGTASSAVEVSRGGDVEIEDSELSTTGAGGAGIRAEGSGSDVSVRKTQVRTSGSGAAGMALSDRAQANVSRSVVSTSGRGSDGVAVGSGAELRMSRSQIDTSGRDADGLSVRGNGSKAVVDDLKISTKGKDSKALSVRDGGLAVVADSELSASGENGVAAAVSGEGARAVIRDSVLSAEGRDGHALEIKSSGFAYLADSVAVGTLSGATVTGEGSMFVAKNSQIEAKAEDDPHGRGRYRPASSTGLNVSKGGKAILLGGDVQAHSDDARGLGVSGKDSSVWAVGTEIVATGRNSAGAAVSNGASAVLLGGTKVSGEAAGLAVASGGRVWMSGGQLNATGEDGAALKVNDHGSLAAIQGTEIAADGMLGNGVAVEDGAKAFLLGATVSAGANGVAVDGRGSSLLAVDTTVQAGTETQIYSRRSDPVSAVGIKVSNGAGAAVQGGSVTAIGDGGTAVLIENGRALLKDARLEATGNDANALVVRSSRDDDDRRGRYGRRDDGHDRSKAEAWVSGATVSTSGDRSDAVLVQGRNSTLSIQGATITTTGAQAAGLSVQDGGRVSLADSSVGASGAGAAAIRLGSVIGEGAGAVSSLDISGSTLSATGENAAGIALDNSANLSITNSGVRSSGASLLSRLDAAGQRQTISIDSGATLVQNNGTLLQVERSEQGRDGRVDLDLKDGSITKGNIVDTQQGLTGDGGTYVRLRAQASYDGLMQGVREVVTEGGNQTLHFAGGSTLGSLLIDNHAVSSGGTVDNRISASGDVVVDNATLGGNWRIGGTLTGRNGAIIRPGNSVGAITAQAIDWRAGSTYQAEINAQGQSDLVEVTGNGGADVSKASLVVGPENGVGRVLLNHDYTVLTAAAGVQGKFAAASWTGQAYPLLALSTVYGPASVAVRMAPDTAAIERYGFTRNQRAAALGTATAAGSNASVDEAFFSANPKGAFDQLSGEVHASVRSILFNDMLSTSAAMQGQMRANLGAQLMPGQPTASTDAASPDAMPVSGAYPLWASFNAAGMTTNDDGNAASTRYSTTRLLVGGDAAIGGGWRLGAAAGVSSGDFKLSDRNSDGSVNNYTMMLYGGNAWKAGPGSLKLLVGGGYTRHNIDTSRTVDLAGSQDLDADYNGSTWQLFGDLGYAIPLGDNYSVEPFVNVAWFKQRLRGFDESGGDAALKAGSSREDLGTYTLGLRTALVYPGKTNPFTLRGHVGWRHATGDRDPSRSMSLVQGGGSAFSVYGSPIAKNAAVVGLSGEVGLDKNFALGLSYDGQFGSGNTDNAGSLFMKVRF
>NZ_CP054569.1|WP_088446142.1|4758742_4759444_-|SLATT-domain-containing-protein
MKDTADITSMQEDVLTPINELIRPRTEAETLLLRMRISQKCRYNASVRLRRSYRFRLFTSMMFAVGLMIIPLLQNSPITLGFSPAVMAMVQVLLAVGILVFTVIAGKAGFELRADKLNQEGDSLKDLSRRLTRYMAAGSEVRLEEFHQEYAALTSGKEAHSRSDYLQAQLEMKEYFPMWPGKRLALRVGLGISVLSNYVIPLLLILMEMAFVSDMLTLTTLYPNVLHLPGLAR
>NZ_CP054569.1|WP_174716937.1|4775493_4777749_-|phospholipase-C,-phosphocholine-specific
MTKTSLPHSAGASPALPGRRQFFRVSAQAAGALSAMALLPASIQRALAIPAAVDSGTIQDIKHVVILMQENRSFDHYFGTMRGVRGFGDRFPIPLANGKPVFFQPNPAGGQDILPFRRDSRISKALIGSGTPHNFPDQQAAWNQGKMDRWIQFKNQATMGFFMREDIPFQFALADAFTVCDGYHCSILTGTDPNRIVFWSGANANPELRKLGINCTDTDSEPVNSRCWPSPSNWVAGRVQEVDGSGQIDPVTGTYNYKYKNNAFKWDTLPDLLERAGVSWHIYQNMNNNWTGAMHGCLAFKSFREAQPGSPIYEHGLTGGPEKADGAVNFLAQLKQDVVNGTLPQVSWVLPTQALAEHPGSSEGVAGAADFIADVLDALTSNPEVWSKTALFVTFDENDGFFDHVAMPAAPSYDANGVLMGKSTVPLDGEYFDASVGSYLKAEDTTTGTVRPWGMSSRVPMYVVSPWSKGGWVNSQVFDHTSVGRFLEQRFGIKVDAISPWSRAVSGDLTTCFDFVTPNDPRIPKLPDTSNYPAINAAQNLLPTAPVTQAPAIPQPLFQETGTRFSRALPYELHTSARLGTDGAVELLFSNTGDAGAVFHVYDKRNLDLIPRRYTVEAGKTLSDTWTGGDYDLWVYSTNGFVRTFAGNTQRGAALEVQVCYEPAGGALYVKVSNHGKARLQAALQANAYRSDGPWTLTVEPGAVAEHHWSIAESGNWYDFTVTAEGFERRFAGRMENGRHGVSDPAMALHL
>NZ_CP054569.1|WP_174716938.1|4777786_4777957_-|hypothetical-protein
MTPYFAPGRALVAAIALSLTLAACGGDDDSDEGRAPPPEIEKPVTPPPAPQLRCAP
>NZ_CP054569.1|WP_088446152.1|4778046_4779051_-|phosphonate-ABC-transporter,-permease-protein-PhnE
MSTQAENAAWRLDPPYGARALLVVIAALMLFLYTGQRVEMGRMAALTFDGALAAVGLKEQSQVTAGLGALADSLFPLQVSYRTETSRIEGFDPDRLPWLARLETVQVTESRLNPHTLKMEDEVSTHTYLVEPLGYLWRVAVKMVETFEIAIWATLLAVLGSAPLAYCSARNYAPNRLLYVAARAAVSLFRAMPELICALFLVLAYGFGPIAGVLALAIHSMGFLGKFYAEDIETADTKPQEALAAIGAGKLRVLAYAVLPQVLPKFTGYTLYILDRNVRMATVVGLVGAGGIGQELKGRYDMYQYAHVGTILVVIFITVFLLDQVAARLRRRLI
>NZ_CP054569.1|WP_125283599.1|4779047_4779896_-|phosphonate-ABC-transporter-ATP-binding-protein
MLRYESVGMRYADGTMALDSVSLRVPRGQFCVILGASGAGKSTLLRMANGLTTPTQGQVWVDDTEVRPSTLAAVRPRIGMVHQHFNLVSRATVATNVLSGALPGLPAWRAYLLRFPAELRERACRLVREVGLQPEHLRRRVSELSGGQQQRVGIARAFMLAPALLLADEPVASLDPRISRDILGLLRDQARERGATVLCSLHQVDLAREFADRIVALRQGAMVFDGPAGAFDETTARALYQAGSSPAPREAAAATPEAGSEPPGQRLAARVRPALLSVGGAR
>NZ_CP054569.1|WP_174716939.1|4779919_4780858_-|phosphate/phosphite/phosphonate-ABC-transporter-substrate-binding-protein
MKTPRFSASALALISLLAAAPLAQAQSLADGSAQRPLRVLLIPADGGTESGTKADYAPIFNAITRSTGLHFQLTVGQSYGAVVEGMCNQLAEVAFLGPVSYVQAHDRLCAQLLAVGVQKGESAYYAAMFAKADSPIGSLADLKGKRAAFGDVNSASSFTFQVASMLKDGMNPAKDLAALQLTGSHASSLAALVQGQVDAAALSFDSFDKAVRQGAVDPKSVKVIFKSEPIPYPPLAMNTRLPEPLKATLKQAFATVHKAPGVTPDMVRGYGGAKLDRFDTEFSEEQFAGPASKMSLLTDEIKGEILDKAAQR
>NZ_CP054569.1|WP_174716940.1|4781087_4781933_+|HAD-hydrolase-like-protein
MTRIARASLLSPSASPTAEPPWTQRSHGLILDLDGTLIRGHEVIPGAGELLTRWAGRYVIVSNNSTDTAAGLAPRLRALGLPVQADSLVLAGEQAVRHIARGHPRARLMLCGSETLRACAAGLDLALVTRDADIVLLARDRDFSYATLQALARELAAGALLMVSNGDLTHPGPQGSVVPETGALLRAVLACAPGIRPLILGKPAAMLFQEGLRRLGLPAGDVTVIGDNARTDALGAARLGMAYLLVGDAPHADAPDMARLLAAARPRRHALPEGIAADADQ
>NZ_CP054569.1|WP_062679868.1|4781926_4782760_-|MurR/RpiR-family-transcriptional-regulator
MLARIQSLLPSMGAASQRIGEFVIRHPAEVVHMSVSEVAERTQSSEGSVVGFCKLLGATGFQQLKIALAQQIVQPVQYIHEDLAAQDTPEQVVSKIFHSNIQTLQETESVLDVAALSAAVELIRGARRVEIYGIGSSAIIAHDAHYRMLRIGLNATAVTDSHVQAISASLTGPDVAVLTISHSGSTHETVLATRLAKEAGARTVCITNFGKSPIQEYADVVLHTMSRETRFRTEAMTSRLAQLAIIDTLIACLALSDYDKAVSTLRSTFDVLSTKRY
>NZ_CP054569.1|WP_174716941.1|4782887_4783385_-|preprotein-translocase-subunit-SecG
MPLMLKLLLAVQVISALAIIVLVLLQQGKGADMGSAFGSGSAGSLFGATGAANFLSRATKWAAVVFFASTAGLAYVSHKGSTGTAVDSGVMQSFPADRSVPQVPGSVPATPSGASSVPGAGSVPAAPAKPDASVPAAPAAPAPAAPAPAAPAPAAGDKPAETPAK
>NZ_CP054569.1|WP_062679726.1|4783406_4784153_-|triose-phosphate-isomerase
MTSVENRARLVLGNWKMHGNLAENAALLTELRAADAASHCEIGVCVPFPYLAQAASALTGSSVSWGAQDVSAHDKGAYTGEVSGAMLKEFGCRWALAGHSERRVLHGETDEVVAAKAQAALAAGLTPVVCVGESLADRDAGNTLAVIERQLKPVLALGADAVSRMVLAYEPVWAIGTGRSASPEQAQEVHGAIRAALRALGAGQVQVLYGGSVKAANAASLFAMTDIDGALVGGASLVAEEFLRIAAI
>NZ_CP054569.1|WP_062679727.1|4784273_4785251_-|NAD(P)H-quinone-oxidoreductase
MHAVEISRPGGPEVLVPVERPTPEAGAGEVLIKVSAAGVNRPDVFQRKGNYAPPRGASDLPGLEVAGEIVGGDLAGSGFALGDKVCALVAGGGYAEYCVAPAAQCLPIPKGLSDIEAAGLPETYFTVWSNVFDRGRLSEGEALLVHGGASGIGTTAIQLARAMGHKVYATVGSDDRARAVEALGAERGINYKTQDFVKEVLDATGGRGVDVILDMVAGDYIARDMQCLADDGRIVIIAQLGGSHANVDTAQVMRRRLTITGSTLRPRPVAFKGAIARALREQAWPLLENGAIKPIVHATFPLAEASRAHAMMESGENIGKIILTM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054569_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054569_6

4774783-4774854

Orphan

Consensus_repeat	Method
CCGGCGTTCTTGCCCTGCGCCAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054569_6

>merge|NZ_CP054569|6|4774783-4774854|CRISPRCasFinder
CCGGCGTTCTTGCCCTGCGCCAGATTGGCGTCGCCTTCGACCTGCTGGCCGGCGTTCTGGCCCTGCGCCAGG

>NZ_CP054569|6|6|4774783-4774854|CRISPRCasFinder
CCGGCGTTCTTGCCCTGCGCCAG	ATTGGCGTCGCCTTCGACCTGCTGG
CCGGCGTTCTGGCCCTGCGCCAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054569.1\|WP_088446147.1\|4769171_4770161_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP054569.1\|WP_157672696.1\|4765443_4765824_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054569.1\|WP_062679717.1\|4770270_4771446_-\|alpha-hydroxy-acid-oxidizing-protein	unknown	unknown	gnl\|CDD\|376451
NZ_CP054569.1\|WP_174716940.1\|4781087_4781933_+\|HAD-hydrolase-like-protein	unknown	unknown	gnl\|CDD\|319832
NZ_CP054569.1\|WP_125283599.1\|4779047_4779896_-\|phosphonate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213223
NZ_CP054569.1\|WP_062679868.1\|4781926_4782760_-\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
NZ_CP054569.1\|WP_088446144.1\|4764506_4765376_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP054569.1\|WP_088446142.1\|4758742_4759444_-\|SLATT-domain-containing-protein	unknown	unknown	gnl\|CDD\|375597
NZ_CP054569.1\|WP_174716941.1\|4782887_4783385_-\|preprotein-translocase-subunit-SecG	unknown	unknown	gnl\|CDD\|235881
NZ_CP054569.1\|WP_088448423.1\|4766470_4766827_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|376540
NZ_CP054569.1\|WP_062679726.1\|4783406_4784153_-\|triose-phosphate-isomerase	unknown	unknown	gnl\|CDD\|234589
NZ_CP054569.1\|WP_088446152.1\|4778046_4779051_-\|phosphonate-ABC-transporter,-permease-protein-PhnE	unknown	unknown	gnl\|CDD\|273441
NZ_CP054569.1\|WP_174716937.1\|4775493_4777749_-\|phospholipase-C,-phosphocholine-specific	unknown	unknown	gnl\|CDD\|274561
NZ_CP054569.1\|WP_157672697.1\|4767118_4768318_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|225110
NZ_CP054569.1\|WP_174716939.1\|4779919_4780858_-\|phosphate/phosphite/phosphonate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270232
NZ_CP054569.1\|WP_062679727.1\|4784273_4785251_-\|NAD(P)H-quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176180
NZ_CP054569.1\|WP_088147036.1\|4771442_4772840_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319958
NZ_CP054569.1\|WP_174716938.1\|4777786_4777957_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054569.1\|WP_174716935.1\|4759657_4764301_-\|autotransporter-domain-containing-protein	unknown	unknown	gnl\|CDD\|377133
NZ_CP054569.1\|WP_088147035.1\|4772921_4773863_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990

Protein	Function_ID	Function_description	E-value
NZ_CP054569.1\|WP_088446147.1\|4769171_4770161_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	1.4094e-146
NZ_CP054569.1\|WP_062679717.1\|4770270_4771446_-\|alpha-hydroxy-acid-oxidizing-protein	gnl\|CDD\|376451	pfam01070, FMN_dh, FMN-dependent dehydrogenase.	9.31747e-138
NZ_CP054569.1\|WP_174716940.1\|4781087_4781933_+\|HAD-hydrolase-like-protein	gnl\|CDD\|319832	cd07530, HAD_Pase_UmpH-like, UmpH/NagD family phosphatase, similar to Escherichia coli UmpH UMP phosphatase/NagD nucleotide phosphatase and Mycobacterium tuberculosis Rv1692 glycerol 3-phosphate phosphatase. Escherichia coli UmpH/NagD is a ribonucleoside tri-, di-, and monophosphatase with a preference for purines, it shows peak activity with UMP and functions in UMP-degradation. It is also an effective phosphatase with AMP, GMP and CMP. Mycobacterium tuberculosis phosphatase, Rv1692 is a glycerol 3-phosphate phosphatase. Rv1692 is the final enzyme involved in glycerophospholipid recycling/catabolism. This subfamily belongs to the UmpH/NagD phosphatase family, and to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	5.30433e-40
NZ_CP054569.1\|WP_125283599.1\|4779047_4779896_-\|phosphonate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213223	cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only prokaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	7.67651e-107
NZ_CP054569.1\|WP_062679868.1\|4781926_4782760_-\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	3.42876e-78
NZ_CP054569.1\|WP_088446144.1\|4764506_4765376_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	4.25194e-15
NZ_CP054569.1\|WP_088446142.1\|4758742_4759444_-\|SLATT-domain-containing-protein	gnl\|CDD\|375597	pfam18160, SLATT_5, SMODS and SLOG-associating 2TM effector domain family 5. The SLATT domain contains two transmembrane helices. SLATT domains are generally predicted to function as pore-forming effectors in a class of conflict systems which are reliant on the production of second messenger nucleotide or nucleotide derivatives. SLATT domains are predicted to initiate cell suicide responses upon their activation. This SLATT family contains an additional C-terminal alpha-helix, and strictly associates with a reverse transcriptase domain, part of a predicted retroelement with diversity-generating potential.	1.71707e-39
NZ_CP054569.1\|WP_174716941.1\|4782887_4783385_-\|preprotein-translocase-subunit-SecG	gnl\|CDD\|235881	PRK06870, secG, preprotein translocase subunit SecG; Reviewed.	4.7531e-25
NZ_CP054569.1\|WP_088448423.1\|4766470_4766827_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	1.47734e-12
NZ_CP054569.1\|WP_062679726.1\|4783406_4784153_-\|triose-phosphate-isomerase	gnl\|CDD\|234589	PRK00042, tpiA, triosephosphate isomerase; Provisional.	9.40581e-131
NZ_CP054569.1\|WP_088446152.1\|4778046_4779051_-\|phosphonate-ABC-transporter,-permease-protein-PhnE	gnl\|CDD\|273441	TIGR01097, PhnE, phosphonate ABC transporter, permease protein PhnE. Phosphonates are a class of compound analogous to organic phosphates, but in which the C-O-P linkage is replaced by a direct, stable C-P bond. Some bacteria can utilize phosphonates as a source of phosphorus. This family consists of permease proteins of known or predicted phosphonate ABC transporters. Often this protein is found as a duplicated pair, occasionally as a fused pair. Certain "second" copies score in between the trusted and noise cutoff and should be considered true hits (by context). [Transport and binding proteins, Anions].	1.32393e-75
NZ_CP054569.1\|WP_174716937.1\|4775493_4777749_-\|phospholipase-C,-phosphocholine-specific	gnl\|CDD\|274561	TIGR03396, PC_PLC, phospholipase C, phosphocholine-specific, Pseudomonas-type. Members of this protein family are bacterial, phosphatidylcholine-hydrolyzing phospholipase C enzymes, with a characteristic domain architecture as found in hemolytyic (PlcH) and nonhemolytic (PlcN) secreted enzymes of Pseudomonas aeruginosa. PlcH hydrolyzes phosphatidylcholine to diacylglycerol and phosphocholine, but unlike PlcN can also hydrolyze sphingomyelin to ceramide ((N-acylsphingosine)) and phosphocholine. Members of this family share the twin-arginine signal sequence for Sec-independent transport across the plasma membrane. PlcH is secreted as a heterodimer with a small chaperone, PlcR, encoded immediately downstream. [Cellular processes, Pathogenesis].	0
NZ_CP054569.1\|WP_157672697.1\|4767118_4768318_-\|EAL-domain-containing-protein	gnl\|CDD\|225110	COG2200, Rtn, c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms].	6.91242e-45
NZ_CP054569.1\|WP_174716939.1\|4779919_4780858_-\|phosphate/phosphite/phosphonate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270232	cd01071, PBP2_PhnD_like, Substrate binding domain of phosphonate uptake system-like, a member of the type 2 periplasmic-binding fold superfamily. This family includes alkylphosphonate binding domain PhnD. These domains are found in PhnD-like proteins that are predicted to function as initial receptors in hypophosphite, phosphonate, or phosphate ABC transport in archaea and eubacteria. PhnD is the periplasmic binding component of an ABC-type phosphonate uptake system (PhnCDE) that recognizes and binds phosphonate. PhnD belongs to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. The PBP2 have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.35522e-71
NZ_CP054569.1\|WP_062679727.1\|4784273_4785251_-\|NAD(P)H-quinone-oxidoreductase	gnl\|CDD\|176180	cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP054569.1\|WP_088147036.1\|4771442_4772840_-\|VOC-family-protein	gnl\|CDD\|319958	cd16348, VOC_YdcJ_like, uncharacterized metal-dependent enzyme similar to Shigella flexneri YdcJ. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	0
NZ_CP054569.1\|WP_174716935.1\|4759657_4764301_-\|autotransporter-domain-containing-protein	gnl\|CDD\|377133	pfam03797, Autotransporter, Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type V pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different protease is used and in some cases no cleavage occurs.	4.58956e-44
NZ_CP054569.1\|WP_088147035.1\|4772921_4773863_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	6.66378e-87

>NZ_CP054569.1|WP_088147035.1|4772921_4773863_-|LysR-family-transcriptional-regulator
MEKRLMPSMMALQCFEAVARHMSFTRAAEELHMTQSAISKQIAQLEALLRNPLFLRVRRRLQLTPAGALYQSEVRAILNQVDMSSRYILTYGSETQVLTIGTQPTFGARWLIPRLQRFLSAHPDIQVKVRSETRPFDLMQAKIDISFFFGHGTLPGAQCRELFEAEVVPVCAPGFLPGDRVDSLEALSGQALIQCASRPEAWHDYFSRQQFQSDRSYHGPRFDTFYMCVRAAEGGCGIALTPRLLAEEELQAGKLVIPWGYVQPSDGAYFVAYSEHSAEVPKIKQFVAWVEEEAARKRAGDAQRKRSMKKRTD
>NZ_CP054569.1|WP_088147036.1|4771442_4772840_-|VOC-family-protein
MSQNFVSPDQIRAWFSRAMSDMYKSEVPLYDTLLDLVAQVNARTLAEQPELAEQLARTGEIERLDIERHGAIRVGTAEELANMRRVFAVMGMQPVGYYDLSPAGVPVHSTAFRATHEAALQASPFRVFTSLLRLELIDDVALREKAARILAARQIFTARALELAARFEAEGGLDEACAREFVGEALHTFRWHGEATVSLEDYRELHGQHRLIADVVAFKGPHINHLTPRTLDIDEAQAEMPRRGVSAKAVIEGPPPRKCPILLRQTSFKALEEAVSFTGADGRAAVGSHTARFGEIEQRGVALTRKGRALYDRLLDLARTRIDGAPSEGNAAAYMQNLQACFAEFPDDYATLHDQGLAYFRYYLTGKEDAPADADPGTLIAQGYIRFEPLVYEDFLPVSAAGIFQSNLGDKAQAEYAQNASQTAFEQALGAPVLDELALYQDTQDRSLAACLQALGAQAGASVAA
>NZ_CP054569.1|WP_062679717.1|4770270_4771446_-|alpha-hydroxy-acid-oxidizing-protein
MSRLGRCLSVRDFEREARRIMPRCVEGYVCGGTEDGASLDESVRALRDIGFRPRGLRVVDQRSSQVSLFGQDYAMPMGFAPTGFSAIVMHECDLALARAAQDARIPFIISGASSVPLERLQQATGKRCWYQAYLPGNTDRIAKLLARLRQAEIPVLVVTIDTCVGANRENLQRLAFTVPFKMSPSVVLDGMLHPRWTLNVFLRTLFGSGVPRFSNLYEEIGPPITQDPPNGFRGERDKLSWEHIRWIRDNWPGKLVLKGVMHADDARQAWAVGADGVIVSNHGGRQLDGCISPLQALPDVAAAVPPGFPVMVDGGFRRGSDVLKAVALGARLVFTGRPQLFGAAVGGDAGIRKVAEIFRSEISTNMALLGCRTLADVTPDLIAPIRPAGSA
>NZ_CP054569.1|WP_088446147.1|4769171_4770161_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKKIYTKLAGVAAVLACVASGPVQAQAGAYPTKPVRLVVGYAPGGTTDISARMIADVLGKEFGQTFVVENKPGANSNIGAESVARSPADGYTLFVGSISTAINQSLYSKMSYDALKDLDAVALLNVVPNILAVNASVPVKTVQEYIDYAKKNPGKLTCASPGNGSSAHLGCELFKMKTGIDILHVPYRGSGPAVADLLGGQVDSIFDNLPPLLPHVRAGKLTGLAVTTGSRVPFAPEIPTIAESGVEGFDVAAWFGLFAPAGTPPEIVQKVNAAINKALTSDAALAASYQTNGFLMPPPPNTPQAFKAFMESETRKWGEVVKATNLQIN
>NZ_CP054569.1|WP_157672697.1|4767118_4768318_-|EAL-domain-containing-protein
MIPSIETSWMDDQGDACPYLSVQVVNMRDIELAYGLDAGIVVRRELWTRLAAVGGPEAPVWQGCDVLTVSLRYAAQARKVSVDGILNYELSQRTALSMPIEIGPRSWVCPLIATELTSAGCLGGCGALRREGSKEGTNGEPLWARRFRDDMVQVSCLLQDLRTRRLPLAFQPVVLVQDLSSVLYDELLLRPPGGGPGQITVALERLGAAWLLDRSIVWTAIEVLESHPARHLACNVSAFSFHPDPWWSEVVDYLQSRPSIAARLVIEITETGVLQDMQKALGLISRLKKVGVRVALDDVGKGNCTLAFLLEASPGVIKIDRSMLQRAARSKEGRRQFQALVRLCASCSPCVVVEGIENEAELNLARAGDEVFAVQGYAIATPDSAPEWLNCSSQFVSLR
>NZ_CP054569.1|WP_088448423.1|4766470_4766827_-|helix-turn-helix-transcriptional-regulator
MRLRLGWTQKDLALASGLTQSAIGNYESGQRVEPSGQALVGLAEALKVSPGWLSHGDEGAGADGAGAGKASRSSSESSSVRWPFREVSLEEYLSLSASEKKVLSSMVTTYIQACQHKR
>NZ_CP054569.1|WP_157672696.1|4765443_4765824_-|hypothetical-protein
MPDIEINGDKVTVGNMGIGDEFSEPRGGRFDRATYEAASRRKLDAVPLLQTLETTRNLACGVASLLVLLKAHGVPEVGHSTDVLINHIQVDELLSLCIESMGLLNDRIEKLADHMTHKHEPEYGGD
>NZ_CP054569.1|WP_088446144.1|4764506_4765376_+|response-regulator-transcription-factor
MKMISEDQSAVGTSAANNGGLQGSWLPSSPRPGDDALGRGLRQPARETPFPLLGGRGSNVSYFAVGDVDSQRHIEGLKLLGFDVKVCSDKLLAGLETIEPDGIPIVVLHASPATALLGVARLRSLLPSAWLIVTSEFPDKVSRVAAMLAGADTCADASLDSLELAATVLAATRRREPRPAGRKVPPHTGENRQSKAWSLTNDGWTLNSPNGKAIELNQIEREIMRDLIEKSNEPLMRSSHAASGANDRVSRNLDVAVSRLRKKAAEHSVHLPIKSIRGVGYVFVAEEAL
>NZ_CP054569.1|WP_174716935.1|4759657_4764301_-|autotransporter-domain-containing-protein
MSRIYWSKSAPTLVLSTLTAALLVAFPHAHAEPSSRDVTASGRDRVTLKRGNDYTSLTATRGGLIRGSRVDVEGRSGELVRAIDGGKIELTDTDISADRASRHSHHLEQGPAVSASSDDGRHSRHRETEVSLKGGSVTTRASNSPALQASGRGATVSADGTRLKTLGSGSDVVKLRSGGTAELRNVSIESQGRGADGVAVQGNRSNATLYRTRIETRGAGADGVEVTEGGQARVDRSAIKTSGTDAAGLRVDGRHSDAVLTRSEIRTRGTASSAVEVSRGGDVEIEDSELSTTGAGGAGIRAEGSGSDVSVRKTQVRTSGSGAAGMALSDRAQANVSRSVVSTSGRGSDGVAVGSGAELRMSRSQIDTSGRDADGLSVRGNGSKAVVDDLKISTKGKDSKALSVRDGGLAVVADSELSASGENGVAAAVSGEGARAVIRDSVLSAEGRDGHALEIKSSGFAYLADSVAVGTLSGATVTGEGSMFVAKNSQIEAKAEDDPHGRGRYRPASSTGLNVSKGGKAILLGGDVQAHSDDARGLGVSGKDSSVWAVGTEIVATGRNSAGAAVSNGASAVLLGGTKVSGEAAGLAVASGGRVWMSGGQLNATGEDGAALKVNDHGSLAAIQGTEIAADGMLGNGVAVEDGAKAFLLGATVSAGANGVAVDGRGSSLLAVDTTVQAGTETQIYSRRSDPVSAVGIKVSNGAGAAVQGGSVTAIGDGGTAVLIENGRALLKDARLEATGNDANALVVRSSRDDDDRRGRYGRRDDGHDRSKAEAWVSGATVSTSGDRSDAVLVQGRNSTLSIQGATITTTGAQAAGLSVQDGGRVSLADSSVGASGAGAAAIRLGSVIGEGAGAVSSLDISGSTLSATGENAAGIALDNSANLSITNSGVRSSGASLLSRLDAAGQRQTISIDSGATLVQNNGTLLQVERSEQGRDGRVDLDLKDGSITKGNIVDTQQGLTGDGGTYVRLRAQASYDGLMQGVREVVTEGGNQTLHFAGGSTLGSLLIDNHAVSSGGTVDNRISASGDVVVDNATLGGNWRIGGTLTGRNGAIIRPGNSVGAITAQAIDWRAGSTYQAEINAQGQSDLVEVTGNGGADVSKASLVVGPENGVGRVLLNHDYTVLTAAAGVQGKFAAASWTGQAYPLLALSTVYGPASVAVRMAPDTAAIERYGFTRNQRAAALGTATAAGSNASVDEAFFSANPKGAFDQLSGEVHASVRSILFNDMLSTSAAMQGQMRANLGAQLMPGQPTASTDAASPDAMPVSGAYPLWASFNAAGMTTNDDGNAASTRYSTTRLLVGGDAAIGGGWRLGAAAGVSSGDFKLSDRNSDGSVNNYTMMLYGGNAWKAGPGSLKLLVGGGYTRHNIDTSRTVDLAGSQDLDADYNGSTWQLFGDLGYAIPLGDNYSVEPFVNVAWFKQRLRGFDESGGDAALKAGSSREDLGTYTLGLRTALVYPGKTNPFTLRGHVGWRHATGDRDPSRSMSLVQGGGSAFSVYGSPIAKNAAVVGLSGEVGLDKNFALGLSYDGQFGSGNTDNAGSLFMKVRF
>NZ_CP054569.1|WP_088446142.1|4758742_4759444_-|SLATT-domain-containing-protein
MKDTADITSMQEDVLTPINELIRPRTEAETLLLRMRISQKCRYNASVRLRRSYRFRLFTSMMFAVGLMIIPLLQNSPITLGFSPAVMAMVQVLLAVGILVFTVIAGKAGFELRADKLNQEGDSLKDLSRRLTRYMAAGSEVRLEEFHQEYAALTSGKEAHSRSDYLQAQLEMKEYFPMWPGKRLALRVGLGISVLSNYVIPLLLILMEMAFVSDMLTLTTLYPNVLHLPGLAR
>NZ_CP054569.1|WP_174716937.1|4775493_4777749_-|phospholipase-C,-phosphocholine-specific
MTKTSLPHSAGASPALPGRRQFFRVSAQAAGALSAMALLPASIQRALAIPAAVDSGTIQDIKHVVILMQENRSFDHYFGTMRGVRGFGDRFPIPLANGKPVFFQPNPAGGQDILPFRRDSRISKALIGSGTPHNFPDQQAAWNQGKMDRWIQFKNQATMGFFMREDIPFQFALADAFTVCDGYHCSILTGTDPNRIVFWSGANANPELRKLGINCTDTDSEPVNSRCWPSPSNWVAGRVQEVDGSGQIDPVTGTYNYKYKNNAFKWDTLPDLLERAGVSWHIYQNMNNNWTGAMHGCLAFKSFREAQPGSPIYEHGLTGGPEKADGAVNFLAQLKQDVVNGTLPQVSWVLPTQALAEHPGSSEGVAGAADFIADVLDALTSNPEVWSKTALFVTFDENDGFFDHVAMPAAPSYDANGVLMGKSTVPLDGEYFDASVGSYLKAEDTTTGTVRPWGMSSRVPMYVVSPWSKGGWVNSQVFDHTSVGRFLEQRFGIKVDAISPWSRAVSGDLTTCFDFVTPNDPRIPKLPDTSNYPAINAAQNLLPTAPVTQAPAIPQPLFQETGTRFSRALPYELHTSARLGTDGAVELLFSNTGDAGAVFHVYDKRNLDLIPRRYTVEAGKTLSDTWTGGDYDLWVYSTNGFVRTFAGNTQRGAALEVQVCYEPAGGALYVKVSNHGKARLQAALQANAYRSDGPWTLTVEPGAVAEHHWSIAESGNWYDFTVTAEGFERRFAGRMENGRHGVSDPAMALHL
>NZ_CP054569.1|WP_174716938.1|4777786_4777957_-|hypothetical-protein
MTPYFAPGRALVAAIALSLTLAACGGDDDSDEGRAPPPEIEKPVTPPPAPQLRCAP
>NZ_CP054569.1|WP_088446152.1|4778046_4779051_-|phosphonate-ABC-transporter,-permease-protein-PhnE
MSTQAENAAWRLDPPYGARALLVVIAALMLFLYTGQRVEMGRMAALTFDGALAAVGLKEQSQVTAGLGALADSLFPLQVSYRTETSRIEGFDPDRLPWLARLETVQVTESRLNPHTLKMEDEVSTHTYLVEPLGYLWRVAVKMVETFEIAIWATLLAVLGSAPLAYCSARNYAPNRLLYVAARAAVSLFRAMPELICALFLVLAYGFGPIAGVLALAIHSMGFLGKFYAEDIETADTKPQEALAAIGAGKLRVLAYAVLPQVLPKFTGYTLYILDRNVRMATVVGLVGAGGIGQELKGRYDMYQYAHVGTILVVIFITVFLLDQVAARLRRRLI
>NZ_CP054569.1|WP_125283599.1|4779047_4779896_-|phosphonate-ABC-transporter-ATP-binding-protein
MLRYESVGMRYADGTMALDSVSLRVPRGQFCVILGASGAGKSTLLRMANGLTTPTQGQVWVDDTEVRPSTLAAVRPRIGMVHQHFNLVSRATVATNVLSGALPGLPAWRAYLLRFPAELRERACRLVREVGLQPEHLRRRVSELSGGQQQRVGIARAFMLAPALLLADEPVASLDPRISRDILGLLRDQARERGATVLCSLHQVDLAREFADRIVALRQGAMVFDGPAGAFDETTARALYQAGSSPAPREAAAATPEAGSEPPGQRLAARVRPALLSVGGAR
>NZ_CP054569.1|WP_174716939.1|4779919_4780858_-|phosphate/phosphite/phosphonate-ABC-transporter-substrate-binding-protein
MKTPRFSASALALISLLAAAPLAQAQSLADGSAQRPLRVLLIPADGGTESGTKADYAPIFNAITRSTGLHFQLTVGQSYGAVVEGMCNQLAEVAFLGPVSYVQAHDRLCAQLLAVGVQKGESAYYAAMFAKADSPIGSLADLKGKRAAFGDVNSASSFTFQVASMLKDGMNPAKDLAALQLTGSHASSLAALVQGQVDAAALSFDSFDKAVRQGAVDPKSVKVIFKSEPIPYPPLAMNTRLPEPLKATLKQAFATVHKAPGVTPDMVRGYGGAKLDRFDTEFSEEQFAGPASKMSLLTDEIKGEILDKAAQR
>NZ_CP054569.1|WP_174716940.1|4781087_4781933_+|HAD-hydrolase-like-protein
MTRIARASLLSPSASPTAEPPWTQRSHGLILDLDGTLIRGHEVIPGAGELLTRWAGRYVIVSNNSTDTAAGLAPRLRALGLPVQADSLVLAGEQAVRHIARGHPRARLMLCGSETLRACAAGLDLALVTRDADIVLLARDRDFSYATLQALARELAAGALLMVSNGDLTHPGPQGSVVPETGALLRAVLACAPGIRPLILGKPAAMLFQEGLRRLGLPAGDVTVIGDNARTDALGAARLGMAYLLVGDAPHADAPDMARLLAAARPRRHALPEGIAADADQ
>NZ_CP054569.1|WP_062679868.1|4781926_4782760_-|MurR/RpiR-family-transcriptional-regulator
MLARIQSLLPSMGAASQRIGEFVIRHPAEVVHMSVSEVAERTQSSEGSVVGFCKLLGATGFQQLKIALAQQIVQPVQYIHEDLAAQDTPEQVVSKIFHSNIQTLQETESVLDVAALSAAVELIRGARRVEIYGIGSSAIIAHDAHYRMLRIGLNATAVTDSHVQAISASLTGPDVAVLTISHSGSTHETVLATRLAKEAGARTVCITNFGKSPIQEYADVVLHTMSRETRFRTEAMTSRLAQLAIIDTLIACLALSDYDKAVSTLRSTFDVLSTKRY
>NZ_CP054569.1|WP_174716941.1|4782887_4783385_-|preprotein-translocase-subunit-SecG
MPLMLKLLLAVQVISALAIIVLVLLQQGKGADMGSAFGSGSAGSLFGATGAANFLSRATKWAAVVFFASTAGLAYVSHKGSTGTAVDSGVMQSFPADRSVPQVPGSVPATPSGASSVPGAGSVPAAPAKPDASVPAAPAAPAPAAPAPAAPAPAAGDKPAETPAK
>NZ_CP054569.1|WP_062679726.1|4783406_4784153_-|triose-phosphate-isomerase
MTSVENRARLVLGNWKMHGNLAENAALLTELRAADAASHCEIGVCVPFPYLAQAASALTGSSVSWGAQDVSAHDKGAYTGEVSGAMLKEFGCRWALAGHSERRVLHGETDEVVAAKAQAALAAGLTPVVCVGESLADRDAGNTLAVIERQLKPVLALGADAVSRMVLAYEPVWAIGTGRSASPEQAQEVHGAIRAALRALGAGQVQVLYGGSVKAANAASLFAMTDIDGALVGGASLVAEEFLRIAAI
>NZ_CP054569.1|WP_062679727.1|4784273_4785251_-|NAD(P)H-quinone-oxidoreductase
MHAVEISRPGGPEVLVPVERPTPEAGAGEVLIKVSAAGVNRPDVFQRKGNYAPPRGASDLPGLEVAGEIVGGDLAGSGFALGDKVCALVAGGGYAEYCVAPAAQCLPIPKGLSDIEAAGLPETYFTVWSNVFDRGRLSEGEALLVHGGASGIGTTAIQLARAMGHKVYATVGSDDRARAVEALGAERGINYKTQDFVKEVLDATGGRGVDVILDMVAGDYIARDMQCLADDGRIVIIAQLGGSHANVDTAQVMRRRLTITGSTLRPRPVAFKGAIARALREQAWPLLENGAIKPIVHATFPLAEASRAHAMMESGENIGKIILTM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054569_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054569_8

4832687-4832775

Orphan

Consensus_repeat	Method
CCCGCGCCGGTGTACGTGGCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054569_8

>merge|NZ_CP054569|8|4832687-4832775|CRISPRCasFinder
CCCGCGCCGGTGTACGTGGCGCCCCAACCCGTCTACGTGCCGCCGCCTCCGCCGGTTTATTACCGCCCCGCGCCGGTCTACGTGGCGCC

>NZ_CP054569|8|8|4832687-4832775|CRISPRCasFinder
CCCGCGCCGGTGTACGTGGCGCC	CCAACCCGTCTACGTGCCGCCGCCTCCGCCGGTTTATTACCGC
CCCGCGCCGGTCTACGTGGCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054569.1\|WP_082775659.1\|4831379_4831577_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054569.1\|WP_062679756.1\|4821513_4823166_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP054569.1\|WP_062679773.1\|4842882_4843752_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NZ_CP054569.1\|WP_174716955.1\|4830122_4831316_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|180337
NZ_CP054569.1\|WP_156494246.1\|4833017_4833176_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054569.1\|WP_062679772.1\|4841808_4842750_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP054569.1\|WP_062679769.1\|4836448_4837240_-\|deaminated-glutathione-amidase	unknown	unknown	gnl\|CDD\|143605
NZ_CP054569.1\|WP_174716956.1\|4838812_4840372_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173867
NZ_CP054569.1\|WP_088146962.1\|4835030_4836371_-\|replication-associated-recombination-protein-A	unknown	unknown	gnl\|CDD\|237355
NZ_CP054569.1\|WP_088146966.1\|4827021_4827927_-\|dihydrodipicolinate-synthase-family-protein	unknown	unknown	gnl\|CDD\|188630
NZ_CP054569.1\|WP_123786068.1\|4837393_4838662_+\|amino-acid-deaminase	unknown	unknown	gnl\|CDD\|143492
NZ_CP054569.1\|WP_174716952.1\|4823338_4824187_+\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP054569.1\|WP_062679767.1\|4833641_4834988_-\|serine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235461
NZ_CP054569.1\|WP_174716954.1\|4826002_4826983_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP054569.1\|WP_174716957.1\|4840796_4841774_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564
NZ_CP054569.1\|WP_088446230.1\|4829231_4830110_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176118
NZ_CP054569.1\|WP_174716953.1\|4824245_4825832_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|227279
NZ_CP054569.1\|WP_062679764.1\|4831768_4832272_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|119344
NZ_CP054569.1\|WP_062679761.1\|4827942_4829070_-\|mandelate-racemase/muconate-lactonizing-enzyme-family-protein	unknown	unknown	gnl\|CDD\|239432
NZ_CP054569.1\|WP_082775660.1\|4833162_4833411_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP054569.1\|WP_062679756.1\|4821513_4823166_-\|MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.29763e-117
NZ_CP054569.1\|WP_174716955.1\|4830122_4831316_-\|amidohydrolase-family-protein	gnl\|CDD\|180337	PRK05985, PRK05985, cytosine deaminase; Provisional.	0
NZ_CP054569.1\|WP_062679772.1\|4841808_4842750_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	9.96174e-128
NZ_CP054569.1\|WP_062679769.1\|4836448_4837240_-\|deaminated-glutathione-amidase	gnl\|CDD\|143605	cd07581, nitrilase_3, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases). The nitrilase superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13). Class 13 represents proteins that at the time were difficult to place in a distinct similarity group; this subgroup represents either a new class or one that was included previously in class 13. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.	6.06912e-128
NZ_CP054569.1\|WP_174716956.1\|4838812_4840372_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173867	cd08502, PBP2_NikA_DppA_OppA_like_16, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP054569.1\|WP_088146962.1\|4835030_4836371_-\|replication-associated-recombination-protein-A	gnl\|CDD\|237355	PRK13342, PRK13342, recombination factor protein RarA; Reviewed.	0
NZ_CP054569.1\|WP_088146966.1\|4827021_4827927_-\|dihydrodipicolinate-synthase-family-protein	gnl\|CDD\|188630	cd00408, DHDPS-like, Dihydrodipicolinate synthase family. Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stabilizes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family.	1.41828e-71
NZ_CP054569.1\|WP_123786068.1\|4837393_4838662_+\|amino-acid-deaminase	gnl\|CDD\|143492	cd06818, PLPDE_III_cryptic_DSD, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Bacterial Cryptic D-Serine Dehydratase. This subfamily is composed of Burkholderia cepacia cryptic D-serine dehydratase (cryptic DSD), which is also called D-serine deaminase, and similar bacterial proteins. Members of this subfamily are fold type III PLP-dependent enzymes with similarity to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. AR exists as dimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on similarity, it is possible cryptic DSDs may also form dimers. Cryptic DSDs are distinct from the ubiquitous bacterial DSDs coded by the dsdA gene, mammalian L-serine dehydratases (LSD) and mammalian serine racemase (SerRac), which are fold type II PLP-dependent enzymes. At present, the enzymatic and biochemical properties of cryptic DSDs are still poorly understood. Typically, DSDs catalyze the dehydration of D-serine to aminoacrylate, which is rapidly hydrolyzed to pyruvate and ammonia.	0
NZ_CP054569.1\|WP_174716952.1\|4823338_4824187_+\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	4.79322e-49
NZ_CP054569.1\|WP_062679767.1\|4833641_4834988_-\|serine--tRNA-ligase	gnl\|CDD\|235461	PRK05431, PRK05431, seryl-tRNA synthetase; Provisional.	0
NZ_CP054569.1\|WP_174716954.1\|4826002_4826983_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	4.10007e-127
NZ_CP054569.1\|WP_174716957.1\|4840796_4841774_+\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	4.04471e-18
NZ_CP054569.1\|WP_088446230.1\|4829231_4830110_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176118	cd08427, PBP2_LTTR_like_2, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.24686e-71
NZ_CP054569.1\|WP_174716953.1\|4824245_4825832_-\|EAL-domain-containing-protein	gnl\|CDD\|227279	COG4943, COG4943, Predicted signal transduction protein containing sensor and EAL domains [Signal transduction mechanisms].	1.96128e-163
NZ_CP054569.1\|WP_062679764.1\|4831768_4832272_+\|hypothetical-protein	gnl\|CDD\|119344	cd06552, ASCH_yqfb_like, ASC-1 homology domain, subfamily similar to Escherichia coli Yqfb. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation.	1.28628e-05
NZ_CP054569.1\|WP_062679761.1\|4827942_4829070_-\|mandelate-racemase/muconate-lactonizing-enzyme-family-protein	gnl\|CDD\|239432	cd03316, MR_like, Mandelate racemase (MR)-like subfamily of the enolase superfamily. Enzymes of this subgroup share three conserved carboxylate ligands for the essential divalent metal ion (usually Mg2+), two aspartates and a glutamate, and conserved catalytic residues, a Lys-X-Lys motif and a conserved histidine-aspartate dyad. Members of the MR subgroup are mandelate racemase, D-glucarate/L-idarate dehydratase (GlucD), D-altronate/D-mannonate dehydratase , D-galactonate dehydratase (GalD) , D-gluconate dehydratase (GlcD), and L-rhamnonate dehydratase (RhamD).	1.21718e-121
NZ_CP054569.1\|WP_062679773.1\|4842882_4843752_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	2.14158e-100

>NZ_CP054569.1|WP_062679764.1|4831768_4832272_+|hypothetical-protein
MKRQSLQFSEPLKQAVLNGGKVQSRRILKPQPSKPTTVWYADASDSGRWVAMGPSLDNPSELRRTSSWVRCPYGKSGESIVLTDEAGNPFTTAVIVGVRIQRLQNLSEADARAEGIQALYQSSSLLPGVPLQTAFALTWCERYGSHAWAANPWVWVVEFRRQQDQEG
>NZ_CP054569.1|WP_082775659.1|4831379_4831577_-|hypothetical-protein
MTTDLHDLKPGYYWYTMANDPLAIIHIHEDGGATLMGTDYRIGAEGVADMVRQGERFFWIEPPQV
>NZ_CP054569.1|WP_174716955.1|4830122_4831316_-|amidohydrolase-family-protein
MTDLLLKNVRVQDAIADVQVRAGRIRQIGPALAAEPGMAVEDGAGALLLPGLVEGHAHLDKTTWGSPWYVNEVGSALTDRIHNERQWRASTGHDAASHARALALAFLREGTTRIRTHVDVDTDAGLRHLDGVHAVRQELAGRVEIQTVAFPQSGLLVRPGTAELLDQALAAGADALGGLDPSAIDRDPARSLDVLFGIADKHGKPLDIHLHEPGELGAFTLELILDRTQALGMNGKVVISHAFCLGGVDAKRLDGLLRRLAALDVALLTTAPPSRPVPPVRACREAGVTIFGGNDGIRDTWTPYGSPDMLARATLIGLRNDLRRDDEVEWAFDCVTAAAARACGFADYGLAPGARADLVLVDASCVAEAVVARAPRRLVVSGGAIVARNGRDAATPA
>NZ_CP054569.1|WP_088446230.1|4829231_4830110_+|LysR-family-transcriptional-regulator
MDSRFLQTYVHVVELGSIAQAARHQGLTPATVQQRLRALETDMGSALIARSGRTVKPTPAGTRILERARAILRDVRDLRSAASDTELPAGPLRLGATPTALTGIMPPVLRTWVARHPHIEIYIEPAPTTLLYSKVLSGELDGALLVHPLFAIPKTCAWRDLRQEPLVLATPADMKVRDPLAVLAREPYIRYDRSVVGGKMAEDYLRARNLRPHVRFELDGIESIARLVAEGLGVALLPDWATTGAPSSAVRRWPLPPPCPVRTVGAIWPRAGVRSALMQAFVELTETQLGLG
>NZ_CP054569.1|WP_062679761.1|4827942_4829070_-|mandelate-racemase/muconate-lactonizing-enzyme-family-protein
MPIIESIDVCAAAVPLDKVTSFSNRTVSTRHYGLVKIRSTDGVEGIGFCYVGSAGGAIFEAAVESLLAPVLLGKDSHAVEGLWQAMYQEALLQGRQGTVMRALSALDIALWDLNAKAAGLPLHRYLGAVELESVPAYASGGYYLDGKTPQHLGEEMASYVEKGFRAVKMKTGRLSPREEEARLKAAREAIGPDVELMMDCNNAWEDVTQAMQYIRRFEQYDPYFIEEPFGPDDIESHAKLARLTRLPIATAEIGYGRWYHKELLDKGAAGILQTDAAVCGGITEWKRIAATAASYGVMVCPHWFHDVHAPLVAATPNARYVEFFWDDQVLNFRKLVDRQLTHKQGRVILHQEPGLGFGFDERMVERFGKWTRVAR
>NZ_CP054569.1|WP_088146966.1|4827021_4827927_-|dihydrodipicolinate-synthase-family-protein
MSTAASDRPQGVYSPVLTPFNADRSPSAPRFVEHCRALLEQGAGLAIFGTNSEANSLTVAEKRALLDALLEAGLPAGRMMPGTGACALPDAVELTRHAVQAGCGGVLMLPPFYYKGVSDEGLFRAFAHVIEQVADERLRIYLYHIPPVSGVPVSLALIDRLLGEFPGIVAGVKDSSGDWANTEAMLRDFQPRGFDVFAGTETVLLETLRAGGAGCITATGNVNAGPIVELYRRWREDDAEDRQRALNETRAVFQSYPMIPAMKAAIAERRGDPAWATVRPPLVELDETQSRQLAQRLAALS
>NZ_CP054569.1|WP_174716954.1|4826002_4826983_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MQRRQFMTGAAALGAALVLPATARAQDMPSGPVKIVVGFPAGGGTDVLARLLGQKLGVMWSIPVIVENRAGAAGIIAAEQVARQPNDGNTLLMAHVNSHGIAPGLQPKLAYSVERDFSPIALVGKTPTILIGGAGQPARTLPELVKLCKAQPGKIVFGSAGSGSAQHLALEIFKARAGIDVLHVPYKGSAPLMNDLMGGHVQYCFEGMTTATPLLQSGKVVALAQTLQQRSKSQPDVPTVAEQGYPGFEASIWFGMVGPGSMPAAMVQRMNRDIDKVLAMADVQEKLAQVGAEDGGGSVQRFADFMRQEQEKYAKTIKDAKIVAEG
>NZ_CP054569.1|WP_174716953.1|4824245_4825832_-|EAL-domain-containing-protein
MPRKYVIGIAIAFAAAAALLPIGFALHMSWSRAVAVEQRDLQGQAERTLKFTQGLLDQTVAMLRTLNDVPFEPCSPQHIRHLRALALKDRAVDELAYVAGRVVKCTTWGVPSYEEALVPTQYLLSNGGQLVLDAVPVVSPGIRMVAVRYGDYSALLEPGRFTEKGAADGVQLAVVLPGVGMLGTRNHPDLVLVSQALNGGKLNLDEAYLSAVARNADLAVVLLEPQSEALGALRRERLFWLPMGALAAALMIGLVVWLSRRRLSLAGELAAAVRRREFVVHYQPIIDLRSGRCVGAEALIRWIRPGGKTLRPDLFISIAEENGLMTRITEEVFRLVIRDMEDLLAEDRGMHIAVNLSAGDLKDGKVLRVLQEMLEGTAIDARQIWLEATERGFMDVDKARCIIEQAREQGHAVAIDDFGTGYSSLSYLQRLPLDTLKIDKSFVDTIGTDSATHKVTDHIIDMAKSLNLLTVAEGIERQEQADHLKNRNVDFGQGWLFGKPMPAPEFILYYRKNAATTPPPQRLPDATA
>NZ_CP054569.1|WP_174716952.1|4823338_4824187_+|IclR-family-transcriptional-regulator
MARPAGKVEKNAEQTPTAARRGIQSIEVGFRILDVIRKAGRPMPLKDIADASELTVPNVHYYLVSFQKVGVVLQHTDTGHYGLGPYALRLGLAALEQFDVFTTARPIMAEVAAITGHTVFLGVWGNKGPTIVYRVEGARSRPLLELRVGSVLPLLSSALGRNFLAHLPEASTRELLAQEMASPPSEGHGGAPGNAYTPQDVQAIRDEVRKHHLSRCRDALLPHFTSLSAPIFDMLGEMKAAITLMGPVGAIDDDLQSDTARLLSEKARSISATAGWVDPEGR
>NZ_CP054569.1|WP_062679756.1|4821513_4823166_-|MFS-transporter
MEANVAMQRIGAEQTLSRKEERQVVVASTLGTLFEWYDFFIYGTLAVFMSQVLFPQDNPTVALLAALGALAVGFIIRPLGAVMFGYLGDKLGRKYTFLITVVMMGGATVLIGCLPTYESAGHLSWILLLTLRVIQGLAVGGEYGGAVIYVAEHCEPKRRGLLTGWIQITSSAGLILSLIVILCTQAAMSAEDFRQWGWRLPFILSIVMLAISIYVRAKLHESPVFTRMKQQNRLSKNPVKETFGQWSSLRLVLLALIGVTAGQGATYFTGQFYVMIFLQQAVQLDQTSVYTLILIGFIIGAPTFVLFGWLSDRIGRKWIMMAGLFVAALGYHSMFDVLLKAGNPALAQAMQSTPVRVHADVSGGACDFGLQAAMIGSHADHKKVCVQAKKFLVGKGINFEYAAPLPGQDIAMSVGGKTVNGFDRAGYAAALTAAGYPDRADPARVDTTTIVLILVLMTAVVAMVYGPVASYLVELFPARIRYTALSFPYHIGAGIFGGIVPFTATYLAQASGNIFGGLMYPVAVTAVVGVIGSLFLPNTRAQAIDEDPAH
>NZ_CP054569.1|WP_156494246.1|4833017_4833176_-|hypothetical-protein
MRPHNGWWRASSAPRRWIDLVQEAPRWADGKAKQAPQQPAVLAGKPVQPPVA
>NZ_CP054569.1|WP_082775660.1|4833162_4833411_-|hypothetical-protein
MTSRMIGDFRVRCSVAREDDQGYRVQIWTRRIGGTAPEKCWTVPGQAPFTDLQEAEQESLQLFQGINGVRFNGEPEFAHASA
>NZ_CP054569.1|WP_062679767.1|4833641_4834988_-|serine--tRNA-ligase
MLDPILLRKDLQTVVDRLKTRGVSFDTERFNDLESRRKAVQTETESLQARRNALAKQIGQLKAKGEDASAVMAESQAVPVRLKQLEEELAALQQPLNDLLMSVPNLPHASVPLGESADDNVEVRRWLPGPAGADGNPPALPFEARDHVAVGEPLGLDFDMAAKLSGARFSFMRGPIARLHRALSQFMLDLQTGTHGYTECYTPYIVNASTLYGTGQLPKFKDDMFAVSKGGGDDDPKQDDQGKPYVREDQYLISTSEITLTSVARDTIQAAADLPIKLTAHTPCFRSEAGSGGRDTRGMIRQHQFDKVEMVQITHPEQSYEALEDMVGHAERVLQLLGLPYRVVLLCAGDMGFGAAKTYDLEVWLPAQNTWREISSVSNCETFQARRMQARFRNAQGKPEFVHTLNGSGLAVGRALVAVLENHQQADGSVLIPEALQPYMGGQTVLKP
>NZ_CP054569.1|WP_088146962.1|4835030_4836371_-|replication-associated-recombination-protein-A
MSNDLFAADPAHRPYVPLAERLRPRTLSDVVGQSHLLGPDKPLRVAFESGRPHSMIFWGPPGVGKTTLARLMADGFDAQFIAISAVLGGVKDIRDAVTVAQVAQGQGRRTILFVDEVHRFNKAQQDAFLPYVESGLFTFIGATTENPSFEVNSALLSRARVYVLQSLTPEELQLLVDRSEQALNDGREEGEIIRIAADAREQLAAWADGDARRLISAVEVVAESAQAAGRDTVDAAWLEISLSQNLRRFDKGGDAFYDQISALHKSVRGSNPDAALYWFCRMIDGGADPKYLSRRLVRMAVEDIGLADPRATDLAVNGADIYERLGSPEGELALAQAVVYMACAAKSNAVYNAYNQARKFAAEHGSAPVPIHLRNAPTKLMKQLGHGKAYRYAHDEPHGYAAAEQYFPDGLNPSFYRPTDRGLEAKIQQKLAFLRELDAQERAKKR
>NZ_CP054569.1|WP_062679769.1|4836448_4837240_-|deaminated-glutathione-amidase
MLKVALGQFAVSRVWEENAQVCIDLMERARAGGAGLLVLPEGILARDITDPQIVLKAAQPLDGPFMSRLLEASRGSQLATMMCVHVPTGEGRVWNTLVTLRDGKILSQYRKLHLYDAFTMKESTNVTPGGEIPPLLDIGGLRVGLMTCYDVRFPELARRLALDGADLLVLPAAWVRGPLKEKHWEVLVTARALENTCYVAATGECGERNIGCSMVVDPLGVVTARAGEAPALVFADIDPERLAHARKVLPVLANRRFAPPELA
>NZ_CP054569.1|WP_123786068.1|4837393_4838662_+|amino-acid-deaminase
MMNASSPAAPLDPNGKGLGAFPESCTTAGVAALRWNLLREDVSLPVAVLYEARVRHNLQWMQRFMEAYQVKLAPHGKTTMSPALFKRQIDNGAWGITLATAPQVLAAYRHGIRKILMANQLVGRANMAIIAQLLRDPAFTYCCIVDSAANAAQLGAYFGEQGLVLPVLIELGPAGGRTGVRDEAQLQAVADEIGRWPGLALAGIEVYEGVLQEEGAIRAFLRRATDALRGLAAAGRLRKSGPALISGAGSAWFDVVAEEFSQLDIGAPLEIVLRPGCYLSHDVGIYRSAAERINAHNPVARKMEPGLQPALQVWAYVQSLPEPGRAIVAMGKRDAAFDAGLPTPALLYRPGAQAPGAAPAHWKLTAMMDQHAFMQIGEGDDIQVGDMIAFDISHPCLTFDKWRQVLLVDEQYHVTDVADTFF
>NZ_CP054569.1|WP_174716956.1|4838812_4840372_+|ABC-transporter-substrate-binding-protein
MNFRTSRRGGGLNSLLLAGAIGLTALSTPALCAEPVKGGTISVATIGEPPTLDPMTSTADLVGILTQHFFETLYTFDGKWNLTPLLADKLPEVSADGLTYTIPLRQGITFHDGSKMDSSDVLASLKRWTETATRGKMAAKIIAGMEAPDANTIRITLKEPYAPLTALLAMNNSAAIIMPKAKIAPTLTEFVGTGPYQLKSRVPDQYIQLVRFDGYKQREGEPDGYGGARKQYLDEIRFVPVSNANTRVESAVAGQFDYVDSLPVESLPKLKNGRSDPVMLKPFGWPRLVLNTKQGIMSNLAVRQAVQLALNEEDMLYAAFGNKDFYKLNGDLYPEGYPWATSLGGKVYNKADAAAAKKLVDGANLQDRKIRILTSQQYEFHYKMALVAAEYLKAAGFTVDMQVVDWATLTQRRQDPAVWDIFITHSPFLPEPALIDFPSKDAPGWWDTPRRNEVLGAFNQARTQEERVKRWGDVQQAVYDEVPFIKVGDFNAQAARSPSLQGTKAVPWPYFWNAWKSAK
>NZ_CP054569.1|WP_174716957.1|4840796_4841774_+|IS110-family-transposase
MQIAVSFFGADVGKAEIVVADHGRAKPVTQILKNTPSSLSKWLQTLPPGSVLAMESTGGYERMLADLAHERGLKVYVLNPKALHHYAKSQGQRGKTDRLDAIMIARFIASEHERLHPYQPCAQYIERLRQMLRLRRMAVITRTQLRLSSERHHQVHAQAQVQKALDALTELANSLEDQMLAEIQAEPALAQDFKLLTSIVGVGNLTATALVTTFARIPFTSSDAVVAYAGLDPRPKESGAYKGMRKLSKQGDAILRSLAYNAATAAARSITFKPMYQALLAKGWATTQALNIIARKLLRIAFGVWKSRKPFERELFLANQACVKP
>NZ_CP054569.1|WP_062679772.1|4841808_4842750_+|ABC-transporter-permease
MLRYLLNRLVGLVAVMFIVATIVFVIIRVTPGDPAAVMLGPQASQQDIAALRAQLGLDQPLAVQYVSWLGKLAQGDLGQSIFMNKPVLAALADRAEPTLLLTLMSLLIASAIALPVGILSAVKRGTTLDQSVLSFSMFTSSVPSFWLGLLLMQLFSVKLGWLPVAGYGGPDASLATRLSHLILPAVVLGLVNSALITRFIRASMLDVLRDDYVRTARAKGLPESKVILKHAVRNALIPILTVLGLTTALLISGAVVTETVFGLPGVGSLVVSAVLRRDYPVIQGALLIIAAIYVLINLFIDLLYLLVDPRVRY
>NZ_CP054569.1|WP_062679773.1|4842882_4843752_+|ABC-transporter-permease
MTSATAASAGVDRWQVLRLLVSRKTVLISLIVIVVLVAAALLAPWISPYDPFKLSIMNRLKAPGATHWFGTDDFGRDVFSRVIYGGRLSLMVGFSVVIVSSVLGIALGLIAGFFRSADKFVSRLIDAMMAFPDILLAISLVAALGPSLVNVVIALGIVYTPRLARIVRASTLVIRELPFVEAARALGVPTWRIVTVHVLRNLVSPILVQGTFIFAYAILAEAGLSFLGVGVSPDIPTWGTMINAGQQYMGSADWIMIFPGIAIVLSVLSLQLVGDGLRDVLDPRLRKEL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054569_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054569_9

4892123-4892340

Orphan

Consensus_repeat	Method
GCCCCCACGCCGCGCCCCTTCCGGGGCTAGCTGGCCCCCCAAGGGGGCTTTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054569_9

>merge|NZ_CP054569|9|4892123-4892340|CRISPRCasFinder
GCCCCCACGCCGCGCCCCTTCCGGGGCTAGCTGGCCCCCCAAGGGGGCTTTTTTTCCTTGGGGCGGCCCGGCGGAAAAAAGGAGCCCCCACGCCGCGCCCCTTCCGGGGCTAGCTGCCCCCCAAGGGGGCTTTTTTCCTTGGGGCGGCCCGGCGGAAAAAAGGAGCCCCCACGCCGCGCCCCTTCCGGGGCTAGCTGCCCCCAAGGGAGCTTTTTGTC

>NZ_CP054569|9|9|4892123-4892340|CRISPRCasFinder
GCCCCCACGCCGCGCCCCTTCCGGGGCTAGCTGGCCCCCCAAGGGGGCTTTTTT	TCCTTGGGGCGGCCCGGCGGAAAAAAGGAGCCCCCACGCCGCGCCCCTTCCGGGGCTAGCTGCCCCCCAAGGGGGCTTTTTTCCTTGGGGCGGCCCGGCGGAAAAAAGGA
GCCCCCACGCCGCGCCCCTTCCGGGGCTAGCTGCCCCCAAGGGAGCTTTTTGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054569.1\|WP_082775661.1\|4896008_4896932_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP054569.1\|WP_125283037.1\|4899104_4899551_+\|PaaI-family-thioesterase	unknown	unknown	gnl\|CDD\|239527
NZ_CP054569.1\|WP_062679807.1\|4886328_4886883_-\|nucleotide-exchange-factor-GrpE	unknown	unknown	gnl\|CDD\|237621
NZ_CP054569.1\|WP_062679815.1\|4893582_4894374_+\|4-hydroxy-tetrahydrodipicolinate-reductase	unknown	unknown	gnl\|CDD\|234595
NZ_CP054569.1\|WP_123786086.1\|4899633_4900602_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_CP054569.1\|WP_062679817.1\|4897194_4897899_+\|haloacid-dehalogenase-type-II	unknown	unknown	gnl\|CDD\|319787
NZ_CP054569.1\|WP_062679810.1\|4888401_4889406_-\|heat-inducible-transcriptional-repressor-HrcA	unknown	unknown	gnl\|CDD\|234621
NZ_CP054569.1\|WP_062679811.1\|4889544_4890444_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|179379
NZ_CP054569.1\|WP_174716967.1\|4897900_4899112_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NZ_CP054569.1\|WP_062679804.1\|4882669_4883794_-\|molecular-chaperone-DnaJ	unknown	unknown	gnl\|CDD\|236757
NZ_CP054569.1\|WP_174716966.1\|4890457_4892119_+\|DNA-repair-protein-RecN	unknown	unknown	gnl\|CDD\|223571
NZ_CP054569.1\|WP_062679808.1\|4887014_4887251_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054569.1\|WP_062679809.1\|4887263_4888355_-\|ferrochelatase	unknown	unknown	gnl\|CDD\|234585
NZ_CP054569.1\|WP_062679806.1\|4885909_4886314_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_CP054569.1\|WP_174716965.1\|4881530_4882556_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|226077
NZ_CP054569.1\|WP_088146944.1\|4883903_4885829_-\|molecular-chaperone-DnaK	unknown	unknown	gnl\|CDD\|234715
NZ_CP054569.1\|WP_062679816.1\|4894464_4895499_-\|UDP-N-acetylmuramate-dehydrogenase	unknown	unknown	gnl\|CDD\|234593
NZ_CP054569.1\|WP_174715468.1\|4897046_4897238_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054569.1\|WP_062679814.1\|4893029_4893566_+\|outer-membrane-protein-assembly-factor-BamE	unknown	unknown	gnl\|CDD\|367908
NZ_CP054569.1\|WP_062679813.1\|4892456_4892876_-\|ferric-iron-uptake-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366663

Protein	Function_ID	Function_description	E-value
NZ_CP054569.1\|WP_082775661.1\|4896008_4896932_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.56167e-57
NZ_CP054569.1\|WP_125283037.1\|4899104_4899551_+\|PaaI-family-thioesterase	gnl\|CDD\|239527	cd03443, PaaI_thioesterase, PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria. Although orthologs of PaaI exist in archaea and eukaryotes, their function has not been determined. Sequence similarity between PaaI, E. coli medium chain acyl-CoA thioesterase II, and human thioesterase III suggests they all belong to the same thioesterase superfamily. The conserved fold present in these thioesterases is referred to as an asymmetric hot dog fold, similar to those of 4-hydroxybenzoyl-CoA thioesterase (4HBT) and the beta-hydroxydecanoyl-ACP dehydratases (FabA/FabZ).	3.91181e-23
NZ_CP054569.1\|WP_062679807.1\|4886328_4886883_-\|nucleotide-exchange-factor-GrpE	gnl\|CDD\|237621	PRK14139, PRK14139, heat shock protein GrpE; Provisional.	2.77437e-80
NZ_CP054569.1\|WP_062679815.1\|4893582_4894374_+\|4-hydroxy-tetrahydrodipicolinate-reductase	gnl\|CDD\|234595	PRK00048, PRK00048, dihydrodipicolinate reductase; Provisional.	9.00647e-131
NZ_CP054569.1\|WP_062679817.1\|4897194_4897899_+\|haloacid-dehalogenase-type-II	gnl\|CDD\|319787	cd02588, HAD_L2-DEX, L-2-haloacid dehalogenase. L-2-Haloacid dehalogenase catalyzes the hydrolytic dehalogenation of L-2-haloacids to produce the corresponding D-2-hydroxyacids with an inversion of the C2-configuration. 2-haloacid dehalogenases are of interest for their potential to degrade recalcitrant halogenated environmental pollutants and their use in the synthesis of industrial chemicals. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.07517e-47
NZ_CP054569.1\|WP_174716966.1\|4890457_4892119_+\|DNA-repair-protein-RecN	gnl\|CDD\|223571	COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair].	0
NZ_CP054569.1\|WP_062679810.1\|4888401_4889406_-\|heat-inducible-transcriptional-repressor-HrcA	gnl\|CDD\|234621	PRK00082, hrcA, heat-inducible transcription repressor; Provisional.	2.0375e-146
NZ_CP054569.1\|WP_062679811.1\|4889544_4890444_+\|NAD-kinase	gnl\|CDD\|179379	PRK02155, ppnK, NAD kinase.	1.83455e-179
NZ_CP054569.1\|WP_062679804.1\|4882669_4883794_-\|molecular-chaperone-DnaJ	gnl\|CDD\|236757	PRK10767, PRK10767, chaperone protein DnaJ; Provisional.	0
NZ_CP054569.1\|WP_062679814.1\|4893029_4893566_+\|outer-membrane-protein-assembly-factor-BamE	gnl\|CDD\|367908	pfam04355, SmpA_OmlA, SmpA / OmlA family. Lipoprotein Bacterial outer membrane lipoprotein, possibly involved in in maintaining the structural integrity of the cell envelope. Lipid attachment site is a conserved N terminal cysteine residue. Sometimes found adjacent to the OmpA domain (pfam00691).	1.28424e-32
NZ_CP054569.1\|WP_088146944.1\|4883903_4885829_-\|molecular-chaperone-DnaK	gnl\|CDD\|234715	PRK00290, dnaK, molecular chaperone DnaK; Provisional.	0
NZ_CP054569.1\|WP_062679809.1\|4887263_4888355_-\|ferrochelatase	gnl\|CDD\|234585	PRK00035, hemH, ferrochelatase; Reviewed.	1.79324e-161
NZ_CP054569.1\|WP_062679806.1\|4885909_4886314_-\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	8.87152e-06
NZ_CP054569.1\|WP_174716965.1\|4881530_4882556_-\|IS110-family-transposase	gnl\|CDD\|226077	COG3547, COG3547, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.19047e-38
NZ_CP054569.1\|WP_174716967.1\|4897900_4899112_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	1.03342e-166
NZ_CP054569.1\|WP_062679816.1\|4894464_4895499_-\|UDP-N-acetylmuramate-dehydrogenase	gnl\|CDD\|234593	PRK00046, murB, UDP-N-acetylmuramate dehydrogenase.	0
NZ_CP054569.1\|WP_123786086.1\|4899633_4900602_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	5.60904e-129
NZ_CP054569.1\|WP_062679813.1\|4892456_4892876_-\|ferric-iron-uptake-transcriptional-regulator	gnl\|CDD\|366663	pfam01475, FUR, Ferric uptake regulator family. This family includes metal ion uptake regulator proteins, that bind to the operator DNA and controls transcription of metal ion-responsive genes. This family is also known as the FUR family.	1.23409e-59

>NZ_CP054569.1|WP_174716966.1|4890457_4892119_+|DNA-repair-protein-RecN
MLRTLHIRDFVIVEQTEIHFGPGFTVFSGETGAGKSILVDALALTLGERGDASMLREGAPRADITAVFDTPKALHAWLAEREIDADAELSLRRVIDAQGRSRAYINGTPATVAQLRELGDSLVDIHGQHAHQSLMRPDAQRDLLDAHGGHGELRHAAGQAWKQWRALARQLESAEKDAESLASERDRLQWQVDELDQLALGPDEWESLQSEHTRLSHAQSLLDGSTQILEALDGEGDSAHHRVTQANQRIHQMLRHDPGLQGVYDELESARIAISEAVSDLNNYVSRVDLDPQRLGTVENRLGLVFETARKFRTEPDALCELRETLHAQLAALQAAGDIDALRAQAQAAQAQYDAAAAKLTAARRKTAKDLGKLVTQAMQTLAMQGGKFEPVLTPSAPAAHGNEQVEFLVAGHAGTTPRPLAKVASGGELSRISLALSVIASRAARVPTLIFDEVDSGVGGAVAEVVGKLLRELGERHQVLCVTHLPQVAACANNQFLVSKSESRGTTRSSIEELDAPARVEEIARMLGGIKLTATTREHAREMLQGFGQASV
>NZ_CP054569.1|WP_062679811.1|4889544_4890444_+|NAD-kinase
MHFPTVALIGRYQDTGLDTPLRALAHALAQAGRHVLIDADTARNTGLTEYPVATLEEIGQTASLAVVMGGDGTVLGAGRHLAPFGVPLIGINHGRLGFITDIALQDAHGALARVLEGSFQIEERTLLEGSVWRGDQKMYSATALNDVVLNRAGRGGMIEVRVELDGAFMYTQRADGLIIATPTGSTAYALSANGPILHPGMNAMVLVPVAPQTLSNRPIVIPDTGVLNMTLTAMGRVEVGASVHFDMQTWSDLQPGDRIVVQRAPYAIRFVHPEGYSFFSTLRRKLHWNLMPQASDNVE
>NZ_CP054569.1|WP_062679810.1|4888401_4889406_-|heat-inducible-transcriptional-repressor-HrcA
MDDRARALLKALIERYIADGQPVGSRTLSKVFDLSPATIRNVMADLEELGLIHSPHTSAGRIPTPRGYRMFVDSLLAVQSYQLEPHNMGEMLAAAEPTRAVNAAAALLSNLTQFAGVVLTPKRAQVFRQIEFIRLSDKRVLLIIVTPDGDVQNRILFVQRDYAESELLEAGNFFNMHFAGKSFNAVRQTLSTELAQLREDISRLMQAAVEASAEAAEDGDAMVISGERKLLDVTDIASDMDRLRKMFSLFEKKTDLLQLLDVSSRAQGVQIYIGGDSQLVPMEEVSVITAPYGVDGKVVGTLGVIGPTRMAYERVIPIVDITARLLSNALSHNQ
>NZ_CP054569.1|WP_062679809.1|4887263_4888355_-|ferrochelatase
MFLRLFKYLWPERYLPEPEQDDPFNEDPPPRGPGKVGVLLVNLGTPDTPGRKDIRKYLGEFLSDPRVIEIPRYLWKPILHGLVLTMRPKKLEPRYTGVWMKEGSPLMVYSERQADGVRAALRAAGMDVVVELGMRYGNPSIPDAIARLREQGCERILTVPLYPQYAASTTATVVDAVTRHAARLRDQPELRFIKRFHEEPGYLDALAGRIERFWQENGKPQKLVMSFHGLPRYSIELGDPYYRDCMDTARLLSDRLSLPREQIEVTFQSRFGTARWLEPYTEPTLKALAASGTTEVDVVCPGFVADCLETLEEISLECRDAFIGAGGRQFRYIPAINDDPAWIAGLSGLVERHLQGWPTQSRT
>NZ_CP054569.1|WP_062679808.1|4887014_4887251_-|hypothetical-protein
MHHDPKTGKVVKKGTVSTPVDEDQVEHELDEALAETFPASDPIAVHPEPDDDDERMDRALKESFPASDPAAPAQPSKK
>NZ_CP054569.1|WP_062679807.1|4886328_4886883_-|nucleotide-exchange-factor-GrpE
MTAPHEPADQAPEIGQSADAAPAAQDAQAELNELRAQLDAAQATVNEQRDQVLRAQAEVENVRRRAQEDVSKARKFGIESFAESLVPVKDSLEAALAQPDQTVEALREGVEVTLKQLTAGFERNLLKEIAPAQGDKFDPHLHQAISSIPNEQPANTVVQLLQKGYSIADRTLRPALVVVSAGQG
>NZ_CP054569.1|WP_062679806.1|4885909_4886314_-|thioredoxin-family-protein
MTDPRFDPAQVFQVFGMRHVDTAGFDAAVVQAPGADLRCVFLWGQDCYNCNLFKQAALLHRETLLGLDLTWFEADVYADEPLGRRFSLHGVPTFVLYRAGKRLGRITGWPGLPQFTAAIRRLQETPTENSSQAS
>NZ_CP054569.1|WP_088146944.1|4883903_4885829_-|molecular-chaperone-DnaK
MSKIIGIDLGTTNSCVAVMDGGQVKIIENAEGARTTPSIVAYMDDGETLVGAPAKRQAVTNPRNTLYAVKRLIGRKFEEKAVQKDINLMPYAIVKADNGDAWVEVRGKKMAPPQVSADVLRKMKKTAEDYLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGLDKTEKGDRKIAVYDLGGGTFDVSIIEIADVDGEKQFEVLSTNGDTFLGGEDFDQRIIDYIIGEFKKEQGVDLSKDVLALQRLKEAAEKAKIELSSAQQTEINLPYITADASGPKHLNLKITRAKLEALVEELIERTIEPCRVAIKDAGVKVSDIDDVILVGGMTRMPKVQEKVKEFFGKDPRKDVNPDEAVAAGAAIQGSVLSGDRKDVLLLDVTPLSLGIETLGGVMTKMIQKNTTIPTRFSQTFSTADDNQPAVTIKVFQGEREIAAGNKALGEFNLEGIPPSPRGMPQIEVTFDIDANGILHVSAKDKGTGKENKITIKANSGLSEDEIQRMVKDAEANAEEDHRVAELAQSRNQADALVHATRKSLTEYGDKLEASEKESIEAAIKELEDTLKEGDKAAIDAKVEALSTASQKLGEKMYADMQAQQAAGQQQAADNAKPVDDNVVDADFKEVKRDQ
>NZ_CP054569.1|WP_062679804.1|4882669_4883794_-|molecular-chaperone-DnaJ
MAKRDYYDVLGVAKNASDDDLKKAYRKLAMKYHPDRNPDSKEAEEKFKEAKEAYEVLGDEQKRAAYDRYGHAGVDPNAAGMGGGMGGGFADAFGDIFGEIFGGGGGRRGGGPQVYRGADLKYALEITLEQAAAGFDTEIRVPSWENCDTCHGSGAKPGTSPKTCRTCGGSGAVRMQQGFFSVQQTCPTCHGNGKEITDPCVACDGVGRIRRNKTLQVKIPAGIDDGMRIRSSGNGEPGINGGPPGDLYVEIHIKQHKIFQRDGDDLHCELTIPFTTAALGGELQVPTLGGKAEISIPEGTQSGKTFRLRGKGIRGVRGSYPGDLYCHVVVETPVRLSDDQKNILRQFEASLNDGGDRHSPQSKSWTDRVKEFFS
>NZ_CP054569.1|WP_174716965.1|4881530_4882556_-|IS110-family-transposase
MSTVTLIGIDLGKHRFHLHGQDSAGRRVFRKKCSRQQLFTLLGNTPRSTVVMEACAGAHWMARRIQALGHQAKLISPQFVRPFVQGNKNDFADAQAICEAASRPSMRFVSVRNEAQQTISALHRVRESLVRERTGVINQIHAFLLEFGISLPRGQAIIRRLPAVLAEHELPPRLVALLERLQAHFKCLDEQVAQIERELCQQLREDERSQRLLEIPGIGPITASVLMTELGDAQQFGSAHQFAASVGLVPRQYSTGGKPTLLGISKRGDKNLRRLLVQGARAIMQHIDRRTDRLGVWVRELLARRHSNVVACALANKLARIAWAILANGTNYRSQQAVSAT
>NZ_CP054569.1|WP_062679813.1|4892456_4892876_-|ferric-iron-uptake-transcriptional-regulator
MSDQSELKNMGLKATFPRLKILDIFRKSDQRHLSAEDVYRALIGENVEIGLATVYRVLTQFEQAGILARSQFDSGKAVFELNDGDHHDHLICTNCGKVVEFSDPEIEKRQQKIAKDNAFALESHAMVLYGICGSCLKGR
>NZ_CP054569.1|WP_062679814.1|4893029_4893566_+|outer-membrane-protein-assembly-factor-BamE
MIARIPSRSLKTGLAVAALAVALAGCTGDKWGFPYKAGVQQGNWITQEQVALLQPGMTREQVRFALGSPTLTSVLHANRWDYPYYFKPGYGDAQERKFTVWFENDRLVRWEGDKQPDLQPYQINTPNAAADEKAEKRLSEDEARQKEDEAESRRDSAAPVSPLNQYPGQPGNAPEPLN
>NZ_CP054569.1|WP_062679815.1|4893582_4894374_+|4-hydroxy-tetrahydrodipicolinate-reductase
MRIAIAGASGRMGQMLIDAVLNSTDLQLTVALDRQGSASLGQDAGAPLGKQTGVAITDDLDALAQADCLVDFTRPEGTLEHLQACVKHGVKAVIGTTGFDDNGRAAIEVAAQKIGIVFAPNMSVGVNATLKLLDMAARILNAGYDVEVFEAHHRNKVDAPSGTALKMGETIASAWDVALPDVATWSRHGDTGVRKPGTIGFSVLRGGDIVGDHTVSFCGIGERVEITHRSSSRATYAEGALRAARFLESKHNGLYDMQSVLGL
>NZ_CP054569.1|WP_062679816.1|4894464_4895499_-|UDP-N-acetylmuramate-dehydrogenase
MSNSSASPTLSPVIQDLTRLNTLGLVSRADAFVTLTDAAQLPALSRLASEASSLLVLGGGSNLVLPQRVPGLVARVAFKGVRLLEARPDAWVVEAAGGETWHGFVETCVGQGWDGLENLALIPGTVGAAPVQNIGAYGVELQERFLGLTAWDVRAGRLVDMNAADCRYSYRDSVFKHDEPGRWVIVSVRFALPRPWRPVLGYPDLQRHARLAEGAPTARDVFDAVCEIRRAKLPDPAVTGNAGSFFKNPIVSASARDALAERFPSLVSYAQADGRYKLAAGWLIDQCGWKGRALGAAGVHDRQALVLINRGGAGAADIMALARAIQAAVYERYGVRLEPEPVVV
>NZ_CP054569.1|WP_082775661.1|4896008_4896932_-|LysR-family-transcriptional-regulator
MRINLRSVDLNLLVMFDALMAERHVTRAAARAAMSQPAMSNALTRLRALFKDELLVRTANGMEPTPRALELRDAIHQILLQAERLMHSDALFEPATSKRSFTIRMSDLVGSLVLPGCMHRLSSVAPGISLDVLHIAPERSIRALEEDQLDFAVSFELSHGRTIRSESLLSDRMVCAMRRGHPLSKGRLTLKRFLEARHLRVAMSPTDLRFVDSKLAAQGLSREIAVNVPQWLLMPEMLRETDLLGVVSERFGSKLTSQGIVCKPLPFESPEFEWRIYFHQRHAHSKAHSWMKQLVIDVAQALPRGEA
>NZ_CP054569.1|WP_174715468.1|4897046_4897238_-|hypothetical-protein
MTTLILFLRTSADAIEILQLVEISADSREVKFTSRAKINPMDDWNGIIDGINSGGVKAAVLAR
>NZ_CP054569.1|WP_062679817.1|4897194_4897899_+|haloacid-dehalogenase-type-II
MASADVLKNKIKVVMFDQYGTVVDMQKGLTEIAAPFLKEKGWTGNPGSFVTWWRRTHFENSMIDALLHKEHTPYREIGHRAVSYTLERAGIEHTPDEVRYLVGCIEKLTCFPDVPEALARLQTRYKIVVLSNGDPDMLEAAKAYHKIPFDNVISVAEANSFKPHVATYAKAAEIMGVRMDEVLFVANHAFDCLGAKSAGMHSAFIDRRKRPFGGTPHQPDLWVDDMQSLADLMV
>NZ_CP054569.1|WP_174716967.1|4897900_4899112_+|CoA-transferase
MGPLTGIRVLDLSRVVSGPFCSMLLGDLGAEIIKIEEPEHGDDSRAFGPPFSGGESAYFLSVNRNKRSCAVNLRDKDGVGVVQSLAERSDVLLDNFRPGTMERLGLDHRALRAANPKLISCSITGFGRTGPDAQRPGYDLIIQGESGIMDITGDPNGPPTKVGTSIADLLTGQFAAQGIMAALLERARTGQGRHVDVSMLDSMASLLTFNAGIYFTTGNSPKRRGNTHATIAPYETFKASDGWLNIGVANDKFWQRFCGVIERPDLAGDPRYAKAVERVRLREELVPIVARIVASKPRRHWIAALSEAGVPYGDIRSVREVCEAEQLTSRGMLIEMAHPTAGVVKNIDSPIRFDDRNDDDHSPPPLLGEHTAQILEDLLGMSGEAVKSLAARGVVRCREAPHG
>NZ_CP054569.1|WP_125283037.1|4899104_4899551_+|PaaI-family-thioesterase
MDEMSARRAFEQALATHRPAFEHFFLARLLDLRFDYPERQCVITFEAKDFMFNPQGSLHGGIIAMVLDISMGHLLNRRQGPGATLEMKTQYVKAARAGTMRCCSEFIKLGQGISYLRAVMTDADGDTVAFATSTWKRLKPPAERSSKS
>NZ_CP054569.1|WP_123786086.1|4899633_4900602_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKRMKKLAAAGAICVAMPGVATSADWPGKPMTVIVPYGPGGGVDVFTRPLAAGLSKELGQPMIVENRPGAGGIIGVQHVSKANPDGYTYLSGGVHQPMAEGLYPKRNYDLDKDFVPVALTAYVPTVLVVTNNAPYKTVREFVAYAKAHPGDINYCSSGNGTSQHLVGEQFKRLTGINVTHVPYRGTAAAMTDLIAGHCSLMFDGLGTSASQIRSGSIRPLAVVTKNRSTLFPDIPTLKEAGGPDMDATIWYGWWTRQGTPPAVVKRMAEAIRNTLKDPAVAETWKLQGAEVPTMPYAETGPYVHAEIERWTQAVKELGISVD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054569_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054569_10

5786848-5786965

Orphan

Consensus_repeat	Method
GCCGCCCCAAGGCGGCGCAGCCCCCCCGGGGGGCAGCAAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054569_10

>merge|NZ_CP054569|10|5786848-5786965|CRISPRCasFinder
GCCGCCCCAAGGCGGCGCAGCCCCCCCGGGGGGCAGCAAGCAAGCGAAAGCTTGCGCAGCGTGGGGGCTCCCTCCCTGCCGCCCCAAGGCGGCGCAGCCCCCCCGGGGGGCAGCAAGC

>NZ_CP054569|10|10|5786848-5786965|CRISPRCasFinder
GCCGCCCCAAGGCGGCGCAGCCCCCCCGGGGGGCAGCAAGC	AAGCGAAAGCTTGCGCAGCGTGGGGGCTCCCTCCCT
GCCGCCCCAAGGCGGCGCAGCCCCCCCGGGGGGCAGCAAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054569.1\|WP_088147446.1\|5786995_5787685_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054569.1\|WP_062685490.1\|5774962_5775784_-\|SURF1-family-protein	unknown	unknown	gnl\|CDD\|119401
NZ_CP054569.1\|WP_013390978.1\|5777016_5777241_-\|DUF2970-domain-containing-protein	unknown	unknown	gnl\|CDD\|378581
NZ_CP054569.1\|WP_088446463.1\|5789994_5794734_+\|glutamate-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|236968
NZ_CP054569.1\|WP_062684299.1\|5785738_5786623_-\|RNA-polymerase-sigma-factor-RpoH	unknown	unknown	gnl\|CDD\|235838
NZ_CP054569.1\|WP_088147443.1\|5794742_5796209_+\|glutamate-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|237213
NZ_CP054569.1\|WP_062685496.1\|5784298_5785138_+\|3',5'-cyclic-AMP-phosphodiesterase	unknown	unknown	gnl\|CDD\|182997
NZ_CP054569.1\|WP_062684306.1\|5797078_5797951_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_CP054569.1\|WP_062684302.1\|5788845_5789586_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054569.1\|WP_062685491.1\|5776102_5776978_-\|cytochrome-c-oxidase-subunit-3	unknown	unknown	gnl\|CDD\|238834
NZ_CP054569.1\|WP_174717146.1\|5779120_5780278_-\|cytochrome-c-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|224537
NZ_CP054569.1\|WP_174717149.1\|5798016_5799279_+\|YbfB/YjiJ-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340869
NZ_CP054569.1\|WP_174717148.1\|5787745_5788612_-\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|131868
NZ_CP054569.1\|WP_174717150.1\|5800271_5801333_+\|nitronate-monooxygenase	unknown	unknown	gnl\|CDD\|240081
NZ_CP054569.1\|WP_174717145.1\|5774291_5774921_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239266
NZ_CP054569.1\|WP_174717147.1\|5780567_5781380_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|239648
NZ_CP054569.1\|WP_062684305.1\|5796402_5797041_+\|outer-membrane-beta-barrel-protein	unknown	unknown	gnl\|CDD\|182867
NZ_CP054569.1\|WP_062685492.1\|5777407_5779015_-\|cytochrome-c-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|238833
NZ_CP054569.1\|WP_006224570.1\|5775820_5776021_+\|twin-transmembrane-helix-small-protein	unknown	unknown	gnl\|CDD\|378564
NZ_CP054569.1\|WP_062684308.1\|5799275_5800253_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296

Protein	Function_ID	Function_description	E-value
NZ_CP054569.1\|WP_174717149.1\|5798016_5799279_+\|YbfB/YjiJ-family-MFS-transporter	gnl\|CDD\|340869	cd06180, MFS_YjiJ, Uncharacterized protein YjiJ and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli YjiJ and other uncharacterized proteins. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.15967e-54
NZ_CP054569.1\|WP_062685490.1\|5774962_5775784_-\|SURF1-family-protein	gnl\|CDD\|119401	cd06662, SURF1, SURF1 superfamily. Surf1/Shy1 has been implicated in the posttranslational steps of the biogenesis of the mitochondrially-encoded Cox1 subunit of cytochrome c oxidase (complex IV). Cytochrome c oxidase (complex IV), the terminal electron-transferring complex of the respiratory chain, is an assemblage of nuclear and mitochondrially-encoded subunits. Its assembly is mediated by nuclear encoded assembly factors, one of which is Surf1/Shy1. Mutations in human Surf1 are a major cause of Leigh syndrome, a severe neurodegenerative disorder.	2.29419e-42
NZ_CP054569.1\|WP_013390978.1\|5777016_5777241_-\|DUF2970-domain-containing-protein	gnl\|CDD\|378581	pfam11174, DUF2970, Protein of unknown function (DUF2970). This short family is conserved in Proteobacteria. The function is not known.	2.7918e-20
NZ_CP054569.1\|WP_088446463.1\|5789994_5794734_+\|glutamate-synthase-subunit-alpha	gnl\|CDD\|236968	PRK11750, gltB, glutamate synthase subunit alpha; Provisional.	0
NZ_CP054569.1\|WP_062684299.1\|5785738_5786623_-\|RNA-polymerase-sigma-factor-RpoH	gnl\|CDD\|235838	PRK06596, PRK06596, RNA polymerase factor sigma-32; Reviewed.	1.56921e-167
NZ_CP054569.1\|WP_062685496.1\|5784298_5785138_+\|3',5'-cyclic-AMP-phosphodiesterase	gnl\|CDD\|182997	PRK11148, PRK11148, cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional.	8.56199e-71
NZ_CP054569.1\|WP_062684306.1\|5797078_5797951_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.52356e-80
NZ_CP054569.1\|WP_088147443.1\|5794742_5796209_+\|glutamate-synthase-subunit-beta	gnl\|CDD\|237213	PRK12810, gltD, glutamate synthase subunit beta; Reviewed.	0
NZ_CP054569.1\|WP_062685491.1\|5776102_5776978_-\|cytochrome-c-oxidase-subunit-3	gnl\|CDD\|238834	cd01665, Cyt_c_Oxidase_III, Cytochrome c oxidase subunit III. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. CcO catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, is believed to play a role in assembly of the multimer complex. Rhodobacter CcO subunit III stabilizes the integrity of the binuclear center in subunit I. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit III contains bound phospholipids in several crystal structures and is proposed to contain a "lipid pool." These phospholipids are believed to intrinsic constituents similar to cofactors of the enzyme.	1.11817e-93
NZ_CP054569.1\|WP_174717146.1\|5779120_5780278_-\|cytochrome-c-oxidase-subunit-II	gnl\|CDD\|224537	COG1622, CyoA, Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion].	2.0868e-73
NZ_CP054569.1\|WP_174717148.1\|5787745_5788612_-\|S-formylglutathione-hydrolase	gnl\|CDD\|131868	TIGR02821, S-formylglutathione_hydrolase, S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well. [Cellular processes, Detoxification].	1.61298e-160
NZ_CP054569.1\|WP_174717150.1\|5800271_5801333_+\|nitronate-monooxygenase	gnl\|CDD\|240081	cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDP is a member of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.	9.1749e-84
NZ_CP054569.1\|WP_174717145.1\|5774291_5774921_-\|hypothetical-protein	gnl\|CDD\|239266	cd02968, SCO, SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properties of Sco1 implies that it participates in signaling events rather than functioning as a chaperone that transfers copper to COX II.	3.41713e-05
NZ_CP054569.1\|WP_174717147.1\|5780567_5781380_+\|NUDIX-domain-containing-protein	gnl\|CDD\|239648	cd03676, Nudix_hydrolase_3, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belong to this superfamily requires a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	1.18025e-63
NZ_CP054569.1\|WP_062684305.1\|5796402_5797041_+\|outer-membrane-beta-barrel-protein	gnl\|CDD\|182867	PRK10959, PRK10959, outer membrane protein W; Provisional.	1.20006e-74
NZ_CP054569.1\|WP_062685492.1\|5777407_5779015_-\|cytochrome-c-oxidase-subunit-I	gnl\|CDD\|238833	cd01663, Cyt_c_Oxidase_I, Cytochrome C oxidase subunit I. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, may play a role in assembly or oxygen delivery to the active site. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit I contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme (heme a3) and a copper ion (CuB). It also contains a low-spin heme (heme a), believed to participate in the transfer of electrons to the binuclear center. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from cytochrome c on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electrons are transferred from cytochrome c (the electron donor) to heme a via the CuA binuclear site in subunit II, and directly from heme a to the binuclear center.	0
NZ_CP054569.1\|WP_006224570.1\|5775820_5776021_+\|twin-transmembrane-helix-small-protein	gnl\|CDD\|378564	pfam11137, DUF2909, Protein of unknown function (DUF2909). This is a family of proteins conserved in Proteobacteria of unknown function.	5.90589e-17
NZ_CP054569.1\|WP_062684308.1\|5799275_5800253_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	1.5086e-146

>NZ_CP054569.1|WP_062684299.1|5785738_5786623_-|RNA-polymerase-sigma-factor-RpoH
MKQPSTSLATSGNALALAIANPGALGTIDAYISAVNRLPVLSAERETELGRRLRDQEDLGAARELILSHLRLVVSVARQYLGYGLPHADLIQEGNVGLMKAVKRFDPERGVRLVSFAVHWIKAEIHEYIIRNWRLVKVATTKAQRKLFFNLRSMRPDGQTLDPEQVEHIARELNVRREDVSEMEVRLSGRDMSLENQDDDDDSYAPIAYLSDDGRQEPTRVLERAARDQLQGSGLSDALEALDPRSRRIVEARWLQDDGGATLHELAQEFGVSAERIRQIEAAALKKMRGNLAA
>NZ_CP054569.1|WP_062685496.1|5784298_5785138_+|3',5'-cyclic-AMP-phosphodiesterase
MARIHSLTRRDDAPAMLVQVTDSHLFGEAGTAMLGVDTDASLRAVLRQIEADGRHPDLLLATGDLSQDGEAQAYRRFASILSEAPALDRACVRCLPGNHDLPAVMRQELAEWSAPVTDVGAWRVVTLDTTVPGSNAGHLPDSQLDMLEAALAAAPGRHTLVAMHHNPMQIDSHWHDTMMIDNPQALFKLLTHWPQVRVLLWGHVHHEFDRRRHNLRMLATPSTCFQFSIRDGKHVVDNMAPGYRWIKLYQDGSMATGVRRVQDALWHPALAASAKAQAA
>NZ_CP054569.1|WP_174717147.1|5780567_5781380_+|NUDIX-domain-containing-protein
MPQQLSDLYAALCARAQEPAPDGARALYIAGRRCGWATHAACDALRGAAGIDADGEALRIGSGMEPGAELDGLLELAAELLREANCLRGWRDELLDVMDGDEPLGVIERAAVRPLGLLTKAVHLNAWTPDGRLWVARRALSKSTDPGMWDTLVGGLAGSREDLEWALVRECGEEAGLDEPDLARRSPLRTILRIHRRLPEGYQVEDVLTSTCVLALDARPANRDGEVMEIATVDVATAVRRIADGEFTLEAALVIVEDIMQRRAAGEIPA
>NZ_CP054569.1|WP_174717146.1|5779120_5780278_-|cytochrome-c-oxidase-subunit-II
MKKWRGILGACAMLIGSVAGAQVRDMPGGPKVNQLNLHEGVTAISRDIMWLHWMLLTICIVIFIGVFGVMFYSIWAHRKSRGHKAATFHEHLGVEVAWTVIPFIIVIAMALPATKTVVAMKDTSSADVTVKVTGYQWKWGYEYLDGPAAGIKFLSTLSTPRAQIENREPKGEFYLMEVDNHLVVPVNKKVRIVLTAADVIHSWMIPDFGVKQDAIPGFLRDTWFNADKPGIYRGQCAELCGKDHAFMPIVVEVLAQADYDKWVEDQKKKMAATADDPNKEWTEAELVARGEKVFAANCVACHQANGKGIPGSFPPLDGDKVVLGPKAEQINTVLKGKPGTAMAPFGGQLNDVEIAAVISYTRHAWSNAGKGQDPTVLPKDVMAAR
>NZ_CP054569.1|WP_062685492.1|5777407_5779015_-|cytochrome-c-oxidase-subunit-I
MSSVTVDHVSPGHGHGHDDHHHAIPTGWRRWLFATNHKDIGTMYLIFSFVMLLEGGTLALLLRTELFEPGLQFFRPELFNQFTTMHGLVMVFGAVMPAFVGFANWMIPMQIGASDMAFARMNNFSFWLLPVAAIMLTASFFVPGGATAAGWTLYAPLSLQMGPGMDLAIFALHIMGASSIMGAINIIVTVLNMRAPGLTLMKMPLFCWTWLITAFLLLAVMPVLAAAITMVLTDRHFGTGFFNAAAGGDPVLYQHVFWFFGHPEVYIMILPAFGIVSAIVPAFARKKLFGYASMVYATASIAVLSFIVWAHHMFTTGMPVTGQLYFMYATMLISIPTGVKVFNWVATMWRGSMTFETPMLFSIGFIFVFTMGGFTGLILSVAPIDIQVHDTYYVVAHFHYVLVAGSLFALFAGAYYWVPKWTGRMYSEKLGKLHFWSTLISFNVTFFPMHFLGLAGMPRRYADYAGQFTTFHQMATIGAFWFGLSQLIFLWAMIRCYRGKGDVASAKPWEGAEGLEWTVPSPAPFHTFETPPEVK
>NZ_CP054569.1|WP_013390978.1|5777016_5777241_-|DUF2970-domain-containing-protein
MSDDLRETSQRKLSFLQTMKAVAWGFFGVRKGAGHREDVAKLNPVHVIVAGLLAAAIFVTVLVLIVRWAVSSLT
>NZ_CP054569.1|WP_062685491.1|5776102_5776978_-|cytochrome-c-oxidase-subunit-3
MSASHSVQGKEAPYYFVPADSGHPVRTAVALLFMGLGAAGWINGVSWAKWSLLAGFIGLIVVLYFWFGDAIQESEAGLNSKRIDGSYRWGMSWFIFSEVMFFAAFFGALWYTRTITTPWLGDMDHRLMLWPDFQAVWPNFGPAGVVEHFQTVGPFWLPTINTALLLSSGVTLTIAHHALRENHRGKTIFWLLATVILGFVFVTCQAYEYHHAYTELNLKFNSGAYGSLFYMLTGFHGFHVLLGATMLTVILIRLIRGHFTADHHFGFEGAAWYWHFVDVVWLGLYLFVYWF
>NZ_CP054569.1|WP_006224570.1|5775820_5776021_+|twin-transmembrane-helix-small-protein
MRVFVVLAFIGILASLASALVYLMRDKGTTSRTVNALTVRIGLSVALFLFVLFAHHMGWIESTGLR
>NZ_CP054569.1|WP_062685490.1|5774962_5775784_-|SURF1-family-protein
MARPHSTRYTVAALLLLGAAVMILASLGQWQLRRGDERRAILAAIEAGRKQAPLQLTPATDPAAMTAWRAAQATGVWLPQFSVLLDNRNQDGKPGYWLATPLLLDADARRAVLVLRGWLPRALPTPGQVPGQGPAQPSLPAAPEGPQTVTGELSLRVPRLFEIWSLGGSDQSVLPAALPVAGGAVPQVQNLPLDAYAQATGLTLLPTVLLQSGSGADDGLVRDWPQPSVDFQQNTSYAVQWFAFASIAAIAWLVVLGGAIRRMRRHESGGPRA
>NZ_CP054569.1|WP_174717145.1|5774291_5774921_-|hypothetical-protein
MARDLSSTQPARKRSLMPMLLVFLCSLAPIVAAVVVYMNPQWWPADSSNYGTLVNPQRPMPAAGELRLTTLDGKPFDLQSLKGKWLLVVADGGDCPESCARKLFITRNSHASQGKNVDRLARVWFITDDAPVPDKVLEAYKGTVMVRANPDQLARFLLARDGAAGQPGLQDPIWVIDPLGNLMMQYPAEADGVKVRKDISKLVYNSRIG
>NZ_CP054569.1|WP_088147446.1|5786995_5787685_-|hypothetical-protein
MINGIAPFVWILLGAVVVLLPGIVMLLGRGGPRDERGRKMFQFRPVRRLFGLMLVLLGCVSGLLALSLVQFFRLTTDEPVARIEVRQQAEGQFEVEASAPGTGTRQYVLYGDQWQIDARVVRWKVPALMAGVPPLYRLERLSGRYSDAAREASATRSVHALDDWPAPDLGSLKKNFPNWFPFVDVQFGSGAYMPLFDGARYQVFLDPRGALFIRPDGEATAEGLKRLGW
>NZ_CP054569.1|WP_174717148.1|5787745_5788612_-|S-formylglutathione-hydrolase
MAVALELISQHRCFGGWQRYYRHESAEIGLPMRFSVYVPPQAEQGPVPVLFYLAGLTCTEETFMIKAGAQRLAAELGVMLVAPDTSPRGANAPNEDESWDLGTGAGFYVDATTSDWRAHYRMYSYVTEELHGIVTGEDLPGDASRTGIFGHSMGGHGALVLALRNPGKFRSVSAFAPIAAPSLCPWGKKAFTAYLGSNEQDWAAYDASALMRLAQRPFPGGILIDQGESDQFLAEQLYPEVFEAACAEAGQPLTLRRHGGYDHGYYFISTFIEDHIRFHVERLGKPAA
>NZ_CP054569.1|WP_062684302.1|5788845_5789586_+|hypothetical-protein
MARLPRLYAPGLPQLVQANFIQPLAAPSQPAPADILNQLATWLGESAQRHRVSVHGWLLANDRILLLATPADEEGLPRLMQTLGRNLAARLRGGRVFAGRYRSALLEPGAWVLPALVWLETYPVRSGASQDPDSWPWSSAASHTGNTTAAPAQWQSDHADYWACGNTPFDRQANYRKRLQDGLSREESQRIDQAVSGQWALGGPSFIASLAHTASRRVAPGQRGRPRKKPAAPAPADAEPSSTPNT
>NZ_CP054569.1|WP_088446463.1|5789994_5794734_+|glutamate-synthase-subunit-alpha
MPQNTQIESCPPPKATPIDASRIGLPSAQGLYHPKNEHDACGVGFVAHIKGKKSHAIIQQGLKILENLDHRGAVGADKLMGDGAGILIQIPDTLYRDELSQQGIILPPPGEYGVAMVFLPKETASRLACEQELERSVRAEGQVVLGWRNVPVDVDMPMSPAVRACEPVIRQLFIGRGADVMVPDALERKLYVIRKTASHAIQNMHLAHGKEYFVPSASVRTVVYKGLLLADQVGRYYRDLADPRTVSALALVHQRFSTNTFPAWPLAHPYRMIAHNGEINTVKGNFNWLRAREGMMQSAVLGDDLKKLYPIVYEGQSDTATFDNCLELLVNSGYSLAHAMMMMIPEAWEQHTQMDESRRAFYEYHAAMMEPWDGPAAVAFTDGRQIGATLDRNGLRPARYLVTDDDMVILASEAGTLSIPENRIVKKWRLQPGKMFLIDLEQGRIIDDAEIKLQLANSRPYRQWIERLQIKLESLPAPRQAAVATQSSVSLLDRQQAFGWTQEDYKFILEPMAASGEEVIGSMGNDAPLAVLSDRAKPFYNYFRQLFAQVTNPPIDPIREQLVMSLVSFIGPKPNLLDINNVNPPLRLEVSQPVLDFAAMAQIRDIEQVTGKKFRSFELDITYPAAWGPEGIEARVAALCARAVDAVRSGYNILIVSDRLVDSERVAIPALLATSAVHQHLIRAGLRTNTGLVVETGSAREVHHFALLGGYGAEAIHPYLALESLGKMNDPEKAVKNFIKAIGKGLNKVMSKMGISTYMSYTGAQIFEAVGLQSALVNKYFTGTSSNIEGIGIFQVAEEALRQHRAAFGTDPVLANDLDAGGEYAYRVRGEEHMWTPDSIAKLQHASRANNYRTYKEYAQIINDQSRRHMTLRGLFEFRFDPSRAIPLDDVEPAKEIVKRFATGAMSLGSISTEAHSVLAVAMNRIGGKSNTGEGGEDELRYRTEMREGKSTIKDGDTLASVLGSDRIEADVQLKKGDSLRSKIKQVASGRFGVTAEYLSSADQIQIKMAQGAKPGEGGQLPGHKVSDYIAKLRYSVPGVGLISPPPHHDIYSIEDLAQLIHDLKNVNAKASVSVKLVSEVGVGTVAAGVAKAKADHVVIAGHDGGTGASPVSSIKHVGTPWELGLAETQQTLVLNRLRSRIRVQADGQMKTGRDVVIGALLGADEFGFATAPLVVEGCIMMRKCHLNTCPVGVATQDPVLRQKFQGKPEHVVNFFFFIAEEVREIMAQLGIRKFDDLIGRADLLDMRSGVEHWKAQGLDFARVFHQTQSDADVRQTEEQDHGLAGALDHQLIERSKPALERGEKVSFIVPVRNRNRTIGAMLSGAVASRYGHDGLPDDTIHIQCNGTAGQSFGAFLAHGITMDLVGEGNDYVGKGLSGGRIIVRSPNDFRGFGPDHIIAGNTVLYGALAGEAFFNGVAGERFAVRNSGAATVVEGTGDHGCEYMTGGTVVVLGATGRNFAAGMSGGVAYVWDPERTLKHRANLSMVELEPVSSHAEQLAQNGMDTWHSAQRGGERETDETILRRLVEDHFRYTGSFRAREILGDWEASRGKFVKIMPTDYRRALGEMWRAANPQQLAA
>NZ_CP054569.1|WP_088147443.1|5794742_5796209_+|glutamate-synthase-subunit-beta
MGKITGFMEYQRLQEASEAPQKRLKNWREFVLHLNDEQAKQQAARCMDCGIPFCNNGCPVNNIIPDWNDLVYKQDWKRALEVLHSTNNFPEFTGRICPAPCEAACTLNINSDAVGIKSIEHAIIDKGWAEGWVAPQVPARKTGKKVAVVGSGPAGMACAQQLARAGHSVTLFEKSDRIGGLLRYGIPDFKLEKHQIDRRISQMEAEGVEFAPSTYIGNPSDPVADGLTVRTPDSLLAEFDAVVMSGGSETPRDLPVPGRELSGVYFAMDFLRQQNKAVAGDRLTNQTLAKGKHVVVIGGGDTGSDCVGTSNRHGAASVTQFELMPQPPESENKSMTWPYWPLKMRTSSSHEEGCDRDWSVTTKLLKGSNGKVEKLVGARVEWFKDEATGQMKMREVEGSEFEIKADLVLLAMGFVSPVQTVLDAFGVDRDARGNVRANTDDYRTSVEKVFTAGDMRRGQSLVVWAIREGRQCARAVDAYLMGSSELPR
>NZ_CP054569.1|WP_062684305.1|5796402_5797041_+|outer-membrane-beta-barrel-protein
MFSLNGHIRATAIAGLIAAGTLAAPAHAHEAGDVLFKVGVTQVRPSSNNGTVLNGSVGLDVNNNVRPSFTLTYMATRNIGIELLGAWPFQHDVSGSGLGKIGSTKQLPPTLSLQWHILPDSMIQPYIGVGINYTHFFDTKAEGALKGSNLKLGDSWGVAAQLGADFKINERWFMNADIRYIDIRSKVKLDGQHIGTARIDPWVATIGVGYRF
>NZ_CP054569.1|WP_062684306.1|5797078_5797951_-|LysR-family-transcriptional-regulator
MRNLDLDALQIFKAVADQGGVARAAAHLNRVQSNVSTRLKQLEASLNAPLFRRQNRRLVLSDQGRVLLSYADRLLRLADEAQAAVRDGSPQGVLRIGTMESTAAARLPPILAAYHAAWPQVRIELVTGTSAALAAKVRNYEIEAAFVAQPFPGEGLATMDAFKEELALISPLAWDPIRSPQDLRDRSVIAFASGCSYRRILESWLSQEGMAPGKIMEFASYHAIVACVAAGSGVAIVPRSVLAVLGAEHAVRVGALSGSHGLAQTQLVWRADDDTPALQALRHKLEAPQG
>NZ_CP054569.1|WP_174717149.1|5798016_5799279_+|YbfB/YjiJ-family-MFS-transporter
MSTPIYPSASHSRSAAAQAVPAALALAAAMGIGRFAFTPVWPLMAQEAGLSLSQGGWLASANYAGYLLGALAAVAWPIRRLRGMLAASLLAVALFTLAMPLGHGLAMWCALRLAAGYASASAFICVAAWRAVPAGDPREAGASAVTYAGVGAGIALTGLACLALAAWDARADTVWMVLGGLALALSAAAWPGLRRQAAPAPARAASAAPPARLPRVIPGLALHYGAFGVGYIIPATFLPAMAKDIIPDPAIFGWAWPLFGLAAAVSCLLVPRLARGGDSVQIWRAAQASMALGMLAVAVWHHIAAVILAAVLVGGTFMVITQAGMLAARRAAGAAAPRAAALMTAAFAAGQILGPLLASWAARWGAGLPQALAASAALLALSAWRLGKITTDGNGAGHNAIASSPRAARTRTITNQESSG
>NZ_CP054569.1|WP_062684308.1|5799275_5800253_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKPLRPLIAALAAVAAFSGAAQAQSADWPAKPITMIVPYAPGGFADTRVRLLARKLGDSLGQPIVVENKAGAGGVVGTNLIARAAPDGYTIGTGNLAPMAVNPSLMKDMPYDPQKDLAPIILIENSPLVLSVNNELPVKTLADLIALAKKQPGKLSFGSSGVGGAHHLSGEMFREQAKIDIVHVPYKGGSLAATDLMGGHISMMFEMGYSALPAIQGKKIHPIAVTSAKRLDVLPDVPTMAESGLTGFESYNWQGIVAPAGTPAPIIAKLNAEFNRILKEPDVQKAIADTGSQAGGGTPEEFGAFIKSETEKWAHVIKAGNIQLQ
>NZ_CP054569.1|WP_174717150.1|5800271_5801333_+|nitronate-monooxygenase
MASRLIELLKLAHPIVQAPMAGGATTVELVSEASKAGTLGSLGAAYLSPEQIEAAAQAIRARTDRPFAINLFASVPEEPMRGDAGRMLALMARYHEQLGLPAPAEPGPQPDPLEGQIEAVLRARPAVFSFTFGRMPAAALARCRERGILTVGTATTVREAVALEQDGVDAVVAQGAEAGGHRGTFLGGFEESLIGTMALVPQVADAVSVPVIASGGIMDGRGIAAALALGADLAQMGTAFLTTEESGINEAYKAVLPASRSEQSRLTRAFSGRPARGIENAFMRDADAIAADILPYPLQNALTRPMRTAGGKAGNIHVLSLWAGQGAPLARRETTSDLVRRLARETAAAQARR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_CP009803	Streptomyces sp. FR-008 plasmid pSSFR1, complete sequence	18996-19020	3	0.88
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_CP029339	Streptomyces sp. SM17 plasmid pSM17A, complete sequence	32714-32738	3	0.88
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NC_010311	Streptomyces sp. HK1 plasmid pSHK1, complete sequence	151841-151865	3	0.88
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	223055-223079	4	0.84
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	453778-453802	4	0.84
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	205885-205909	4	0.84
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_CP026489	Streptomyces sp. 604F plasmid unnamed, complete sequence	155730-155754	4	0.84
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4452939-4452963	4	0.84
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1392582-1392606	4	0.84
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	39562-39586	4	0.84
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	MH588547	Caulobacter phage CcrSC, complete genome	287466-287490	4	0.84
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_CP047896	Sphingomonas sp. C33 plasmid pC33, complete sequence	3687-3711	4	0.84
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NC_008308	Sphingomonas sp. KA1 plasmid pCAR3 DNA, complete sequence	172905-172929	4	0.84
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	152867-152891	5	0.8
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_CP033508	Mesorhizobium jarvisii strain ATCC 700743 plasmid pMJ700743a, complete sequence	164977-165001	5	0.8
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_CP033369	Mesorhizobium loti strain SU343 plasmid pMLSU343a, complete sequence	164977-165001	5	0.8
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	919989-920013	5	0.8
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_CP016080	Mesorhizobium loti NZP2037 plasmid pML2037, complete sequence	399769-399793	5	0.8
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	475607-475631	6	0.76
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NC_020894	Streptomyces hygroscopicus subsp. jinggangensis TL01 plasmid pSHJGH1, complete sequence	139910-139934	6	0.76
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NZ_CP046102	Rhodococcus sp. AQ5-07 plasmid unnamed3, complete sequence	40849-40873	6	0.76
NZ_CP054569_6	6.1\|4774806\|25\|NZ_CP054569\|CRISPRCasFinder	4774806-4774830	25	NC_017766	Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG1, complete sequence	139911-139935	6	0.76

1. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_CP009803 (Streptomyces sp. FR-008 plasmid pSSFR1, complete sequence) position: , mismatch: 3, identity: 0.88

attggcgtcgccttcgacctgctgg	CRISPR spacer
catgtcgtcgccttcgacctgctgg	Protospacer
  ** ********************

2. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_CP029339 (Streptomyces sp. SM17 plasmid pSM17A, complete sequence) position: , mismatch: 3, identity: 0.88

attggcgtcgccttcgacctgctgg	CRISPR spacer
catgtcgtcgccttcgacctgctgg	Protospacer
  ** ********************

3. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NC_010311 (Streptomyces sp. HK1 plasmid pSHK1, complete sequence) position: , mismatch: 3, identity: 0.88

attggcgtcgccttcgacctgctgg	CRISPR spacer
catgtcgtcgccttcgacctgctgg	Protospacer
  ** ********************

4. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 4, identity: 0.84

attggcgtcgccttcgacctgctgg	CRISPR spacer
attggtgtcgccttcgacctgcaac	Protospacer
*****.**************** .

5. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 4, identity: 0.84

attggcgtcgccttcgacctgctgg	CRISPR spacer
cacggcgtcgccttcgagctgctgg	Protospacer
  .************** *******

6. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 4, identity: 0.84

attggcgtcgccttcgacctgctgg	CRISPR spacer
attggtgtcgccttcgacctgcaac	Protospacer
*****.**************** .

7. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_CP026489 (Streptomyces sp. 604F plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

attggcgtcgccttcgacctgctgg	CRISPR spacer
cacgtcgtcgccttcgacctgctgg	Protospacer
  .* ********************

8. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.84

attggcgtcgccttcgacctgctgg	CRISPR spacer
agcggcgtcgccttcgacgtgctgc	Protospacer
* .*************** *****

9. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 4, identity: 0.84

attggcgtcgccttcgacctgctgg	CRISPR spacer
gattgcgtcgccttcgacctgcggg	Protospacer
. * ****************** **

10. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 4, identity: 0.84

attggcgtcgccttcgacctgctgg	CRISPR spacer
ggtgacgtcgccttcgagctgctgg	Protospacer
. **.************ *******

11. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to MH588547 (Caulobacter phage CcrSC, complete genome) position: , mismatch: 4, identity: 0.84

attggcgtcgccttcgacctgctgg	CRISPR spacer
cttggcgtggccttcgccctgctgt	Protospacer
 ******* ******* *******

12. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_CP047896 (Sphingomonas sp. C33 plasmid pC33, complete sequence) position: , mismatch: 4, identity: 0.84

attggcgtcgccttcgacctgctgg	CRISPR spacer
cttggcatcgccttcgacttgctgc	Protospacer
 *****.***********.*****

13. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NC_008308 (Sphingomonas sp. KA1 plasmid pCAR3 DNA, complete sequence) position: , mismatch: 4, identity: 0.84

attggcgtcgccttcgacctgctgg	CRISPR spacer
attggcttcggcttcgacctgctca	Protospacer
****** *** ************ .

14. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.8

attggcgtcgccttcgacctgctgg	CRISPR spacer
tccttcgtcgccttcgacctgctgg	Protospacer
 ..  ********************

15. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_CP033508 (Mesorhizobium jarvisii strain ATCC 700743 plasmid pMJ700743a, complete sequence) position: , mismatch: 5, identity: 0.8

attggcgtcgccttcgacctgctgg	CRISPR spacer
tatttcgtcgccttcgacctgctgc	Protospacer
  *  *******************

16. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_CP033369 (Mesorhizobium loti strain SU343 plasmid pMLSU343a, complete sequence) position: , mismatch: 5, identity: 0.8

attggcgtcgccttcgacctgctgg	CRISPR spacer
tatttcgtcgccttcgacctgctgc	Protospacer
  *  *******************

17. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 5, identity: 0.8

attggcgtcgccttcgacctgctgg	CRISPR spacer
gggcgcatcgccttcgacctgctgg	Protospacer
.   **.******************

18. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_CP016080 (Mesorhizobium loti NZP2037 plasmid pML2037, complete sequence) position: , mismatch: 5, identity: 0.8

attggcgtcgccttcgacctgctgg	CRISPR spacer
tatttcgtcgccttcgacctgctgc	Protospacer
  *  *******************

19. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 6, identity: 0.76

attggcgtcgccttcgacctgctgg	CRISPR spacer
gcctacgtcgccttcgacctgctga	Protospacer
... .*******************.

20. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NC_020894 (Streptomyces hygroscopicus subsp. jinggangensis TL01 plasmid pSHJGH1, complete sequence) position: , mismatch: 6, identity: 0.76

attggcgtcgccttcgacctgctgg	CRISPR spacer
cactacgtcgccttcgacctgctgt	Protospacer
  . .*******************

21. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NZ_CP046102 (Rhodococcus sp. AQ5-07 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.76

attggcgtcgccttcgacctgctgg	CRISPR spacer
tgcatcgtcgccttcgacctgctga	Protospacer
  .. *******************.

22. spacer 6.1|4774806|25|NZ_CP054569|CRISPRCasFinder matches to NC_017766 (Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG1, complete sequence) position: , mismatch: 6, identity: 0.76

attggcgtcgccttcgacctgctgg	CRISPR spacer
cactacgtcgccttcgacctgctgt	Protospacer
  . .*******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1867 : 56385

Pseudomonas_phage(23.53%)

capsid,tail,tRNA,portal,head,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_174715470.1\|1867_2239_+\|portal	phage portal protein	A0A142K630	Streptomyces_phage	9.6e-07	36.8
WP_174715471.1\|2238_3093_+\|portal	phage portal protein	Q8HAD4	Salmonella_phage	2.4e-69	50.2
WP_174715472.1\|3094_3730_+\|head,protease	HK97 family phage prohead protease	Q8W628	Enterobacteria_phage	7.3e-47	48.8
WP_174715473.1\|3795_4986_+\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	1.2e-119	53.8
WP_174715474.1\|5036_5618_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_174717453.1\|5655_5988_+\|head	phage head closure protein	NA	NA	NA	NA
WP_174715475.1\|5991_6486_+	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_174715476.1\|6478_6832_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_174715477.1\|6828_7269_+	hypothetical protein	NA	NA	NA	NA
WP_174715478.1\|7372_8026_+\|tail	phage tail protein	A0A0H5BBY3	Pseudomonas_phage	5.5e-58	52.6
WP_174715479.1\|8097_8418_+	hypothetical protein	A0A0S2SYT8	Pseudomonas_phage	2.8e-23	46.2
WP_174717454.1\|8414_8726_+	DUF1799 domain-containing protein	A0A2H4JBP7	uncultured_Caudovirales_phage	1.7e-12	40.7
WP_174715480.1\|8762_14369_+\|tail	phage tail length tape measure family protein	A0A1V0E8B0	Vibrio_phage	1.2e-68	40.7
WP_174715481.1\|14365_15256_+	hypothetical protein	NA	NA	NA	NA
WP_174715482.1\|15257_16097_+	hypothetical protein	NA	NA	NA	NA
WP_174715483.1\|16309_16537_+	hypothetical protein	NA	NA	NA	NA
WP_174717455.1\|16620_17064_+	hypothetical protein	Q6TM82	Pseudomonas_phage	3.7e-13	38.0
WP_174715484.1\|17066_17564_+	hypothetical protein	A0A2H4JFP9	uncultured_Caudovirales_phage	4.7e-49	64.3
WP_174715485.1\|17547_17814_+	hypothetical protein	NA	NA	NA	NA
WP_174715486.1\|18035_18266_+	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
WP_174715487.1\|18346_18784_-	hypothetical protein	NA	NA	NA	NA
WP_080551133.1\|19365_19668_+	hypothetical protein	NA	NA	NA	NA
WP_174715488.1\|19651_19936_+	hypothetical protein	NA	NA	NA	NA
WP_174715489.1\|20019_20175_-	hypothetical protein	NA	NA	NA	NA
WP_174715490.1\|20298_20886_-	GNAT family N-acetyltransferase	A0A0B5CYP1	Listeria_phage	2.8e-08	28.4
WP_088446812.1\|21551_22943_-	uracil-xanthine permease	H9YQ34	environmental_Halophage	6.3e-27	50.8
WP_174715491.1\|23163_25062_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	6.9e-117	37.4
WP_174715492.1\|25245_26130_+	DUF2520 domain-containing protein	NA	NA	NA	NA
WP_123786635.1\|26332_27373_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_125283285.1\|27429_28407_+	SMP-30/gluconolactonase/LRE family protein	NA	NA	NA	NA
WP_174715493.1\|28424_30539_-	acetate--CoA ligase family protein	NA	NA	NA	NA
WP_062680063.1\|30556_31552_-	acryloyl-CoA reductase	NA	NA	NA	NA
WP_088146631.1\|31570_32740_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_174715494.1\|32743_33712_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_088146633.1\|33729_34713_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_174715495.1\|34772_35939_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_174715496.1\|36131_36929_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_088146635.1\|36918_37692_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_174715497.1\|37849_39049_+	MFS transporter	NA	NA	NA	NA
WP_062680055.1\|39154_40465_-	MFS transporter	NA	NA	NA	NA
WP_062680054.1\|40497_41646_-	galactonate dehydratase	Q6A202	Oenococcus_phage	3.3e-58	37.0
WP_062680053.1\|41642_42296_-	2-dehydro-3-deoxy-6-phosphogalactonate aldolase	NA	NA	NA	NA
WP_174715498.1\|42305_43313_-	2-dehydro-3-deoxygalactonokinase	NA	NA	NA	NA
WP_174715499.1\|43620_44439_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_174715500.1\|44470_45421_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_174715501.1\|45514_46990_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_174715502.1\|46995_48018_+	NAD-dependent epimerase/dehydratase family protein	A0A2H4UUK0	Bodo_saltans_virus	1.1e-25	26.9
WP_174715503.1\|48153_49113_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_174715504.1\|49122_49743_-	glutathione S-transferase	NA	NA	NA	NA
WP_174715505.1\|49760_50339_-	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	2.0e-06	29.8
WP_174715506.1\|50437_50701_-	hypothetical protein	NA	NA	NA	NA
WP_062680048.1\|50702_51545_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_088146642.1\|51651_53058_+	signal recognition particle protein	NA	NA	NA	NA
WP_062680046.1\|53296_53743_-	peptidoglycan-binding protein LysM	G3MBQ1	Bacillus_virus	8.8e-07	47.9
WP_088146643.1\|53786_54104_-	hypothetical protein	NA	NA	NA	NA
WP_056559414.1\|54399_54600_-	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_062680044.1\|54613_55552_-	prolyl aminopeptidase	NA	NA	NA	NA
WP_174715507.1\|55551_56385_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA

DBSCAN-SWA_2

584138 : 659269

Pseudomonas_phage(34.21%)

plate,integrase,tail,transposase,head,protease

attL 603985:604002|attR 638366:638383

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_174715674.1\|584138_584921_-	hypothetical protein	J9SNQ5	Pseudomonas_phage	3.5e-06	57.4
WP_174715675.1\|585532_586144_-	regulatory protein GemA	A4JWM5	Burkholderia_virus	6.8e-26	48.9
WP_174715676.1\|586145_586844_-	DUF2786 domain-containing protein	L7P7W8	Pseudomonas_phage	3.5e-26	35.9
WP_174715677.1\|586885_587278_-	hypothetical protein	NA	NA	NA	NA
WP_174715678.1\|587454_587721_-	hypothetical protein	NA	NA	NA	NA
WP_174715679.1\|587722_588535_-	DUF3164 family protein	A0A0A1IVF8	Pseudomonas_phage	7.9e-54	54.0
WP_174715680.1\|588543_588906_-	hypothetical protein	NA	NA	NA	NA
WP_174715681.1\|588907_589189_-	hypothetical protein	NA	NA	NA	NA
WP_174715682.1\|589178_589481_-	hypothetical protein	NA	NA	NA	NA
WP_174715683.1\|589471_590662_-	AAA family ATPase	Q6QIE1	Burkholderia_phage	7.2e-88	47.4
WP_174715684.1\|590671_592477_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q6QIE0	Burkholderia_phage	7.6e-158	49.0
WP_174715685.1\|592487_593369_-	DUF3102 domain-containing protein	Q5ZR03	Pseudomonas_phage	2.3e-38	37.5
WP_174715686.1\|593374_593605_-	hypothetical protein	NA	NA	NA	NA
WP_174715687.1\|593601_593907_-	helix-turn-helix domain-containing protein	Q5ZR02	Pseudomonas_phage	1.2e-23	58.0
WP_174715688.1\|593903_594107_-	hypothetical protein	NA	NA	NA	NA
WP_174715689.1\|594103_594355_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_174715690.1\|594461_594917_+	helix-turn-helix transcriptional regulator	A0A2H4JFL3	uncultured_Caudovirales_phage	2.7e-11	37.5
WP_174715691.1\|594913_595597_+	hypothetical protein	NA	NA	NA	NA
WP_174715692.1\|595714_596098_+	hypothetical protein	Q6QIC8	Burkholderia_phage	3.2e-29	58.3
WP_174715693.1\|596097_596727_+	transglycosylase SLT domain-containing protein	Q6QIC7	Burkholderia_phage	1.7e-64	62.8
WP_174715694.1\|596723_597158_+	hypothetical protein	NA	NA	NA	NA
WP_174715695.1\|597269_597662_+	hypothetical protein	Q5ZQY8	Pseudomonas_phage	5.5e-37	60.3
WP_174715696.1\|597651_597960_+	hypothetical protein	Q5ZQY7	Pseudomonas_phage	1.2e-47	85.3
WP_174715697.1\|597963_598542_+	DUF3486 family protein	Q5ZQY6	Pseudomonas_phage	1.2e-53	64.4
WP_174715698.1\|598538_598814_+	hypothetical protein	NA	NA	NA	NA
WP_174715699.1\|600636_602238_+	DUF935 domain-containing protein	L7P7P3	Pseudomonas_phage	4.4e-125	47.2
WP_174715700.1\|602239_603514_+	hypothetical protein	A0A2P1A4D1	Alteromonadaceae_phage	3.6e-53	37.4
WP_174715701.1\|603706_604801_+\|protease	phage protease	A0A0M5N0Q6	Ralstonia_phage	2.7e-49	42.5
603985:604002	attL	NA	NA	NA	NA
WP_174715702.1\|604842_605253_+	hypothetical protein	J9RWG0	Pseudomonas_phage	5.8e-37	61.4
WP_174715703.1\|605291_606182_+\|head	Mu-like prophage major head subunit gpT family protein	A0A0M4UKB9	Ralstonia_phage	1.3e-89	55.1
WP_174715704.1\|606238_606496_+	hypothetical protein	NA	NA	NA	NA
WP_174715705.1\|606640_607147_+	DUF1320 family protein	B7SDP4	Haemophilus_phage	6.1e-12	42.2
WP_174715706.1\|607146_607737_+	phage virion morphogenesis protein	NA	NA	NA	NA
WP_174715707.1\|607726_608350_+	hypothetical protein	NA	NA	NA	NA
WP_174715708.1\|608365_608578_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_174715709.1\|608594_610067_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A2I7S9H0	Vibrio_phage	1.3e-94	41.9
WP_174715710.1\|610079_610433_+\|tail	phage tail tube protein	NA	NA	NA	NA
WP_174715711.1\|610466_610766_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_174715712.1\|610905_613071_+\|tail	phage tail tape measure protein	B5TAA4	Burkholderia_phage	1.5e-43	32.0
WP_174715713.1\|613123_614332_+	DNA circularization N-terminal domain-containing protein	A0A2P9JZK2	Alteromonadaceae_phage	1.0e-36	31.8
WP_174715714.1\|614331_615453_+	hypothetical protein	A0A2P9JZK3	Alteromonadaceae_phage	3.9e-43	33.5
WP_174715715.1\|615449_615995_+\|plate	phage baseplate assembly protein	Q8SBG6	Shigella_phage	2.9e-20	47.7
WP_174715716.1\|616053_616536_+	phage GP46 family protein	A0A0C4UR04	Shigella_phage	1.7e-19	44.8
WP_174715717.1\|616537_617593_+\|plate	baseplate J/gp47 family protein	A0A0C4UQU9	Shigella_phage	1.9e-44	34.3
WP_174715718.1\|617580_618183_+	DUF2313 domain-containing protein	A0A192Y5V3	Salmonella_phage	4.1e-23	36.7
WP_174717471.1\|618233_619097_+\|tail	phage tail protein	A0A0A8J8U5	Ralstonia_phage	2.4e-32	37.9
WP_174715719.1\|619842_620145_-	hypothetical protein	NA	NA	NA	NA
WP_174715720.1\|620137_620371_-	hypothetical protein	NA	NA	NA	NA
WP_174715721.1\|620427_620799_+\|tail	phage tail protein	A0A0U4JEJ6	Pseudomonas_phage	5.6e-07	35.1
WP_174717472.1\|620934_621726_+	DNA adenine methylase	Q5ZQW7	Pseudomonas_phage	2.7e-123	76.6
WP_174715722.1\|621685_622708_-\|integrase	tyrosine-type recombinase/integrase	W6MYA3	Pseudomonas_phage	1.1e-33	37.4
WP_174715465.1\|622795_622933_-	hypothetical protein	NA	NA	NA	NA
WP_062684480.1\|623087_623597_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_088145732.1\|623575_624589_+	FecR family protein	NA	NA	NA	NA
WP_174715723.1\|624709_627328_+	TonB-dependent hemoglobin/transferrin/lactoferrin family receptor	NA	NA	NA	NA
WP_062684477.1\|627391_628438_+	hemin-degrading factor	NA	NA	NA	NA
WP_088145734.1\|628448_629282_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_125284689.1\|629325_630273_+	iron ABC transporter permease	NA	NA	NA	NA
WP_062684474.1\|630269_631058_+	heme ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	5.0e-05	25.4
WP_062684473.1\|631127_631610_+	YajQ family cyclic di-GMP-binding protein	NA	NA	NA	NA
WP_075873460.1\|631720_632626_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_062684472.1\|632639_634085_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_082775894.1\|634227_634776_+	methylated-DNA--[protein]-cysteine S-methyltransferase	NA	NA	NA	NA
WP_062684471.1\|634859_635945_+	tartrate dehydrogenase	NA	NA	NA	NA
WP_062684470.1\|636034_637015_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_062684469.1\|637018_637624_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_088148831.1\|637715_638144_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	1.5e-48	64.3
WP_174715724.1\|639764_641966_-	TonB-dependent receptor	NA	NA	NA	NA
638366:638383	attR	NA	NA	NA	NA
WP_174715725.1\|642127_642541_-	DUF2946 family protein	NA	NA	NA	NA
WP_062684464.1\|642577_643276_-	urea ABC transporter ATP-binding subunit UrtE	F2Y2R6	Organic_Lake_phycodnavirus	2.8e-15	29.5
WP_062684463.1\|643277_644117_-	urea ABC transporter ATP-binding protein UrtD	A0A2R8FG22	Brazilian_cedratvirus	8.0e-09	25.0
WP_062684462.1\|644113_645241_-	urea ABC transporter permease subunit UrtC	NA	NA	NA	NA
WP_174715726.1\|645237_646869_-	urea ABC transporter permease subunit UrtB	NA	NA	NA	NA
WP_062684460.1\|646881_648135_-	urea ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_174715727.1\|648495_650328_+	allophanate hydrolase	NA	NA	NA	NA
WP_174715728.1\|650356_653995_+	urea carboxylase	NA	NA	NA	NA
WP_062685560.1\|653991_654723_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_123786863.1\|654733_655549_-	anti-sigma factor	NA	NA	NA	NA
WP_062685562.1\|655550_656063_-	RNA polymerase sigma factor	A0A076YQ50	Rhizobium_phage	2.5e-05	25.6
WP_125284279.1\|656094_656463_-	hypothetical protein	NA	NA	NA	NA
WP_125284278.1\|656553_657006_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_062685565.1\|657092_657569_-\|transposase	transposase	NA	NA	NA	NA
WP_123786589.1\|658288_659269_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	2.7e-24	30.7

DBSCAN-SWA_3

1854078 : 1897241

Burkholderia_phage(34.38%)

terminase,plate,integrase,capsid,tail

attL 1853919:1853938|attR 1896395:1896414

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1853919:1853938	attL	NA	NA	NA	NA
WP_174716072.1\|1854078_1855062_+\|integrase	site-specific integrase	A0A1B1P9F9	Acinetobacter_phage	5.2e-60	38.9
WP_174716073.1\|1855035_1855278_-	hypothetical protein	NA	NA	NA	NA
WP_174716074.1\|1855278_1855452_-	hypothetical protein	NA	NA	NA	NA
WP_174716075.1\|1855448_1855805_-	hypothetical protein	NA	NA	NA	NA
WP_174716076.1\|1856629_1856884_-	hypothetical protein	C9DGD3	Deftia_phage	2.1e-13	46.5
WP_174716077.1\|1856883_1857441_-	hypothetical protein	NA	NA	NA	NA
WP_174716078.1\|1857553_1858057_-	hypothetical protein	NA	NA	NA	NA
WP_174716079.1\|1858138_1858663_-	hypothetical protein	NA	NA	NA	NA
WP_174716080.1\|1858700_1859741_-	hypothetical protein	A0A2H4JAZ0	uncultured_Caudovirales_phage	4.2e-68	48.0
WP_174716081.1\|1859755_1860655_-	PD-(D/E)XK nuclease-like domain-containing protein	V5YTC9	Pseudomonas_phage	1.3e-41	35.5
WP_174716082.1\|1860651_1861014_-	hypothetical protein	NA	NA	NA	NA
WP_174716083.1\|1861015_1861201_-	hypothetical protein	NA	NA	NA	NA
WP_174716084.1\|1861202_1861529_-	hypothetical protein	NA	NA	NA	NA
WP_174716085.1\|1861682_1862051_-	hypothetical protein	NA	NA	NA	NA
WP_174716086.1\|1862053_1862452_-	hypothetical protein	NA	NA	NA	NA
WP_174716087.1\|1862491_1863406_-	pentapeptide repeat-containing protein	A0A2P9HXG2	Yersinia_phage	6.7e-09	59.2
WP_174716088.1\|1863913_1864507_-	Rha family transcriptional regulator	A0A1B0VMK9	Pseudomonas_phage	3.4e-14	44.8
WP_174716089.1\|1864503_1864677_-	hypothetical protein	NA	NA	NA	NA
WP_174716090.1\|1864781_1865561_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_174716091.1\|1865641_1866070_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_174716092.1\|1866143_1866371_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_174715466.1\|1866424_1866598_-	hypothetical protein	NA	NA	NA	NA
WP_174716093.1\|1866711_1866975_+	DNA-binding protein	NA	NA	NA	NA
WP_174716094.1\|1866977_1867385_+	recombination protein NinB	A0A0H5AUD0	Pseudomonas_phage	1.8e-27	59.6
WP_174716095.1\|1867384_1868023_+	hypothetical protein	A0A2I7R856	Vibrio_phage	1.5e-28	35.1
WP_174716096.1\|1868845_1869616_+	hypothetical protein	Q5QF86	Pseudomonas_virus	1.3e-21	37.7
WP_174716097.1\|1869612_1870089_+	hypothetical protein	NA	NA	NA	NA
WP_174716098.1\|1871094_1871475_+	hypothetical protein	NA	NA	NA	NA
WP_174717502.1\|1871474_1871681_+	hypothetical protein	NA	NA	NA	NA
WP_174716099.1\|1871677_1872127_+	hypothetical protein	NA	NA	NA	NA
WP_174716100.1\|1872657_1873239_+\|terminase	terminase small subunit	U5PZD3	Bacillus_phage	2.9e-26	40.1
WP_174717503.1\|1873303_1874641_+\|terminase	phage terminase large subunit	J7I460	Acinetobacter_phage	6.9e-148	59.1
WP_174716101.1\|1874637_1876173_+	DUF1073 domain-containing protein	A0A0F6WD88	Pseudomonas_phage	1.7e-102	47.4
WP_174717504.1\|1876084_1876945_+\|capsid	minor capsid protein	Q6IWU3	Burkholderia_phage	1.1e-45	38.2
WP_174716102.1\|1876925_1878182_+	DUF2213 domain-containing protein	Q6IWU4	Burkholderia_phage	8.5e-39	40.1
WP_174716103.1\|1878178_1878658_+	hypothetical protein	NA	NA	NA	NA
WP_174716104.1\|1878678_1879761_+	DUF2184 domain-containing protein	Q6IWU6	Burkholderia_phage	1.2e-54	34.4
WP_174716105.1\|1879820_1880171_+	hypothetical protein	Q6IWU7	Burkholderia_phage	1.6e-08	35.2
WP_174716106.1\|1880172_1880601_+	DUF4054 domain-containing protein	A0A088C3T8	Shewanella_sp._phage	4.0e-17	36.2
WP_174716107.1\|1880597_1881074_+	hypothetical protein	Q6IWU9	Burkholderia_phage	7.4e-20	41.4
WP_174716108.1\|1881070_1881439_+	hypothetical protein	NA	NA	NA	NA
WP_174716109.1\|1881435_1881963_+	hypothetical protein	NA	NA	NA	NA
WP_174716110.1\|1881973_1883482_+	DUF3383 domain-containing protein	I7B2P4	Escherichia_phage	2.8e-73	37.0
WP_174716111.1\|1883612_1884122_+	Rha family transcriptional regulator	A0A249XSL1	Mycobacterium_phage	1.4e-11	37.2
WP_174716112.1\|1884158_1884608_+	hypothetical protein	A0A2H4P6T4	Pseudomonas_phage	1.3e-29	45.6
WP_174716113.1\|1884617_1885061_+	hypothetical protein	Q6IWV4	Burkholderia_phage	7.4e-22	43.6
WP_174716114.1\|1885218_1885866_+	hypothetical protein	A0A221SAP1	Ralstonia_phage	3.1e-21	39.7
WP_174716115.1\|1885929_1887543_+\|tail	phage tail protein	NA	NA	NA	NA
WP_174716116.1\|1887542_1888085_+	hypothetical protein	NA	NA	NA	NA
WP_174716117.1\|1888081_1888390_+	hypothetical protein	Q6IWP9	Burkholderia_phage	3.2e-08	34.3
WP_174716118.1\|1888382_1889207_+	hypothetical protein	Q6IWQ0	Burkholderia_phage	5.9e-41	39.7
WP_174716119.1\|1889191_1889827_+	hypothetical protein	A0A2H4P6V3	Pseudomonas_phage	3.8e-27	43.5
WP_174716120.1\|1889823_1890168_+	hypothetical protein	NA	NA	NA	NA
WP_174716121.1\|1890160_1891351_+\|plate	baseplate J/gp47 family protein	Q6IWQ3	Burkholderia_phage	9.4e-64	39.3
WP_174716122.1\|1891347_1891998_+	DUF2612 domain-containing protein	Q6IWQ4	Burkholderia_phage	3.8e-43	44.2
WP_174716123.1\|1891998_1892772_+	hypothetical protein	NA	NA	NA	NA
WP_174716124.1\|1892798_1893194_+	hypothetical protein	G8DDH4	Micromonas_pusilla_virus	2.3e-06	42.4
WP_174716125.1\|1893287_1894448_+	hypothetical protein	A0A2I7RBK1	Vibrio_phage	8.1e-44	33.2
WP_174716126.1\|1894508_1894817_+	hypothetical protein	NA	NA	NA	NA
WP_174716127.1\|1894818_1895097_+	hypothetical protein	NA	NA	NA	NA
WP_174716128.1\|1895093_1895570_+	hypothetical protein	I6NSS1	Burkholderia_phage	1.3e-48	63.1
WP_174716129.1\|1895566_1895923_+	hypothetical protein	NA	NA	NA	NA
WP_174716130.1\|1896064_1896283_-	hypothetical protein	NA	NA	NA	NA
WP_157672750.1\|1896605_1897241_-	hypothetical protein	A0A2I6UFG0	Klebsiella_phage	6.2e-06	32.6
1896395:1896414	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1924925 : 1931533

Lake_Baikal_phage(16.67%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006220190.1\|1924925_1925129_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.3e-17	63.6
WP_062682780.1\|1925305_1925869_+	DUF924 family protein	A0A1V0SIY0	Klosneuvirus	8.5e-15	38.2
WP_042794090.1\|1926186_1926393_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	8.1e-16	59.7
WP_123785818.1\|1926558_1927779_+\|transposase	ISL3 family transposase	A4PE56	Ralstonia_virus	2.3e-198	82.6
WP_062682781.1\|1927838_1928384_-	TIGR00645 family protein	K4K6D8	Caulobacter_phage	1.7e-20	32.7
WP_062682782.1\|1928641_1929397_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_062682783.1\|1929564_1930875_+	trigger factor	NA	NA	NA	NA
WP_062682784.1\|1930879_1931533_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	2.6e-55	57.2

DBSCAN-SWA_5

2485246 : 2493648

Moraxella_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062682610.1\|2485246_2485831_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	3.3e-22	37.0
WP_062682555.1\|2486007_2486382_-	thioredoxin family protein	V9SJ74	Achromobacter_phage	5.5e-10	28.9
WP_062682556.1\|2486524_2487529_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_062682557.1\|2487756_2489049_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	9.3e-65	35.6
WP_062682558.1\|2489171_2490203_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	2.1e-91	51.4
WP_062682559.1\|2490393_2491032_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_062682560.1\|2491211_2491970_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	4.9e-66	50.8
WP_062682561.1\|2491954_2492779_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.3e-31	45.8
WP_062682562.1\|2492796_2493648_+	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	4.9e-14	40.2

DBSCAN-SWA_6

3800932 : 3898776

106

Vibrio_phage(13.79%)

plate,terminase,integrase,capsid,holin,tail,tRNA,portal,head,protease

attL 3813468:3813485|attR 3875760:3875776

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088146759.1\|3800932_3801943_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_088146758.1\|3802120_3803089_+	homoserine kinase	NA	NA	NA	NA
WP_174717560.1\|3803594_3804128_-	DUF192 domain-containing protein	NA	NA	NA	NA
WP_174716683.1\|3804193_3805066_-	type II secretion system F family protein	NA	NA	NA	NA
WP_062682032.1\|3805077_3805923_-	type II secretion system F family protein	NA	NA	NA	NA
WP_174716684.1\|3805919_3807608_-	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_174716685.1\|3807612_3808998_-	pilus assembly protein N-terminal domain-containing protein	NA	NA	NA	NA
WP_174716686.1\|3808994_3809852_-	Flp pilus assembly protein CpaB	NA	NA	NA	NA
WP_174717561.1\|3809848_3810367_-	hypothetical protein	NA	NA	NA	NA
WP_174716687.1\|3810612_3811227_-	pilus assembly protein	NA	NA	NA	NA
WP_174716688.1\|3811223_3812642_-	hypothetical protein	NA	NA	NA	NA
WP_062682027.1\|3812638_3812905_-	hypothetical protein	NA	NA	NA	NA
WP_075873302.1\|3813298_3814696_-	multidrug transporter subunit MdtD	NA	NA	NA	NA
3813468:3813485	attL	NA	NA	NA	NA
WP_174716689.1\|3814752_3815604_-	MaoC family dehydratase N-terminal domain-containing protein	NA	NA	NA	NA
3813468:3813485	attL	NA	NA	NA	NA
WP_174716690.1\|3815656_3816586_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_088146752.1\|3816619_3817648_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_062682023.1\|3817688_3817901_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_174716691.1\|3817897_3819265_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_174716692.1\|3819275_3820820_-	methylmalonyl-CoA carboxyltransferase	NA	NA	NA	NA
WP_062682020.1\|3820853_3821522_-	3-oxoacid CoA-transferase subunit B	NA	NA	NA	NA
WP_062682019.1\|3821511_3822198_-	3-oxoacid CoA-transferase subunit A	NA	NA	NA	NA
WP_088445878.1\|3822230_3823403_-	thiolase	NA	NA	NA	NA
WP_174716693.1\|3823399_3823795_-	OB-fold domain-containing protein	NA	NA	NA	NA
WP_123785800.1\|3824023_3824956_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_062682015.1\|3825031_3825625_-	hypothetical protein	NA	NA	NA	NA
WP_123788033.1\|3825767_3826070_-	monooxygenase	NA	NA	NA	NA
WP_174716694.1\|3826266_3826881_-	hypothetical protein	NA	NA	NA	NA
WP_123785802.1\|3827220_3827922_+	hypothetical protein	A0A1B1IY38	Phage_MedPE-SWcel-C56	2.1e-18	37.9
WP_174717562.1\|3828573_3828813_+	hypothetical protein	NA	NA	NA	NA
WP_174716695.1\|3829078_3829654_-	hypothetical protein	NA	NA	NA	NA
WP_174716696.1\|3830181_3831195_-	hypothetical protein	A0A0M4S6X1	Salmonella_phage	2.8e-77	45.9
WP_174716697.1\|3831752_3832004_+	hypothetical protein	NA	NA	NA	NA
WP_174716698.1\|3832127_3832739_-	hypothetical protein	NA	NA	NA	NA
WP_174716699.1\|3833784_3834525_+	hypothetical protein	NA	NA	NA	NA
WP_174716700.1\|3834671_3835073_-	hypothetical protein	NA	NA	NA	NA
WP_174716701.1\|3835069_3835603_-	hypothetical protein	X5KCC3	Pseudomonas_phage	1.6e-31	45.8
WP_174716702.1\|3835599_3835869_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_174716703.1\|3835879_3836233_-	hypothetical protein	NA	NA	NA	NA
WP_174716704.1\|3836311_3837334_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JE37	uncultured_Caudovirales_phage	2.4e-23	30.5
WP_123786964.1\|3837338_3837701_-\|tail	phage tail protein	A0A0U4JEJ6	Pseudomonas_phage	6.7e-05	35.8
WP_174716705.1\|3837934_3838237_+	hypothetical protein	NA	NA	NA	NA
WP_174716706.1\|3838497_3839388_-\|tail	phage tail protein	A0A0A8J8U5	Ralstonia_phage	3.1e-27	34.6
WP_054480987.1\|3839394_3839985_-	DUF2313 domain-containing protein	A0A2P9JZK7	Alteromonadaceae_phage	6.0e-27	38.1
WP_174716707.1\|3839994_3841158_-\|plate	baseplate J/gp47 family protein	B5TAA9	Burkholderia_phage	4.6e-15	26.2
WP_123786961.1\|3841159_3841612_-	phage GP46 family protein	A0A0C4UR04	Shigella_phage	3.2e-20	38.9
WP_054480993.1\|3841608_3842223_-\|plate	phage baseplate assembly protein V	A0A2P9JZK4	Alteromonadaceae_phage	3.8e-08	35.7
WP_123786959.1\|3842224_3843343_-	Mu P family protein	A0A2I7S9G1	Vibrio_phage	5.2e-32	28.7
WP_174716708.1\|3843339_3844764_-	DNA circularization N-terminal domain-containing protein	NA	NA	NA	NA
WP_174716709.1\|3844760_3846806_-	transglycosylase SLT domain-containing protein	A0A0M4REK7	Salmonella_phage	1.1e-19	42.9
WP_123786955.1\|3846944_3847274_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_123786954.1\|3847275_3847644_-\|tail	phage tail tube protein	NA	NA	NA	NA
WP_174716710.1\|3847705_3849235_-\|tail	phage tail sheath subtilisin-like domain-containing protein	B5TK67	Pseudomonas_phage	5.9e-103	46.8
3848616:3848633	attR	NA	NA	NA	NA
WP_174716711.1\|3849235_3849445_-	DUF2635 domain-containing protein	NA	NA	NA	NA
3848616:3848633	attR	NA	NA	NA	NA
WP_054481010.1\|3849454_3850006_-	hypothetical protein	NA	NA	NA	NA
WP_054481013.1\|3850002_3850323_-	hypothetical protein	NA	NA	NA	NA
WP_123786951.1\|3850324_3850585_-	hypothetical protein	NA	NA	NA	NA
WP_054481018.1\|3850581_3851643_-\|capsid	major capsid protein	V5Q8G6	Xylella_phage	1.8e-53	35.3
WP_174716712.1\|3851728_3852409_-\|head	head decoration protein	NA	NA	NA	NA
WP_054481022.1\|3852442_3853015_-	hypothetical protein	NA	NA	NA	NA
WP_054481025.1\|3853036_3853924_-	S49 family peptidase	S4TQW3	Salmonella_phage	6.0e-47	39.4
WP_054481027.1\|3853924_3855487_-\|portal	phage portal protein	A0A291AUL8	Sinorhizobium_phage	3.5e-82	33.7
WP_123786948.1\|3855555_3855804_-\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
WP_082401378.1\|3855815_3857984_-\|terminase	phage terminase large subunit family protein	A0A067ZJA1	Vibrio_phage	1.1e-91	34.9
WP_174716713.1\|3857925_3858531_-	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	1.5e-12	33.2
WP_174716714.1\|3858847_3859537_-	hypothetical protein	NA	NA	NA	NA
WP_174716715.1\|3859596_3860391_+	hypothetical protein	NA	NA	NA	NA
WP_174716716.1\|3860664_3861600_+	hypothetical protein	A0A1B5FPB0	Escherichia_phage	9.2e-14	32.5
WP_174716717.1\|3861727_3862315_-	hypothetical protein	NA	NA	NA	NA
WP_174716718.1\|3862311_3862692_-	hypothetical protein	NA	NA	NA	NA
WP_174716719.1\|3862702_3863101_-	hypothetical protein	R9TNL4	Vibrio_phage	1.3e-22	51.0
WP_174716720.1\|3863100_3864828_-	toprim domain-containing protein	A0A1B1IP14	uncultured_Mediterranean_phage	1.2e-72	34.4
WP_174716721.1\|3864824_3865895_-	hypothetical protein	U6C6J3	Ralstonia_phage	7.5e-28	73.6
WP_174716722.1\|3865901_3866222_-	hypothetical protein	NA	NA	NA	NA
WP_174716723.1\|3866599_3866803_-	hypothetical protein	NA	NA	NA	NA
WP_174716724.1\|3866886_3867120_+	hypothetical protein	NA	NA	NA	NA
WP_174716725.1\|3867100_3867403_-	hypothetical protein	NA	NA	NA	NA
WP_174716726.1\|3867439_3867670_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_174717563.1\|3867921_3868440_+	S24 family peptidase	A0A0M3LSL8	Mannheimia_phage	6.0e-23	44.2
WP_174716727.1\|3868436_3869375_+	hypothetical protein	NA	NA	NA	NA
WP_174716728.1\|3869641_3870013_+	hypothetical protein	NA	NA	NA	NA
WP_174716729.1\|3870860_3871205_+	hypothetical protein	NA	NA	NA	NA
WP_174716730.1\|3871201_3871450_+	hypothetical protein	NA	NA	NA	NA
WP_174716731.1\|3871446_3871695_+	hypothetical protein	NA	NA	NA	NA
WP_174716732.1\|3871687_3871963_+	hypothetical protein	NA	NA	NA	NA
WP_174716733.1\|3871959_3872343_+	hypothetical protein	NA	NA	NA	NA
WP_174716734.1\|3872545_3873631_+\|integrase	site-specific integrase	Q9ZXG4	Shigella_phage	1.5e-60	36.9
WP_062682012.1\|3873735_3876003_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	4.2e-36	30.1
WP_174716735.1\|3876680_3878744_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	2.7e-66	42.6
WP_006218592.1\|3878763_3878976_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_062682010.1\|3879283_3879826_-	phosphoribosyltransferase	NA	NA	NA	NA
WP_062682009.1\|3879909_3881205_-	adenylosuccinate synthase	A0A0B5J049	Pandoravirus	4.5e-59	31.6
WP_088146742.1\|3881281_3882439_-	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_062682007.1\|3882703_3883606_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_062682006.1\|3883624_3884923_-\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_043541532.1\|3884888_3885995_-	GTPase HflX	NA	NA	NA	NA
WP_006218585.1\|3886079_3886316_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_062682005.1\|3886472_3887546_-	histidinol-phosphate transaminase	NA	NA	NA	NA
WP_174716736.1\|3887549_3888908_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_088445882.1\|3888930_3890088_-	outer membrane protein assembly factor BamB	NA	NA	NA	NA
WP_062682002.1\|3890093_3890732_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_087881390.1\|3890735_3892022_-\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_062682000.1\|3892072_3893359_-	flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase	NA	NA	NA	NA
WP_062681999.1\|3893372_3893867_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_062681998.1\|3893863_3895018_-	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
WP_062681997.1\|3895062_3895488_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	1.1e-22	42.9
WP_062681996.1\|3895881_3898776_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	2.1e-141	37.4

DBSCAN-SWA_7

6762283 : 6786540

Burkholderia_virus(37.5%)

terminase,integrase,capsid,portal,head,protease

attL 6759672:6759686|attR 6778805:6778819

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
6759672:6759686	attL	NA	NA	NA	NA
WP_174717601.1\|6762283_6763030_-\|integrase	integrase	NA	NA	NA	NA
WP_152553768.1\|6763314_6763524_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_174717412.1\|6763963_6765046_-	hypothetical protein	NA	NA	NA	NA
WP_174717413.1\|6765042_6765423_-	hypothetical protein	NA	NA	NA	NA
WP_174717414.1\|6765419_6765803_-	hypothetical protein	A0A240F4V4	Ochrobactrum_phage	1.5e-26	48.3
WP_174717415.1\|6765799_6766042_-	hypothetical protein	NA	NA	NA	NA
WP_174717602.1\|6766038_6766392_-	hypothetical protein	K7PKY8	Enterobacterial_phage	2.4e-15	41.5
WP_174717416.1\|6766457_6766664_-	hypothetical protein	NA	NA	NA	NA
WP_174717417.1\|6766660_6767455_-	hypothetical protein	A4JX52	Burkholderia_virus	5.0e-61	48.9
WP_174717418.1\|6767471_6768368_-	recombination-associated protein RdgC	B5AX95	Iodobacteriophage	1.3e-38	34.0
WP_174717419.1\|6768382_6768748_-	hypothetical protein	NA	NA	NA	NA
WP_174717420.1\|6768744_6769023_-	hypothetical protein	NA	NA	NA	NA
WP_174717421.1\|6769019_6769253_-	hypothetical protein	NA	NA	NA	NA
WP_174717422.1\|6769621_6769861_+	cold-shock protein	Q9AZD3	Lactococcus_phage	6.8e-14	64.5
WP_174717423.1\|6769919_6770153_+	hypothetical protein	NA	NA	NA	NA
WP_174717424.1\|6770511_6770766_-	hypothetical protein	NA	NA	NA	NA
WP_174717425.1\|6770776_6770992_-	hypothetical protein	NA	NA	NA	NA
WP_174717426.1\|6771006_6771717_-	hypothetical protein	NA	NA	NA	NA
WP_174717427.1\|6772165_6772681_+	hypothetical protein	NA	NA	NA	NA
WP_174717428.1\|6772712_6773417_-	LexA family transcriptional regulator	A0A1I9KG86	Aeromonas_phage	3.4e-37	38.6
WP_174717429.1\|6773906_6774113_-	hypothetical protein	NA	NA	NA	NA
WP_174717430.1\|6774328_6774772_+	phage regulatory CII family protein	Q8W6P5	Burkholderia_virus	1.2e-27	48.6
WP_174717431.1\|6774924_6775074_+	hypothetical protein	NA	NA	NA	NA
WP_174717432.1\|6775066_6775366_+	hypothetical protein	NA	NA	NA	NA
WP_174717433.1\|6775362_6775845_+	DUF1364 family protein	Q8W6N7	Burkholderia_virus	2.3e-16	48.9
WP_174717434.1\|6775841_6776822_+	helix-turn-helix domain-containing protein	Q6JIG0	Burkholderia_virus	1.1e-36	43.1
WP_174717603.1\|6777021_6777435_+	hypothetical protein	NA	NA	NA	NA
WP_174717435.1\|6777434_6778088_+	hypothetical protein	NA	NA	NA	NA
WP_174717436.1\|6778295_6779093_+	hypothetical protein	NA	NA	NA	NA
6778805:6778819	attR	NA	NA	NA	NA
WP_174717437.1\|6779177_6779369_+	hypothetical protein	NA	NA	NA	NA
WP_174717438.1\|6779558_6779948_-	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_102774659.1\|6779970_6780153_-	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	5.9e-18	71.2
WP_174717439.1\|6780313_6780628_+	hypothetical protein	NA	NA	NA	NA
WP_174717440.1\|6780627_6781008_+	HNH endonuclease	C7BGG5	Burkholderia_phage	7.0e-29	52.8
WP_174717441.1\|6781216_6781699_+\|terminase	phage terminase small subunit P27 family	A4JWZ6	Burkholderia_virus	2.3e-53	63.3
WP_174717442.1\|6781702_6783421_+\|terminase	terminase large subunit	A4JWZ7	Burkholderia_virus	3.9e-276	80.7
WP_174717443.1\|6783420_6784647_+\|portal	phage portal protein	A0A2D1GNU4	Pseudomonas_phage	1.8e-94	48.5
WP_174715472.1\|6784648_6785284_+\|head,protease	HK97 family phage prohead protease	Q8W628	Enterobacteria_phage	7.3e-47	48.8
WP_174715473.1\|6785349_6786540_+\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	1.2e-119	53.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP054569

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection