CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP053952	Bacillus cereus strain FDAARGOS_798 plasmid unnamed1, complete sequence	0 crisprs	csa3,cas14j	0	0	25
NZ_CP053954	Bacillus cereus strain FDAARGOS_798 chromosome, complete genome	6 crisprs	csa3,WYL,cas14j,DEDDh,cas3,c2c9_V-U4,DinG	17	11	10
NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	1 crisprs	csa3,cas14j,cas14k,RT	2	1	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 23550

Clostridioides_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852148.1\|3967_4906_-	ACP S-malonyltransferase	NA	NA	NA	NA
WP_172851998.1\|4939_8266_-	ACP S-malonyltransferase	NA	NA	NA	NA
WP_172851999.1\|8667_9342_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_172852000.1\|9622_10330_-	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_172852001.1\|11709_11988_-	hypothetical protein	NA	NA	NA	NA
WP_098281600.1\|12871_13150_-	hypothetical protein	NA	NA	NA	NA
WP_172852002.1\|14136_14628_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_172852003.1\|16908_17202_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_172852004.1\|18401_18815_-	hypothetical protein	NA	NA	NA	NA
WP_172852005.1\|19354_19648_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_025690082.1\|20446_20647_-	hypothetical protein	NA	NA	NA	NA
WP_166695587.1\|21555_21714_+	hypothetical protein	NA	NA	NA	NA
WP_172852149.1\|21864_22590_-	epoxyqueuosine reductase QueH	NA	NA	NA	NA
WP_172852006.1\|22911_23550_-	NERD domain-containing protein	A0A2R2ZH57	Clostridioides_phage	3.7e-22	36.1

DBSCAN-SWA_2

29488 : 31102

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852150.1\|29488_31102_-	S-layer homology domain-containing protein	A0A1J0MS59	Bacillus_phage	5.1e-44	54.9

DBSCAN-SWA_3

36719 : 38741

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098382198.1\|36719_37697_-	2,3-diaminopropionate biosynthesis protein SbnA	C3U2M1	Lactococcus_phage	5.8e-27	29.5
WP_063549877.1\|37808_38741_-	ornithine carbamoyltransferase	A0A1J0F9B8	Only_Syngen_Nebraska_virus	1.6e-18	27.8

DBSCAN-SWA_4

42339 : 72370

Tupanvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_097797323.1\|42339_43665_-	DegT/DnrJ/EryC1/StrS family aminotransferase	E5ES42	Bathycoccus_sp._RCC1105_virus	1.5e-30	29.7
WP_097797324.1\|43763_44753_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_172852015.1\|44886_45585_-	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_098558716.1\|45827_52364_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	1.0e-180	29.3
WP_002001177.1\|52606_53326_-	thioesterase	NA	NA	NA	NA
WP_172852016.1\|53381_57878_-	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	2.9e-81	27.7
WP_000031543.1\|57859_58939_-	HAD-IIIC family phosphatase	NA	NA	NA	NA
WP_098382204.1\|58935_62019_-	cyclic peptide export ABC transporter	A0A2P1JQM9	Mycobacterium_phage	3.7e-11	28.1
WP_172852017.1\|62034_63111_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_172852018.1\|63129_70818_-	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	1.6e-95	26.2
WP_098326486.1\|70792_72370_-	amino acid adenylation domain-containing protein	A0A2K9L3I8	Tupanvirus	8.9e-70	32.5

DBSCAN-SWA_5

81496 : 97263

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852020.1\|81496_87220_-	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	1.0e-168	27.5
WP_172852021.1\|87246_97263_-	SDR family NAD(P)-dependent oxidoreductase	D0R7J2	Paenibacillus_phage	7.9e-63	35.2

DBSCAN-SWA_6

106468 : 107809

Bacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852024.1\|106468_107809_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	6.3e-32	37.3

DBSCAN-SWA_7

113122 : 115149

Spodoptera_litura_multicapsid_nucleopolyhedrovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088361292.1\|113122_114325_-	glycosyl transferase	B0LUM8	Spodoptera_litura_multicapsid_nucleopolyhedrovirus	5.1e-09	28.0
WP_000627284.1\|114618_115149_+	GNAT family N-acetyltransferase	G9BWD5	Planktothrix_phage	4.3e-08	28.6

DBSCAN-SWA_8

124288 : 139852

Tupanvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852025.1\|124288_131881_-	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	3.0e-163	27.8
WP_061663542.1\|132246_133173_+	aldo/keto reductase	NA	NA	NA	NA
WP_172852026.1\|133657_135313_+	aspartate aminotransferase family protein	M1HWX9	Paramecium_bursaria_Chlorella_virus	1.6e-05	31.1
WP_172852027.1\|135422_136067_+	hypothetical protein	NA	NA	NA	NA
WP_098318373.1\|136912_137323_-	hypothetical protein	NA	NA	NA	NA
WP_098472376.1\|137415_137613_-	helix-turn-helix transcriptional regulator	A0A142LP09	Marinitoga_camini_virus	7.3e-06	44.1
WP_098879987.1\|138604_139852_-	DNA (cytosine-5-)-methyltransferase	Q7Y4B5	Escherichia_virus	2.8e-50	36.3

DBSCAN-SWA_9

147162 : 154532

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852029.1\|147162_148575_-	AAA family ATPase	A0A2K9L1W7	Tupanvirus	1.5e-07	27.2
WP_172851995.1\|148625_148811_-	hypothetical protein	NA	NA	NA	NA
WP_172852030.1\|151445_154532_-	UvrD-helicase domain-containing protein	A0A068EQC7	Bacillus_phage	9.7e-20	27.5

DBSCAN-SWA_10

163720 : 166190

Paenibacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087874946.1\|163720_164880_-\|transposase	IS3-like element ISBth8 family transposase	A0A0C5AEA5	Paenibacillus_phage	2.5e-37	42.0
WP_000709205.1\|164994_165120_-	hypothetical protein	NA	NA	NA	NA
WP_172852033.1\|165116_166190_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.1e-71	42.0

DBSCAN-SWA_11

173159 : 177626

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001043942.1\|173159_173432_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	2.8e-24	67.8
WP_002001785.1\|173609_173849_-	hypothetical protein	NA	NA	NA	NA
WP_000713970.1\|173871_174666_-	hypothetical protein	NA	NA	NA	NA
WP_102956951.1\|174855_175014_-	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
WP_172852037.1\|175013_176105_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	2.3e-96	50.1
WP_097797373.1\|176689_177202_+	damage repair protein	O64031	Bacillus_phage	3.7e-33	45.6
WP_001158653.1\|177251_177626_+	hypothetical protein	D2XQ01	Bacillus_virus	1.9e-26	46.6

DBSCAN-SWA_12

188710 : 190537

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852039.1\|188710_190537_-	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SGM7	Hokovirus	2.4e-34	27.3

DBSCAN-SWA_13

197872 : 201705

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098281487.1\|197872_199042_-	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	7.2e-24	29.0
WP_098281482.1\|199601_200999_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.6e-25	28.0
WP_098281481.1\|200988_201705_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-35	35.7

DBSCAN-SWA_14

205112 : 302922

Bacillus_phage(60.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852041.1\|205112_205277_+	hypothetical protein	A0A1B0T6B0	Bacillus_phage	9.4e-07	65.4
WP_086411729.1\|205609_206053_-	DUF5065 family protein	NA	NA	NA	NA
WP_172852042.1\|206696_207272_-	hypothetical protein	NA	NA	NA	NA
WP_098281479.1\|207592_208648_-	N-acetylmuramoyl-L-alanine amidase	A0A1B0T6C8	Bacillus_phage	1.2e-150	71.8
WP_000570185.1\|208644_208884_-	hypothetical protein	A0A0A7AR38	Bacillus_phage	2.7e-26	75.9
WP_021728083.1\|208883_209120_-	hemolysin XhlA family protein	A0A288WG97	Bacillus_phage	6.1e-15	88.9
WP_098281478.1\|209811_210696_-	N-acetylmuramoyl-L-alanine amidase family protein	A0A0S2MVR5	Bacillus_phage	1.6e-76	51.8
WP_098281477.1\|210968_211790_-	M23 family metallopeptidase	A0A218KCJ1	Bacillus_phage	1.2e-28	43.8
WP_061884948.1\|211931_212900_-	lysozyme family protein	A0A223LKM8	Bacillus_phage	4.5e-32	41.7
WP_000460733.1\|213137_213524_-	hypothetical protein	A0A288WG73	Bacillus_phage	2.6e-47	69.8
WP_172852043.1\|214595_214832_-	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	6.3e-12	58.2
WP_000579788.1\|214968_215397_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	9.3e-30	51.4
WP_098281474.1\|215419_215848_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	2.8e-34	55.1
WP_098281473.1\|216119_216647_-	ester cyclase	NA	NA	NA	NA
WP_042889832.1\|216806_217199_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_098281472.1\|217203_218025_-	cytoplasmic protein	F2NZ47	Diadromus_pulchellus_ascovirus	5.0e-24	30.3
WP_098281471.1\|218197_218818_-	DsbA family protein	NA	NA	NA	NA
WP_098281470.1\|219524_220838_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_098281469.1\|220830_223050_-	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	1.0e-47	29.5
WP_098281468.1\|223214_223415_+	hypothetical protein	NA	NA	NA	NA
WP_098281467.1\|223497_223989_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_165613739.1\|224368_224521_-	hypothetical protein	NA	NA	NA	NA
WP_098281466.1\|224900_225896_-	DUF4065 domain-containing protein	NA	NA	NA	NA
WP_170962695.1\|225936_226368_-	hypothetical protein	NA	NA	NA	NA
WP_098402776.1\|227184_228555_-	M23 family metallopeptidase	D7RWE0	Brochothrix_phage	4.3e-20	42.6
WP_172852044.1\|228764_230105_-	C40 family peptidase	A0A0A8WF62	Clostridium_phage	3.1e-15	39.8
WP_172852045.1\|230167_231430_-	3D domain-containing protein	M4HQ50	Bacillus_phage	3.5e-24	44.8
WP_061663378.1\|231675_231945_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_098280861.1\|232242_233337_+	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	4.0e-93	49.6
WP_170962688.1\|233529_233691_-	hypothetical protein	NA	NA	NA	NA
WP_098280862.1\|234184_234604_+	hypothetical protein	NA	NA	NA	NA
WP_001167049.1\|234673_234889_-	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	1.7e-19	70.1
WP_172852046.1\|235055_236798_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	4.1e-07	39.8
WP_172852047.1\|237786_238266_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_172852151.1\|238419_238527_-	hypothetical protein	NA	NA	NA	NA
WP_172852048.1\|238984_239395_-	hypothetical protein	NA	NA	NA	NA
WP_000787540.1\|239808_240222_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_065705218.1\|240211_240619_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_172852049.1\|240988_241336_-	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	1.3e-10	37.8
WP_172852050.1\|241764_241953_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_172852051.1\|242247_244938_-	magnesium-translocating P-type ATPase	M1HLC0	Paramecium_bursaria_Chlorella_virus	3.7e-39	23.7
WP_172852052.1\|245337_246666_-	magnesium transporter	NA	NA	NA	NA
WP_172852053.1\|246927_247395_+	RsfA family transcriptional regulator	NA	NA	NA	NA
WP_172852054.1\|247556_249254_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_172852055.1\|251404_253114_+	hypothetical protein	NA	NA	NA	NA
WP_000798819.1\|255403_255814_-	HEPN domain-containing protein	NA	NA	NA	NA
WP_172852056.1\|257548_258316_-	PH domain-containing protein	I3VYV9	Thermoanaerobacterium_phage	1.0e-10	27.5
WP_000633813.1\|258509_258794_-	hypothetical protein	NA	NA	NA	NA
WP_002164669.1\|259612_259900_-	hypothetical protein	NA	NA	NA	NA
WP_172852152.1\|260115_261027_-	hypothetical protein	NA	NA	NA	NA
WP_172852057.1\|266279_267557_-	replication-relaxation family protein	NA	NA	NA	NA
WP_001006726.1\|269271_269694_+	hypothetical protein	NA	NA	NA	NA
WP_172852058.1\|269698_271153_+	cell division protein FtsZ	NA	NA	NA	NA
WP_172852059.1\|271187_271928_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_172852060.1\|275474_275612_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_172851997.1\|276351_276501_+	hypothetical protein	NA	NA	NA	NA
WP_172852153.1\|279298_279763_+	redoxin domain-containing protein	NA	NA	NA	NA
WP_172852061.1\|279776_280223_+	hypothetical protein	NA	NA	NA	NA
WP_172852062.1\|280726_281170_+	hypothetical protein	NA	NA	NA	NA
WP_167319656.1\|281166_281601_+	hypothetical protein	NA	NA	NA	NA
WP_172852063.1\|282842_284663_+	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	5.7e-20	27.8
WP_172852154.1\|286909_287839_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	9.1e-38	43.0
WP_172852064.1\|287760_288069_-\|transposase	transposase	NA	NA	NA	NA
WP_172852065.1\|288703_288814_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_172852066.1\|289009_289432_-	hypothetical protein	NA	NA	NA	NA
WP_172852155.1\|289814_290093_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_172852067.1\|290306_290462_+	hypothetical protein	NA	NA	NA	NA
WP_172852068.1\|290735_290861_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_172852069.1\|291606_291903_+	hypothetical protein	NA	NA	NA	NA
WP_172852070.1\|293293_293776_-	thioredoxin family protein	NA	NA	NA	NA
WP_153594324.1\|294431_295091_-	hypothetical protein	NA	NA	NA	NA
WP_172852071.1\|295536_295767_+	hypothetical protein	NA	NA	NA	NA
WP_172852072.1\|295956_296331_-	hypothetical protein	D2XQ01	Bacillus_virus	1.2e-28	51.3
WP_172852073.1\|296378_296720_-	YolD-like family protein	A0A1Q1PW34	Staphylococcus_phage	6.1e-08	31.4
WP_172852074.1\|296716_297982_-	Y-family DNA polymerase	O64031	Bacillus_phage	1.2e-101	46.3
WP_130067921.1\|298825_298966_-\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_001281108.1\|299097_299793_+	VanA-type vancomycin resistance DNA-binding response regulator VanR	W8CYM9	Bacillus_phage	1.3e-36	37.7
WP_172852075.1\|299782_300937_+	vancomycin resistance histidine kinase VanS	W8CYF6	Bacillus_phage	3.2e-16	24.1
WP_172852156.1\|301394_301610_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_172852076.1\|301803_302922_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	6.1e-174	81.7

DBSCAN-SWA_15

309444 : 310614

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852080.1\|309444_310614_+	beta-lactamase family protein	X2KYU1	Mycobacterium_phage	6.5e-17	30.3

DBSCAN-SWA_16

314511 : 328320

Erysipelothrix_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852084.1\|314511_315780_+	MFS transporter	A0A2K5B2B5	Erysipelothrix_phage	1.7e-15	26.9
WP_172852157.1\|316427_316661_+	hypothetical protein	NA	NA	NA	NA
WP_172852085.1\|317214_317757_+	stress protein	NA	NA	NA	NA
WP_172852158.1\|318665_319832_+	beta-lactamase family protein	G1DB24	Mycobacterium_phage	4.6e-23	28.6
WP_172852159.1\|320295_322380_+	beta-lactamase family protein	A0A1V0SLG8	Klosneuvirus	1.9e-06	23.4
WP_172852086.1\|323118_324237_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	1.0e-173	81.7
WP_172852087.1\|325768_326719_-	class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	1.9e-54	44.1
WP_172852088.1\|327549_328320_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-33	42.5

DBSCAN-SWA_17

334785 : 344097

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852093.1\|334785_335472_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-41	40.0
WP_172852094.1\|335468_336545_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.2e-18	29.2
WP_172852095.1\|336826_337588_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.1e-36	39.7
WP_172852096.1\|337604_339467_+	ABC transporter permease	NA	NA	NA	NA
WP_172852097.1\|339740_340724_+	FAD-binding protein	S4VRT3	Pandoravirus	1.0e-15	27.6
WP_172852098.1\|341493_342198_+	response regulator transcription factor	NA	NA	NA	NA
WP_172852099.1\|342197_343184_+	sensor histidine kinase	A0A1V0SGX0	Hokovirus	6.7e-07	24.9
WP_172852100.1\|343308_344097_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-31	40.4

DBSCAN-SWA_18

354535 : 355708

Lactobacillus_prophage(100.0%)

integrase

attL 344574:344592|attR 355804:355822

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
344574:344592	attL	NA	NA	NA	NA
WP_172852107.1\|354535_355708_+\|integrase	site-specific integrase	Q6SEG4	Lactobacillus_prophage	9.8e-05	26.9
WP_172852107.1\|354535_355708_+\|integrase	site-specific integrase	Q6SEG4	Lactobacillus_prophage	9.8e-05	26.9
355804:355822	attR	NA	NA	NA	NA

DBSCAN-SWA_19

359557 : 361285

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852110.1\|359557_361285_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-09	64.1

DBSCAN-SWA_20

369074 : 370799

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852115.1\|369074_370799_+	alpha-keto acid decarboxylase family protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	2.4e-20	23.4

DBSCAN-SWA_21

385010 : 385997

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852125.1\|385010_385997_+	choloylglycine hydrolase family protein	A7IWP6	Paramecium_bursaria_Chlorella_virus	1.1e-30	29.2

DBSCAN-SWA_22

389398 : 389602

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000410775.1\|389398_389602_-	cold-shock protein	Q9AZD3	Lactococcus_phage	1.5e-17	63.6

DBSCAN-SWA_23

400373 : 404930

Brevibacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852133.1\|400373_401447_-	tyrosine recombinase XerS	A0A0K2CP59	Brevibacillus_phage	3.9e-08	24.8
WP_172852134.1\|402683_404930_-	peptidase domain-containing ABC transporter	F2Y2R6	Organic_Lake_phycodnavirus	3.4e-22	34.1

DBSCAN-SWA_24

410543 : 414370

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098280505.1\|410543_411257_-	response regulator transcription factor	W8CYM9	Bacillus_phage	7.4e-40	41.2
WP_172852136.1\|411586_411937_-	YxeA family protein	NA	NA	NA	NA
WP_000830528.1\|411959_412691_-	ABC transporter permease	NA	NA	NA	NA
WP_172852137.1\|412703_413456_-	ABC transporter permease	NA	NA	NA	NA
WP_172852163.1\|413452_414370_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-44	43.3

DBSCAN-SWA_25

423321 : 478024

Paenibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852141.1\|423321_432279_-	SDR family NAD(P)-dependent oxidoreductase	D0R7J2	Paenibacillus_phage	3.1e-42	31.3
WP_172852142.1\|432271_437119_-	SDR family NAD(P)-dependent oxidoreductase	D0R7J2	Paenibacillus_phage	1.7e-34	30.0
WP_172852143.1\|437115_450867_-	SDR family NAD(P)-dependent oxidoreductase	D0R7J2	Paenibacillus_phage	1.1e-35	32.8
WP_172852144.1\|450863_460640_-	SDR family NAD(P)-dependent oxidoreductase	D0R7J2	Paenibacillus_phage	1.1e-35	29.8
WP_172852145.1\|460632_475005_-	SDR family NAD(P)-dependent oxidoreductase	D0R7J2	Paenibacillus_phage	5.7e-38	30.4
WP_172852146.1\|474997_478024_-	polyketide synthase dehydratase domain-containing protein	D0R7J2	Paenibacillus_phage	5.6e-36	33.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP053954

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP053954_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053954_1

253674-253781

Orphan

Consensus_repeat	Method
TATATCAACGATTTTTTAAATATATC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP053954_1

>merge|NZ_CP053954|1|253674-253781|CRISPRCasFinder
TATATCAACGATTTTTTAAATATATCGTTCATTCCTTTCAATATATCAACGATTTTTTAAATATATCGTTCATTCCTTTCAATATATCAACGATTTTTCAAATATATC

>NZ_CP053954|1|1|253674-253781|CRISPRCasFinder
TATATCAACGATTTTTTAAATATATC	GTTCATTCCTTTCAATATATCAACGATTTTTTAAATATATCGTTCATTCCTTTCAA
TATATCAACGATTTTTCAAATATATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053954.1\|WP_000412774.1\|245287_248485_-\|bifunctional-P-450/NADPH--P450-reductase	unknown	unknown	gnl\|CDD\|223446
NZ_CP053954.1\|WP_001046619.1\|252516_253512_-\|D-cysteine-desulfhydrase	unknown	unknown	gnl\|CDD\|179673
NZ_CP053954.1\|WP_000005138.1\|249068_250547_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP053954.1\|WP_002061808.1\|257066_257987_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377216
NZ_CP053954.1\|WP_000477749.1\|260765_261830_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP053954.1\|WP_000202597.1\|260094_260766_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP053954.1\|WP_000505586.1\|240164_240524_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053954.1\|WP_000851006.1\|258933_260046_+\|LPXTG-cell-wall-anchor-domain-containing-protein	unknown	unknown	gnl\|CDD\|274009
NZ_CP053954.1\|WP_000636459.1\|240605_241556_-\|class-A-beta-lactamase	unknown	unknown	gnl\|CDD\|185339
NZ_CP053954.1\|WP_001201801.1\|251701_252256_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053954.1\|WP_000826989.1\|258202_258793_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379324
NZ_CP053954.1\|WP_016111591.1\|255469_256429_-\|RNA-splicing-ligase-RtcB	unknown	unknown	gnl\|CDD\|376465
NZ_CP053954.1\|WP_000798027.1\|242964_245076_+\|TerD-family-protein	unknown	unknown	gnl\|CDD\|132992
NZ_CP053954.1\|WP_000803871.1\|262015_262639_+\|ArsR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238042
NZ_CP053954.1\|WP_061654910.1\|253909_255142_-\|DUF4073-domain-containing-protein	unknown	unknown	gnl\|CDD\|290024
NZ_CP053954.1\|WP_000373139.1\|250974_251571_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053954.1\|WP_000022542.1\|241862_242291_-\|DUF5412-domain-containing-protein	unknown	unknown	gnl\|CDD\|375187
NZ_CP053954.1\|WP_087948644.1\|262708_263968_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NZ_CP053954.1\|WP_061654911.1\|256711_256930_-\|RtcB-family-protein	unknown	unknown	gnl\|CDD\|376465
NZ_CP053954.1\|WP_065703686.1\|237838_239626_+\|response-regulator	unknown	unknown	gnl\|CDD\|225107

Protein	Function_ID	Function_description	E-value
NZ_CP053954.1\|WP_000412774.1\|245287_248485_-\|bifunctional-P-450/NADPH--P450-reductase	gnl\|CDD\|223446	COG0369, CysJ, Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism].	9.82416e-172
NZ_CP053954.1\|WP_001046619.1\|252516_253512_-\|D-cysteine-desulfhydrase	gnl\|CDD\|179673	PRK03910, PRK03910, D-cysteine desulfhydrase; Validated.	0
NZ_CP053954.1\|WP_000005138.1\|249068_250547_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	6.57844e-109
NZ_CP053954.1\|WP_002061808.1\|257066_257987_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|377216	pfam04072, LCM, Leucine carboxyl methyltransferase. Family of leucine carboxyl methyltransferases EC:2.1.1.-. This family may need divides a the full alignment contains a significantly shorter mouse sequence.	5.84005e-62
NZ_CP053954.1\|WP_000477749.1\|260765_261830_-\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	9.56957e-10
NZ_CP053954.1\|WP_000202597.1\|260094_260766_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	5.4485e-104
NZ_CP053954.1\|WP_000851006.1\|258933_260046_+\|LPXTG-cell-wall-anchor-domain-containing-protein	gnl\|CDD\|274009	TIGR02169, chromosome_segregation_protein_related_ptotein, chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	3.0063e-13
NZ_CP053954.1\|WP_000636459.1\|240605_241556_-\|class-A-beta-lactamase	gnl\|CDD\|185339	PRK15442, PRK15442, beta-lactamase TEM; Provisional.	8.51024e-64
NZ_CP053954.1\|WP_000826989.1\|258202_258793_+\|ATP-binding-protein	gnl\|CDD\|379324	pfam13671, AAA_33, AAA domain. This family of domains contain only a P-loop motif, that is characteristic of the AAA superfamily. Many of the proteins in this family are just short fragments so there is no Walker B motif.	1.13343e-11
NZ_CP053954.1\|WP_016111591.1\|255469_256429_-\|RNA-splicing-ligase-RtcB	gnl\|CDD\|376465	pfam01139, RtcB, tRNA-splicing ligase RtcB. This family of RNA ligases (EC:6.5.1.3) join 2',3'-cyclic phosphate and 5'-OH ends. They catalyze the splicing of tRNA and may also participate in tRNA repair and recovery from stress-induced RNA damage.	1.51775e-58
NZ_CP053954.1\|WP_000798027.1\|242964_245076_+\|TerD-family-protein	gnl\|CDD\|132992	cd06974, TerD_like, Uncharacterized proteins involved in stress response, similar to tellurium resistance terD. Tellurium resistance terD like proteins. This family is composed of uncharacterized proteins involved in stress response, such as the tellurium resistance proteins, chemical-damaging agent resistance proteins, and general stress proteins from a variety of organisms. The tellurium resistance proteins are homologous terA,-D,-E,-F,-Z,-X gene products, which confer tellurium resistance mediated by plasmids. Currently, the biochemical mechanism of tellurium resistance remains unknown. The family also contains several ter gene homologues, YceC, YceD, YceE, for which there is no clear evidence for any involvement in the tellurium resistance. A putative cAMP-binding protin CABP1 shows a significant similarity to the terD protein and is also included in this family.	2.1252e-15
NZ_CP053954.1\|WP_000803871.1\|262015_262639_+\|ArsR-family-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	4.9769e-11
NZ_CP053954.1\|WP_061654910.1\|253909_255142_-\|DUF4073-domain-containing-protein	gnl\|CDD\|290024	pfam13285, DUF4073, Domain of unknown function (DUF4073). This family is frequently found at the C-terminus of bacterial proteins carrying the family, Metallophos pfam00149.	2.32434e-101
NZ_CP053954.1\|WP_000022542.1\|241862_242291_-\|DUF5412-domain-containing-protein	gnl\|CDD\|375187	pfam17428, DUF5412, Family of unknown function (DUF5412). This is a family of unknown function found in Bacteria. Members of this family have one or two predicted trans-membrane regions.	1.93303e-53
NZ_CP053954.1\|WP_087948644.1\|262708_263968_+\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.6902e-61
NZ_CP053954.1\|WP_065703686.1\|237838_239626_+\|response-regulator	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.66299e-66
NZ_CP053954.1\|WP_061654911.1\|256711_256930_-\|RtcB-family-protein	gnl\|CDD\|376465	pfam01139, RtcB, tRNA-splicing ligase RtcB. This family of RNA ligases (EC:6.5.1.3) join 2',3'-cyclic phosphate and 5'-OH ends. They catalyze the splicing of tRNA and may also participate in tRNA repair and recovery from stress-induced RNA damage.	2.25316e-05

>NZ_CP053954.1|WP_001046619.1|252516_253512_-|D-cysteine-desulfhydrase
MNLAKFPRKKYTESYTPIEKLNNFSEALGGPTIYFKRDDLLGLTAGGNKTRKLEFLVADAQENGADTLITAGGIQSNHCRLTLAAAVKEKMKCILVLEEGLEPEEKRDFNGNYFLYHLLGAENVIVVPNGADLMEEMHKVAQEVSEKGNTPYVIPVGGSNPTGAMGYVACAQEIMAQSFEQGIDFSSVVCVSGSGGMHAGLVTGFSGTQSHIPVIGINVSRGKAEQEEKVAKLVDETSAHVGIPNFISRDAVTCFDEYVGPGYALPTPEMVEAVQLLAKTEGILLDPVYTGKAVAGLIDLIRKDKFNKEDNILFVHSGGSPALYANTSLFA
>NZ_CP053954.1|WP_001201801.1|251701_252256_-|hypothetical-protein
MRAKKLVTLAVPFMLLVGCEVGDKDSTHKTEQTSKAITKTVISEQQYPYYICEQVVEFQFKKDELLLNLGESLKDKEKAKAVLKTSNEIDKILDNMEHIKVPDTYKDIHKSIQEGVTEARKATKLIKDAGKEDKQKIQEATMKGTEFLSGVDGEHWKKAIYELSQENKDAYSKALDKKVKEHSK
>NZ_CP053954.1|WP_000373139.1|250974_251571_+|hypothetical-protein
MDQYWYLNSKGNGQQYTNQISLYSQPEITTSEVMNDLKLPENWSYRVYPVSWDSSANYTGFNPQPPPFSWGQQPINYAEILPQGHPANWTPLPGHAGFNFQKPPFPWAQPFNHTGMFAQGHLAALLSPPAKAFKFNTNNGGIFGNSPGWGGPWAPMGWGNNGGNGQLGMLGNLLTAGKGTMSGIGMISSLIGMGKFFF
>NZ_CP053954.1|WP_000005138.1|249068_250547_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MSETLHKRKPPYVMLVILFIGAFVSFLNNSLLNVALPSIMKDLNIQDYSTIQWLSTGYMLVSGILIPASAFLITRFSNRSLFITSMVIFILGTALAAVAPNFGLLLTGRMVQAAGSSVMGPLLMNIMLVSFPREKRGTAMGIFGLVMITAPAIGPTLSGYIVEYYDWRLLFEMILPLAIISLLLGIWKSENVMKQNKNAKLDYLSLLLSSVGFGGLLYGFSSASSDGWTNKVVLTTLIIGAIALIAFIIRQLKMDEPLLDLRVYKYPMFALASVIAIVNAVAMFSGMILTPAYVQNVRGISPLSSGLMMLPGAVIMGIMSPITGKLFDKYGPRILGIVGLSITAVSTYMLASLQIDSSHTHIILIYTLRMFGMAMVMMPLMTNGLNQLPTRLNPHGTAVNNTAQQVSGSIGTAILVTIMNSVTKTKAESLMSHIDPTTFTETTKAIVTQKALLSGIQYSFYVALGMNVVALLLVFFVKRVDTSAEAVEKLNR
>NZ_CP053954.1|WP_000412774.1|245287_248485_-|bifunctional-P-450/NADPH--P450-reductase
MEKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKIAEEYGPIFQIQTLSDTIIVVSGHELVAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETHEPNWKKAHNILMPTFSQRAMKDYHAMMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSMTRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSGDQEENDLLSRMLNVSDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDRVLTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISVLIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMGMLLQHFELIDYQNYQLDVKQTLTLKPGDFKIRILPRKQTISHPTALPPTEDKLKNHEIKQHVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVVALNDRIGSLPKEGAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYIDEQMAQKGATRFSKRGEADASGDFEEQLEQWKQSMWSDAMKAFGLELNKNMEKERSTLSLQFVSRLGGSPLARTYEAVYASILENRELQSSSSDRSTRHIEVSLPEGATYKEGDHLGVLPVNSEKNINRILKRFGLNGKDQVILSASGRSINHIPLDSPVSLLDLLSYSVEVQEAATRAQIREMVTFTACPPHKKELEALLEEGVYHEQILKKRISMLDLLEKYEACEIRFERFLELLPALKPRYYSISSSPLVAQNRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTPQSNFELPKDPETPIIMVGPGTGIAPFRGFLQARRVQKQKGINLGEAHLYFGCRHPEKDYLYRTELENDERDGLISLHTAFSRLEGHPKTYVQHLIKQDRINLISLLDNGAHLYICGDGSKMAPDVEDTLCQAYQEIHEVSEQEARNWLDRVQDEGRYGKDVWAGI
>NZ_CP053954.1|WP_000798027.1|242964_245076_+|TerD-family-protein
MKNSIYIRRSLKVIIKREENKLPNIYLATVLKNLESLGFTFSEPLIEELQTLSVDAFTSFYKELVKHLKEMVGAHIQFTPMYPNFPQQMMDLSDADLYINAIIHYVTLRLPVSKVEERLPLLDRVDLKVIDLGSEEDFNQMISQLISANSSISSTDKTDVEWAITHTEDVSCFLPNVIPHKENMSFIIGVLLINRKISADAAAKYFKTATDVLRLAVALSEGDVSLASSVRFKKFNRAERRFLLGLLEQCGNITEDMLRYKKRWIRLGEILHPAEYHTRFPKTHRAFEILRNNIKVETFNGKIEAALLNRDIMTAKNLLKTRPGEFARRLDHLIRLCSDKSTDVFNILEDFLSIIGNVSTPVLLQLTAHFKHRNDKNEFRTFFPKGNVAKAIGIENTLPFISEDICLMIVKMCEDTLKNRFAELPSLGKVFLDEQLKNHLVPFSQRSASKALRTLSRGSKVDLPEGDTIRFFLWWKEGYVNGQHTGRVDIDLSAAMYDEDWQYKEHVSFTNLRSKNFKAYHSGDITSAPKGASEFIDFDIPSVLKYGARYVVMTLLSYTDQPYKDLPECFTGWMVRQYPGSGEIFEPSTVQDKVDITADTQISIPVILDLKERKLIWTDLSLTRDLTYDNTIEANQKGMILVGKALTNLVKPNLYDLFRLHIEARGELVQDIEEAESIFSLDKGITPFDIEKIISDFIADSKG
>NZ_CP053954.1|WP_000022542.1|241862_242291_-|DUF5412-domain-containing-protein
MSIINTKGEIKKTKRKVLLTILTMLVIIIGFGYWKLFSLQGVPKGELIRTVKSPDGKYLIKTYFHNAGSLSADAVRGELVNLDTDSEKNIYWNYPDTDPYIEWVNKNIVRIGDQTLDVSQKETYDWRDDDKHVKEMPKQFIR
>NZ_CP053954.1|WP_000636459.1|240605_241556_-|class-A-beta-lactamase
MIVLNKFFNILHYKKMVPVVFLSCATLIGCSDGNTQSELPKQTKQTNQIKQEITGNDSFVKLEKEFDAKLGIYALDTDTNQTVTYQSDERFAYASTHKALAVGVLLQKKSIEDLNQRVLYTREDLVNYNPITEKYVDSGMTLKELADASLRYSDNTAQNLILKQLGGPSEFKKSLREVGDTVTNPERFEPELNEVPPGDVRDTSTPKALATSLQAFTLGDVLSTEKRDLLIDWMKRNTTGDNLIRAGVPGGWEVADKTGSGSYGTRNDIAIIWPPNKKPIVVAILSNHDKEDAKYDDKLIAEATKIVLDALKVTNK
>NZ_CP053954.1|WP_000505586.1|240164_240524_-|hypothetical-protein
MGFFVGVAFLATMASCLMFKVLSGASKDVARYQTFRKIVVRRELLTNSIYKELYFIFLFPAIVGITHILFGMNMFSPILINPYSRICLPLVIFVVIYSIYYLITVQLYKGIVLSKKRSM
>NZ_CP053954.1|WP_065703686.1|237838_239626_+|response-regulator
MLDIVKYWFWYDWIMLGVRILISVSIAITTFDFQDSITLPLWIIILWEIIAFSVPWVALLFNYKYYLFTDILLYGGLCIYLTSLFPEAYNTFLISVFLIAANSKHLSYYWTAPITVFITTGIFYALAPSNNYWIMVTYYGLAYVMGFAFHLLIVNHKQNEAIRKQNAVLEQYMSQIERITLAEERNRLSSELHDTVGHAYTSIIMGMETLRTELATEMGIQRLDSLLEMGRKSIEDVRGYLHQMDSRCQSPSLIQSLQNLGAEFQEHAQVNVSFRTFGEEYQLSRQAKITFVRCLQESLTNAVRHGQGTEIIVSLQFEQQYTRLEVQDNGKGNVEWQEGFGMNAMKERAMNLQGHLSVYTKPEEGMLVTCTIPRQTEIKNGLIRLLIVDDQPFVRESLRTLLDRYEDLNVVGLAEDGNEAIDLCGRLQPHVILMDLDMQHMDGIEATKKIKQQWPHIRVLIFTTFQDTEQAVESLRNGADGFLLKSIETLELANTIRLIHKGGTLIDQGMSHKIFEKFDEQKETPQSKAAVYELTAREIEILQLVAKGLRYTTIASRLYLSNGTVRNYASTAYTKLGVCNKEEAVQKALEIGIIE
>NZ_CP053954.1|WP_061654910.1|253909_255142_-|DUF4073-domain-containing-protein
MKKTVASLAVMAALLPTFSAHAEGKEQVRKSATTFNVISDIQGDLGDFDHVLKDMNKVTPLSRALIMNGDITPTGQQSQYDDVKRVLNKNKHPENVWSTVGNHEFYAGKWTADGKLSQSTWPNGVTEETLFNRYLKFSGQEKVYHKKELDGYPLLFLGTEKYMKYHDSKMWDEVYMSDEQLGWLKQNLEEYSQKDKNKPIFIFSHHVLPDTVSGSRQSPYLQDYLNVDKLYDILKDYPQVVFFTSHTHWDLNLPDWAGKKKIAGGDKKGFTVVNTGGIETGWMSAGPNGGEKTAPDGYSFKQGLQVKAYGNDVIVTAYDYKRDKDIKKLLISDSKIAQMAPNVTADDSENIIVGATEYMEYSIEGTNEWHTYSKANPPKFDGDKVVYVRHKGEMNLEPGLTQLLRFSVNK
>NZ_CP053954.1|WP_016111591.1|255469_256429_-|RNA-splicing-ligase-RtcB
MEVVIINKKKEEINFDYLDETIRKFVPSGFRIRDKEHRFSKMIDFDSVRAPFTLQRAQKSIGTLGGGNHFVELNEDDEGNVYIVIHSGSRNLGKQVAEYYQNFAYEQLINVKSIKEEIIERLTKEGRQQEIHEALREIKKPVIRKELAYLEGQGFKDYMNDMKIAQKYAELNRKAMIDEIVTTMDWKVTDQFTTIHNYIDMDNMILRKGAISAQKDERVIIPINMRDGSIIAFGKGNPDWNFSGPHGAGRIMSRKKAKEVLNLEDFQNTMTEVWTTSVAESTLDEAPMVYKPMDEIIENTKETIDIKHIIKPLYNFKAN
>NZ_CP053954.1|WP_061654911.1|256711_256930_-|RtcB-family-protein
MLKLRGKYNEAKVYTTNVEKMAAGQIIDLCNQEFVKDSKIRIMPDTHAGAGCTIGTTMTVQDKIVPNLVGVN
>NZ_CP053954.1|WP_002061808.1|257066_257987_-|class-I-SAM-dependent-methyltransferase
MCVKQGEASVTSLVSAFGRAYHSEFDSPKIFNDYVAKDFISQKERNNIETNMVQGIHFFNTDIAEQFQDNPKEILKWITQVQLSPTPLARAAYCERVLLHEITLGAKQYVILGAGLDTFSFRNRELENKIEIFEVDHPSTQAFKKERIKEVEIEVPNNLHFVSMDFTKGFSYEQLRNEGFENKKTFFSLLGVTYYLTKEELSSLIECLFEVVPAGSSIVFDYPDENLFTEKGLSNRVENMVKMAAVGGEPMKSCFSYAEMEALLEKAGLLIYEHLSPEDINKLYFEGRNDYLKAFETVHYVHAVKR
>NZ_CP053954.1|WP_000826989.1|258202_258793_+|ATP-binding-protein
MKRLVIITVGKTHSGKTTFARALEKELPHSFVMDQDNQAEFINTHYEKLQPAKGPNTFKHGLSKFIVDYAKEHSNLHLIISNSNRSKNGRLYLLNELFPQNEYVRILVHFDIPDDVLYERVARSTRSTNIFRGGYSSFKEVFDRQQTESLHDDVVDPIENEADYLFVIRNNKDVSFTIEEIVHLARGLSPTPNKRL
>NZ_CP053954.1|WP_000851006.1|258933_260046_+|LPXTG-cell-wall-anchor-domain-containing-protein
MKTKQTIAASTLALAMIAGANSAHAEVNDATPQQSTGDRLAEIKQHKQELDAKLQQHKENVDQTLNELNKVKENVDTKVNELHERKQVADEKINEVKQHKQELDAKLQQDKQIAEDKIAEIKEHKKQVEDKVAEVKEHKQNIDNKVNEIKEHKQTVDEKVNEMKQHKENIDQKVNELKEVKKQVDEKLAELKKAKQTAEDKLAELKENKPNTGNTLEELKKIKGNLDSLSANLELAKQDVKNKLAVLQEARQDLINKINEIKQSKQTVSDDLSKKKQDLDIKINDFKHTEKKIDDKLAELHTTKQNVDNKINEVSQSKQMQADNGTKNNNAKELPNAGSEQSNNMALGMLSVLGGVLLLTRNKIKTLFSK
>NZ_CP053954.1|WP_000202597.1|260094_260766_-|ABC-transporter-ATP-binding-protein
MTSLLKLDKVSKVYGEGNTEVTALHPISLDVKAGEFIGIVGPSGSGKSTLLSIAGALLSPSKGDIYIREQNITQLSEKEMTDIRLKKIGFIFQFANLVPYLNVKEQLLYIAKLKKESKQESEKRADHLLAAFGLGERKNHYPNQLSGGEKQRVAIARAFMNNPDLILADEPTASLDSKRAREVVEMMKREVKESQKAAIMITHDERMLDVCDRILTLRDGQLI
>NZ_CP053954.1|WP_000477749.1|260765_261830_-|ABC-transporter-permease
MFLALRELKQSKLRYGLIGLIMVLLSFLVLVISGLANGLSYDNASSIQNMEANKFVLADDAENKLLRSQIKKDDVDNVVNQVGEKEAVPFRVKVSTYEKKDSSKKVDIAIFSSERDSFLEPKIVKGEKLGTANNEMVADESIKEKGIDIGDTIIDPVSKKEFTIVGFTKDQMFSHTPVVYVNEDVWGAISQPNQKDYSAIALNTDKEIKNAHVIDKKEVLQSIPGFKEEQGTLTMIIAFLLVIAALLIGVFFYVITLQKTQQLGVLKAIGTKNSYLANSLVVQALFLSVVAMVISIVLVQGLEQILPAGMPFLLTTPMIAQYAAIFIVISILGTLISLYQVLKVDALEAIGGGM
>NZ_CP053954.1|WP_000803871.1|262015_262639_+|ArsR-family-transcriptional-regulator
MKPMLTLTTYSQLKAISDPLRVEMMMRLCERPYTGQLLSEKFGIPRAKIHYHLKELEKNGFIEIVYTEEKNGIIQKFYQSVARGFTPAADLLPHLEMLSESGRQIFLQMAETTKNHILAAPEEAFILRKESEDPAEWNYVSSCWEFDATPEQFQVWVKKFHELMAELNDIAKDADKDPNSKSYYISTTALQIDERAMQRFVKKEEKS
>NZ_CP053954.1|WP_087948644.1|262708_263968_+|MFS-transporter
MDILKNRNFLLLFLGRIFTNIGDSLYYVAAMWLVYKLSGNPFYSGLAGFLTLLPSALQFLTGPFVDRWSIKNTLVITQVLQCILILIIPITHYFDLLTVQLLLIIMPIVAFIEQFAYPAQSKALPLLLHKTQLLKGNSLFSFAYQGIDLICTTISGILVALLGAITLYVIDSFTFAITALLFFSLKMPKQTETGTSLSTKQYFSDLKEGFSIVFRSLMGAFLIGSVVANFSIGMTMAILPSFADSLGGVKSYGFFLAAISAGSLIGALFSSWVGKRNVGRTSIISFATGAIFWFLSTIVPFQWLSIFLFGLAWIPIGATNILFATISQIVIPNQYIGRINSVMRSMGTIAMPFGSLIGGYTANVFSSQLIFALASIGIFFISLVWLLHPKLRALPKADEITADTFGVRFKEERGKGAAL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP053954_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053954_2

724476-725375

Orphan

Consensus_repeat	Method
TAACACGGGCGCTACTGG	CRT

22 spacers

The CRISPR arrays of NZ_CP053954_2

>merge|NZ_CP053954|2|724476-725375|CRT
CGCTACTGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACCGGCGCTACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACAGGCGCTACCGGTGCCACTGGGCCTCGAGGTAATACGGGCGCTACTGGCGCTACTGGGCCTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAAGGTAACACGGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCAAGGTAACACGGGCGCTACTGGCGCTACTGGGCCTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAAGGTAACACGGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCAAGGTAACACGGGTGCTACTGG

>NZ_CP053954|2|1|724476-725375|CRT
CGCTACTGGTGCCACTGG	GCCTCGAGGTAACACGGG
CGCTACCGGCGCTACTGG	GCCTCGAGGTAACACGGG
CGCTACTGGCGCTACCGG	TGCCACTGGACCTCGAGGTAACACGGG
CGCTACTGGCGCTACTGG	ACCTCAAGGTAACACGGG
CGCTACTGGCGCTACCGG	TGCCACTGGACCTCAAGG
TAACACGGGCGCTACTGG	CGCTACCGGTGCCACTGGGCCTCGAGG
TAACACGGGCGCTACTGG	TGCCACTGGACCTCAAGG
TAACACGGGCGCTACTGG	CGCTACCGGTGCCACTGGGCCTCGAGG
TAACACAGGCGCTACCGG	TGCCACTGGGCCTCGAGG
TAATACGGGCGCTACTGG	CGCTACTGGGCCTCAAGG
TAACACGGGCGCTACTGG	TGCCACTGGACCTCAAGG
TAACACGGGCGCTACCGG	TGCCACTGGGCCTCGAGG
TAACACGGGCGCTACTGG	CGCTACCGGTGCCACTGGGCCTCGAGG
TAACACGGGCGCTACTGG	CGCTACCGGTGCCACTGGGCCTCGAGG
TAACACGGGCGCTACTGG	CGCTACCGGTGCCACTGGGCCTCAAGG
TAACACGGGCGCTACTGG	CGCTACTGGGCCTCAAGG
TAACACGGGCGCTACTGG	TGCCACTGGACCTCAAGG
TAACACGGGCGCTACCGG	TGCCACTGGGCCTCGAGG
TAACACGGGCGCTACTGG	CGCTACCGGTGCCACTGGGCCTCGAGG
TAACACGGGCGCTACTGG	CGCTACCGGTGCCACTGGGCCTCGAGG
TAACACGGGCGCTACTGG	CGCTACCGGTGCCACTGGGCCTCAAGG
TAACACGGGCGCTACTGG	CGCTACCGGTGCCACTGGGCCTCAAGG
TAACACGGGTGCTACTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053954.1\|WP_000391395.1\|719567_720842_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP053954.1\|WP_000092763.1\|716345_717680_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP053954.1\|WP_000504957.1\|727547_728501_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP053954.1\|WP_103595474.1\|736117_736435_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053954.1\|WP_087948597.1\|728681_728927_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053954.1\|WP_000438175.1\|721826_722783_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP053954.1\|WP_001102627.1\|715588_715912_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP053954.1\|WP_172852536.1\|730289_732146_-\|PTS-sugar-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|236740
NZ_CP053954.1\|WP_001179092.1\|733977_735141_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP053954.1\|WP_000656783.1\|717728_718118_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP053954.1\|WP_000031383.1\|715053_715596_-\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NZ_CP053954.1\|WP_002000547.1\|733067_733877_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP053954.1\|WP_000734613.1\|728989_729940_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NZ_CP053954.1\|WP_000450319.1\|722896_723862_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|227308
NZ_CP053954.1\|WP_172852537.1\|732159_733071_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP053954.1\|WP_000228314.1\|735257_735800_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NZ_CP053954.1\|WP_000460289.1\|718303_719575_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP053954.1\|WP_000813896.1\|727301_727526_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP053954.1\|WP_000312267.1\|720934_721558_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP053954.1\|WP_000181501.1\|721657_721795_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP053954.1\|WP_000391395.1\|719567_720842_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP053954.1\|WP_000092763.1\|716345_717680_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP053954.1\|WP_000504957.1\|727547_728501_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	7.80471e-165
NZ_CP053954.1\|WP_000438175.1\|721826_722783_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	9.01836e-156
NZ_CP053954.1\|WP_001102627.1\|715588_715912_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	6.74615e-25
NZ_CP053954.1\|WP_172852536.1\|730289_732146_-\|PTS-sugar-transporter-subunit-IIA	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	6.09805e-142
NZ_CP053954.1\|WP_000656783.1\|717728_718118_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NZ_CP053954.1\|WP_000031383.1\|715053_715596_-\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	2.38278e-81
NZ_CP053954.1\|WP_002000547.1\|733067_733877_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	5.69155e-81
NZ_CP053954.1\|WP_000734613.1\|728989_729940_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	1.68064e-36
NZ_CP053954.1\|WP_001179092.1\|733977_735141_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP053954.1\|WP_172852537.1\|732159_733071_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	1.68785e-142
NZ_CP053954.1\|WP_000228314.1\|735257_735800_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	3.82961e-56
NZ_CP053954.1\|WP_000460289.1\|718303_719575_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP053954.1\|WP_000813896.1\|727301_727526_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP053954.1\|WP_000312267.1\|720934_721558_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.8015e-60
NZ_CP053954.1\|WP_000450319.1\|722896_723862_+\|site-specific-integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	9.07412e-13

>NZ_CP053954.1|WP_000450319.1|722896_723862_+|site-specific-integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKTNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISPDEEKRLKYIVTSLEGLSEKQLPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTITLAKEDKKQLYNYYKSIPEPVRPKYHSDDPLFVAFDFNRGTYRWVYENDAPKALTEIAIQKMIRLEVARANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENRKNALL
>NZ_CP053954.1|WP_000438175.1|721826_722783_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISNETAIKHEMLQRIEEEMGKLVGMEDIKKIIKEIYAWIYVNKKRQEKGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEDREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKNDLIGISSMDLMLEEETHST
>NZ_CP053954.1|WP_000181501.1|721657_721795_+|hypothetical-protein
MTNHVNKGAQKSSVNQFGHDPNSAHEKSAKMEHFHKTHQEKAKKE
>NZ_CP053954.1|WP_000312267.1|720934_721558_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYILFILIVCFRMVSIHYKWHLPHRRIETKERSMHK
>NZ_CP053954.1|WP_000391395.1|719567_720842_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYIGHEKTVKRLLSELEINHIPVITLYNKKDELHQNFIPFPKSDFLMTSAFEESDLLRIKEAIETKMKKEMDRYRVEIPPSEGKLLTLLKTETLLAKMEFLEDKFVYDCAGYIFTHSSLNVQLKRFLVEEGENKNV
>NZ_CP053954.1|WP_000460289.1|718303_719575_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEAGLVDFEAVAAAIHNNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NZ_CP053954.1|WP_000656783.1|717728_718118_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP053954.1|WP_000092763.1|716345_717680_-|type-I-glutamate--ammonia-ligase
MSRYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVRQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFDGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDANGDLQLSDDARHFIAGILKHAPAFTAIANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVVCGALGEHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP053954.1|WP_001102627.1|715588_715912_-|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRKDSYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGETQFHLLVTEWCDFAKGVQEIIEGVEWDE
>NZ_CP053954.1|WP_000031383.1|715053_715596_-|DUF1700-domain-containing-protein
MSKEGFLKELSSYLRKLPEEERQDILLDYEEHFQFGLEEGKTESEIIQGLGSPKVIAKELLAMYRFDEMKKNPSTSNVTRAVMAAIGLSLFNFIIVLGPLVAIIAFIFSFWIGGIASVVTPFFVIGKVFMGTFIWLDLFVSITFVGVGLLLCIIAFYSTKWFKRLCVRYVIWNFKMIKGE
>NZ_CP053954.1|WP_000813896.1|727301_727526_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP053954.1|WP_000504957.1|727547_728501_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSINLAKALNGEIISGDSMQIYRTMDIGTAKVTKAEMDGIPHYMIDIKNPEDSFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSEQIEKQEKELLYDVSLIGLTMDREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFENRVSLEDAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTNGEKTSEILRYIEGKLQVKSNNSK
>NZ_CP053954.1|WP_087948597.1|728681_728927_+|hypothetical-protein
MKQSTINFSSLTKDLILATSIKEQNCSQKELYFALNCLLRAFHSTLHETTLHLENKNTEYIQTQFCSAYKIITGKTIYPFQ
>NZ_CP053954.1|WP_000734613.1|728989_729940_-|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPNVESKLVGKVLSGNTLDVINTENGWTKIKLNGKEAFVSADFTKSTYYVTAGVLNVRAGANTDSEILGKLNKNDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVIEKKEVVAQEEAPARTNTPVKNNTVVKNKESVKSNDSIKNVESSKPVVKEKPAAKPVAKSTETSAPTGGREITVEATAYTADPSENGSYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIQ
>NZ_CP053954.1|WP_172852536.1|730289_732146_-|PTS-sugar-transporter-subunit-IIA
MKITELLKRDTVIMDLTASNKEAVIDELVEKLNGANRLNSKMEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPSICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDESELLQLFDEKENEKEEEIEVAKPEVNEPYVLAVTACPTGIAHTYMAADSLKAKATELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTETLLNRAVKQDAPIFKGVKEDGKSESIEGEKGLGIYKHLMSGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGKTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAANANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKAVIPPVVALNEMLTGWLNGLNGTNAILLGLILGGMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPLLYIFSILIGTIVSAIMLGVWKKKVQ
>NZ_CP053954.1|WP_172852537.1|732159_733071_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSFDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENIALGFTGGFTGQFIKGVLQAEGVMTNFIQVDGDSRINVKIKGQEETELNGQGPNVTNEQFEQLMKQIESMKQGDCVVLAGSVPASIPTTFYESIAALGAEKGIRVVVDASGSALQHVIKNKPFLIKPNHHELGELFGVELSTVEDVLPYGRKLIEQGIKHVIVSMAGEGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIERAFQYGVATGSATAFSADLCKKEKVEELLSQVIVAKR
>NZ_CP053954.1|WP_002000547.1|733067_733877_-|DeoR/GlpR-transcriptional-regulator
MVDFCDRFHYTVIKEEVNKMLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIANYAASVIEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NZ_CP053954.1|WP_001179092.1|733977_735141_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKDINAEVFELTGVEPNPRVSTVKKGIQICKENGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFANEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPVHTTSVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCEAVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVEENVSRFKQFAIRVFDIETDGKTDKEVALEGIKALRQFWTSIEAPATLADYGIGENEIDIMANKAMAYGEFGNFKKLNKDDVLSIYKASL
>NZ_CP053954.1|WP_000228314.1|735257_735800_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGELHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NZ_CP053954.1|WP_103595474.1|736117_736435_-|hypothetical-protein
MIMEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDMQREPLLNYANVNYEQIPFVIFFMIRFITAIVRKKESDDEECHSTCNIANVF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP053954_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053954_3

1923799-1923923

Orphan

Consensus_repeat	Method
CTTAAACAAGCGTTTGATTAATTCTCCATTTTTCTTTCTTAACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP053954_3

>merge|NZ_CP053954|3|1923799-1923923|CRISPRCasFinder
CTTAAACAAGCGTTTGATTAATTCTCCATTTTTCTTTCTTAACCTTTGAACTACAGGAGTTTCTTCCTACCGAACATACAGCTTAAACAAACGTTTGATTAATTCTCCATTTTTCTTTCTTAACC

>NZ_CP053954|3|2|1923799-1923923|CRISPRCasFinder
CTTAAACAAGCGTTTGATTAATTCTCCATTTTTCTTTCTTAACC	TTTGAACTACAGGAGTTTCTTCCTACCGAACATACAG
CTTAAACAAACGTTTGATTAATTCTCCATTTTTCTTTCTTAACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053954.1\|WP_002062684.1\|1921659_1921968_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_CP053954.1\|WP_000601778.1\|1919725_1920751_-\|methionine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224058
NZ_CP053954.1\|WP_000026896.1\|1922812_1923196_-\|glycine-cleavage-system-protein-GcvH	unknown	unknown	gnl\|CDD\|234918
NZ_CP053954.1\|WP_000416291.1\|1930817_1932602_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173850
NZ_CP053954.1\|WP_001242139.1\|1921162_1921507_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053954.1\|WP_000713771.1\|1924685_1925333_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239481
NZ_CP053954.1\|WP_000722399.1\|1917356_1918163_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP053954.1\|WP_000359401.1\|1919067_1919733_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922
NZ_CP053954.1\|WP_149216684.1\|1929955_1930678_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293807
NZ_CP053954.1\|WP_001180551.1\|1927893_1928079_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053954.1\|WP_065702912.1\|1928225_1928939_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP053954.1\|WP_001002987.1\|1927631_1927880_-\|spore-coat-protein	unknown	unknown	gnl\|CDD\|377935
NZ_CP053954.1\|WP_000218968.1\|1923237_1923603_-\|arsenate-reductase-family-protein	unknown	unknown	gnl\|CDD\|239334
NZ_CP053954.1\|WP_000929160.1\|1916332_1917118_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NZ_CP053954.1\|WP_172852632.1\|1926434_1927538_-\|L-lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|133427
NZ_CP053954.1\|WP_098294023.1\|1929403_1929952_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379115
NZ_CP053954.1\|WP_172852630.1\|1918232_1919045_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP053954.1\|WP_172852631.1\|1924014_1924542_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053954.1\|WP_000666172.1\|1925398_1926412_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|379113
NZ_CP053954.1\|WP_000640870.1\|1921971_1922316_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224572

Protein	Function_ID	Function_description	E-value
NZ_CP053954.1\|WP_002062684.1\|1921659_1921968_-\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	7.89621e-18
NZ_CP053954.1\|WP_000601778.1\|1919725_1920751_-\|methionine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224058	COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism].	8.75714e-177
NZ_CP053954.1\|WP_000026896.1\|1922812_1923196_-\|glycine-cleavage-system-protein-GcvH	gnl\|CDD\|234918	PRK01202, PRK01202, glycine cleavage system protein GcvH.	6.96592e-70
NZ_CP053954.1\|WP_000416291.1\|1930817_1932602_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173850	cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase. VLCAD is an acyl-CoA dehydrogenase (ACAD), which is found in the mitochondria of eukaryotes and in some bacteria. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. VLCAD acts as a homodimer.	0
NZ_CP053954.1\|WP_000218968.1\|1923237_1923603_-\|arsenate-reductase-family-protein	gnl\|CDD\|239334	cd03036, ArsC_like, Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine.	6.13259e-61
NZ_CP053954.1\|WP_000713771.1\|1924685_1925333_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239481	cd03386, PAP2_Aur1_like, PAP2_like proteins, Aur1_like subfamily. Yeast Aur1p or Ipc1p is necessary for the addition of inositol phosphate to ceramide, an essential step in yeast sphingolipid synthesis, and is the target of several antifungal compounds such as aureobasidin.	1.59372e-15
NZ_CP053954.1\|WP_000722399.1\|1917356_1918163_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	1.42242e-111
NZ_CP053954.1\|WP_000359401.1\|1919067_1919733_-\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	8.57648e-99
NZ_CP053954.1\|WP_149216684.1\|1929955_1930678_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293807	cd07721, yflN-like_MBL-fold, uncharacterized subgroup which includes Bacillus subtilis yflN; MBL-fold metallo hydrolase domain. This subgroup includes the uncharacterized Bacillus subtilis yflN protein. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	3.80714e-72
NZ_CP053954.1\|WP_065702912.1\|1928225_1928939_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	4.69629e-17
NZ_CP053954.1\|WP_001002987.1\|1927631_1927880_-\|spore-coat-protein	gnl\|CDD\|377935	pfam07875, Coat_F, Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.	9.62029e-15
NZ_CP053954.1\|WP_000929160.1\|1916332_1917118_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	8.75164e-150
NZ_CP053954.1\|WP_172852632.1\|1926434_1927538_-\|L-lactate-dehydrogenase	gnl\|CDD\|133427	cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases. L-2-hydroxyisocapronate dehydrogenase (HicDH) catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. This subfamily is composed of HicDHs and some bacterial L-lactate dehydrogenases (LDH). LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Bacterial LDHs can be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. Members of this subfamily with known structures such as the HicDH of Lactobacillus confusus, the non-allosteric LDH of Lactobacillus pentosus, and the allosteric LDH of Bacillus stearothermophilus, show that they exist as homotetramers. The HicDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0
NZ_CP053954.1\|WP_098294023.1\|1929403_1929952_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379115	pfam13305, WHG, WHG domain. This presumed domain is around 80 amino acids in length. It is found to the C-terminus of a DNA-binding helix-turn-helix domain. This domain may be involved in binding to an as yet unknown ligand that allows a transcriptional regulation response to that molecule. The domain is named WHG after three conserved residues near the C-terminus of the domain.	5.15757e-25
NZ_CP053954.1\|WP_172852630.1\|1918232_1919045_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	4.30964e-112
NZ_CP053954.1\|WP_000666172.1\|1925398_1926412_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|379113	pfam13303, PTS_EIIC_2, Phosphotransferase system, EIIC. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The sugar-specific permease of the PTS consists of three domains (IIA, IIB and IIC). The IIC domain catalyzes the transfer of a phosphoryl group from IIB to the sugar substrate.	1.57356e-86
NZ_CP053954.1\|WP_000640870.1\|1921971_1922316_-\|hypothetical-protein	gnl\|CDD\|224572	COG1658, COG1658, Small primase-like proteins (Toprim domain) [DNA replication, recombination, and repair].	2.03274e-21

>NZ_CP053954.1|WP_000218968.1|1923237_1923603_-|arsenate-reductase-family-protein
MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASEDEMYELLASDGMLIKRPIVTDGTNVTLGFNEEQFESVWKKYQ
>NZ_CP053954.1|WP_000026896.1|1922812_1923196_-|glycine-cleavage-system-protein-GcvH
MSIPNNLRYSEEHEWVKTEGNEVVIGITHFAQGELGDIVFVELPEVGATIEADEPFGSVESVKTVSELYAPVSGKVVAVNEELSDQPELVNESPYEGAWMVKVELSDASQVEKLLTAEKYAEMTNQD
>NZ_CP053954.1|WP_000640870.1|1921971_1922316_-|hypothetical-protein
MIYVEKVIIVEGTSDRRKIESIIREPVEIVCTNGTIGLSKMDELVDQFFDKEVYVLVDADDAGEKLRKQFRKEFPQAEHIYIDRSYREVATAPSTHLANVLWGADIDVYTEYLR
>NZ_CP053954.1|WP_002062684.1|1921659_1921968_-|thioredoxin-family-protein
MIEVIDWTGAEATALIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEGLKIGMLDLNYAPYLAKEYGIESVPCLLVFENGTLMKKIYAFHSVEYLYTELK
>NZ_CP053954.1|WP_001242139.1|1921162_1921507_-|hypothetical-protein
MRLYSLLQSFVNYANGQYHLEPLLRQEEKTVNFRFGDESCSLQISRDYIELVHEERGTEQIICLDEKDIEQLVNGNVRLQMLMNDGRVQYSGTYRTMLLVESMFHICKPMSVGA
>NZ_CP053954.1|WP_000601778.1|1919725_1920751_-|methionine-ABC-transporter-ATP-binding-protein
MILLENVKKIYKAKSGDVTAVDNANLKIEKGEIFGVIGYSGAGKSSLIRLFNQLEKPTSGQITIANRVISAITGSELRKARQEIGMIFQHFNLLWSRTVRENIEFPLEIAGVDKAKRRKRVDELIHLVGLEGRGDAYPSQLSGGQKQRVGIARALANNPQVLLCDEATSALDPETTDQILDLLLDINKRLGLTIVLITHEMHVIRKICNRVAVMERGKIVETGPVLDVFRNPKQDITKRFVQQLTDSEDTNETIENLIEKYPDGKVIRLQFIGEAVERPVLQRLMQRSDIEVSILQGNIAQTNNGSYGSLVVHLNGEETAIQQAIEGIHQDQVELEVIAHG
>NZ_CP053954.1|WP_000359401.1|1919067_1919733_-|ABC-transporter-permease
MDKLLANVDWNQMLEATGETLYMTAIAALATFVLGLILGLLLFMTAKDNLWENKSINTVIGAFVNIFRSIPFIILIILLIPFTKILLGTILGASAALPALIIGAAPFYARMVEIALREIDKGVIEASKAMGAKTSTIILKVLIPESLPALVSGITVTTIALVGYTAMAGVVGAGGLGTLAYLEGFQRGNNDVTIVATICVLLVVFLIQWIGDSLTTRIDKR
>NZ_CP053954.1|WP_172852630.1|1918232_1919045_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKRLLLTALISTSIFGLAACGGKDKDEKKLVVGASNVPHAEILEKAKPLLEKKGIELEVKKFQDYVLPNKSLADKELDANYFQHIPYLEKEIKDKKYDFEIAGKIHIEPIGVYSQKYKSLKELPDGATIIMSNSVTDHGRGLAILQKEGILKIKDGVDPVSATPKDIADNPKHLKFKTDIEPGLLPQVYNNKEGDAVLINSNYAIDAKLNPEKDAIAIEGDDSPYANVLVVRKGDKDKKAIKELVEVLHSKEIKDFITKEYKGAVVLVKE
>NZ_CP053954.1|WP_000722399.1|1917356_1918163_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKILLSVVTALSVFTLAACGGKEENKLVVGASNVPHAVILEKAQPILEKKGIKLEIKKFQDYVLPNKALADKEIDANYFQHIPYLDKEIQEKGYKIVNAGKIHLEPMGIYSKKYKSLKDLPDGGTVIMSNNVAERGRMLALLQKGGVIKLKDGVDVVKATVKDVVENPKNLKFKTDVEPGLSPKLYENNEGDALFINSNYAIDAKLNPTKDAIAIEGADSPYANIIAVRKGDEKKKEIKELVEVLHSKEIQDFINKEYKGAVLPVSE
>NZ_CP053954.1|WP_000929160.1|1916332_1917118_-|Fe-S-cluster-assembly-ATPase-SufC
MAGSTLTVKDLHVSIDGKEILKGVNLEVKGGEIHAIMGPNGTGKSTLSSAIMGHPKYEVTEGSIIIDGEDVLEMEVDERAQAGLFLAMQYPSEISGVTNADFLRSAINARREEGDEISLMKFIRTLDKNMEFLEMDPEMAQRYLNEGFSGGEKKRNEILQLMMIEPKIAILDEIDSGLDIDALKVVSKGINEMRGEEFGCLMITHYQRLLNYITPDFVHVMMNGRIVKSGGPELAQRLEAEGYDWIKKELGIEDETTEQEA
>NZ_CP053954.1|WP_172852631.1|1924014_1924542_-|hypothetical-protein
MKRLSYFLFFILICLVGAGCAKDKAGEKLEYNGRALVIGVVGEKPKDTFRNVKFEEMKLEELKKKSKEVDGFLIMKDHFQEASTEQYKNVFSSLKKPVFFIGLQDKSYSIFITKGIEYNSARKDVNAMYTQGFANIGSGEGQQWAIGLSNGGNTEESIHNMYIVVFQTIADYLNR
>NZ_CP053954.1|WP_000713771.1|1924685_1925333_+|phosphatase-PAP2-family-protein
MKKFKLSSFLPLSYILLLVLVSPLYDVLNKSTVHAVDVTTVVDDWIPFVKAFIIPYLLWFPYLYGALIYYCFADRKQYYVTLSSVIFGKLACFSIYYFWQTTVPRPTVVGTDVFSELVRYIYSIDQPVNCFPSIHVLTTFVIMLAAFKRREQHAFEYYILTFFGTLIILSTLFTKQHAFVDAISGMTLASILYFGVQLLLAKEPIRVPVKQNHRM
>NZ_CP053954.1|WP_000666172.1|1925398_1926412_-|PTS-sugar-transporter-subunit-IIC
MKEYIMSRVFKASAGIAQGIFVSLGIGLLIENIGRIVDIPLLITIGVVAKSLMAPAIGAGIAFMLGANGLVIFSAMVAGAIGAGSISITEAGLIIKTGEPIGALLTATLAVYIGKRLSGKTALDMMLVPFAAILGSGLVGIWLSHNITPVLNAVGAFIKDSSAGSPFIASIVIAVVWGLLLISPASSAALAIALSLDGVAGGAALAGCVAQFIGFSVISAKENNLGGILAQALCTPKVQLPNITKNPMILVPTVVASAIVGPVSALIFQLEAGKEIAGLGLSSLIAPINLISSQGWEVLPAMVITYIVIPVAVSYILYIALKKAGRIHSGDMTVPQS
>NZ_CP053954.1|WP_172852632.1|1926434_1927538_-|L-lactate-dehydrogenase
MTKMEYNNSQKGQTLCSIFHKVSMVSIVRTFIIRSVKSKRNRLYDQLGEIAMKRHTRKIAIIGTGLVGSSCAYSIVNQGICEELLLIDINHERAVGEAMDLSHCINFTNTRTKVYAGSYEDCKDMDIVIITAGPAPKPGQSRLDTLGASAKIMESVVGGVMESGFDGIFLLASNPVDIITYEVWKLSGLPRNRVIGTGTSLDSSRLRTILSEMLHVDPRSIHGYSLGEHGDSQMVAWSHVTVGGKPILQILEEQKERFGKIDLDEIVEKTAKAGWEIYKRKGTTYYGIGNSLAYIASSIFNDDHRVIAVSAILDGEYGEYDICTGVPAIITRDGIREVVELNLTEDEESRFAKSNDILRDYMKTIGY
>NZ_CP053954.1|WP_001002987.1|1927631_1927880_-|spore-coat-protein
MNEKDMVNDYLAGLNASLTSYANYIAQSDNEQLHQTLIQIRNQDEMRQRNMYEYAKQKSYYKPAAPANPMIVQQLKSQLSAE
>NZ_CP053954.1|WP_001180551.1|1927893_1928079_-|hypothetical-protein
MQNLTELEVENLRHLIGGHATIINKLEQYAETCTDPQLKQMLQKDAQDARNTKQQLMTFLG
>NZ_CP053954.1|WP_065702912.1|1928225_1928939_-|CPBP-family-intramembrane-metalloprotease
MSKTVLEAYSVERKIENITYKNLFVMIAMIIGISLLGGLFLGLAFEIYGEEALSTKLEGYYLLLFDAIVVAIVLLAYKPVFHFIKSIWDVSVLKSGKTYLYLLIGFIIIAVSQYLMLHVFSFESAAEQKEQLGSLRLQNSIQSIIYVLSVAIITPVKEEILFRGILYRFLEKRYNFLVSIIISSFIFGILHGGLLITATIMGMVFAMLYKKTQSIIPSIILHIVWNLLVSISMIVSL
>NZ_CP053954.1|WP_098294023.1|1929403_1929952_-|TetR/AcrR-family-transcriptional-regulator
MSPRIGLTLQKIVETAAEIADTNGIQEVTLASLAQRLGIRSPSLYNHVKGLQDVRKNLGIYGIKQLHNKLEEAAEDKRMDEAIHALGEVYVAFVRKHPGLYEATFLRDEEVRKAGDGIVKLCLQVLQQYGLEGENALHATRGFRSICHGFASIEQQGGFGLPLDLDISLHVLLETFIKGLRE
>NZ_CP053954.1|WP_149216684.1|1929955_1930678_-|MBL-fold-metallo-hydrolase
MRMIHEKTLYQLSFLPRAFPVNCYFVEEEDGLTLIDAALPYSAKGILQAAEKIGKPITKIVLTHAHDDHIGALDALKEVLPHVPVYISKRDAKLLEGDTTLQKDEPNIPIKGGVPKKVKTVPDVLLEDGDRVGSLLAIMTPGHTPGSMSFLDVRNKALIVGDAFQTRGGMAVSGQMKFWFPFPAMATWSKEISLQSAEKLSEYEPSLLAAGHGEMIKNPGTVIELAIKEAKRNIESKKEE
>NZ_CP053954.1|WP_000416291.1|1930817_1932602_-|acyl-CoA-dehydrogenase-family-protein
MEKTVGNAVKGGSFLVDEITIDQVFTPEDFSSEHKMIAKTTEDFIVNEVLPELEYLEQHEFDRSVRLLKEAGELGLLGADVPEEYGGIGLDKVSSALIAEKFSRAGGFAITHGAHVGIGSLPIVLFGNEEQKKKYLPLLATGEKLAAYALTEPGSGSDALGAKTTARLNAEGTHYVLNGEKQWITNSAFADVFVVYAKIDGEHFSAFIVEKDYAGVSTSPEEKKMGIKCSSTRTLILEDALVPKENLLGEIGKGHIIAFNILNIGRYKLGVGTVGSAKRAVEISAQYANQRQQFKQPIARFPLIQEKLANMAAKTYAAESSVYRTVGLFESRMSTLSEEEVKDGKAVAASIAEYAIECSLNKVFGSEVLDYTVDEGVQIHGGYGFMAEYEIERMYRDSRINRIFEGTNEINRLIVPGTFLRKAMKGELPLLQKAQKLQEELMMMMPEEVGDEPLALQKYLVTNAKKIGLMVAGLAAQKYGKALDKEQEILVNIADIVSNLYAMESAVLRTEKAIKTTGLEKNKQKVLYTEVFCQEAFNEIEADAKETLIAVENGDMLRMMLSSLRKLTRHTPLNVIPKKREIAAKILEDERYTV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP053954_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053954_4

2214386-2214519

Orphan

Consensus_repeat	Method
GTTGATTTCTCTTCTTTTTGAGA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP053954_4

>merge|NZ_CP053954|4|2214386-2214519|CRISPRCasFinder
GTTGATTTTTCTTCTTTCTTCGGTTCTTCTTTTTTGTCACTAGTTGAACCGCTTGTTGATTTCTCTTCTTTTTGAGACTTGTCTTCTGTTTTACTTTCAGGTTTCGTGCTCGTTGACTTCTCTTCTTTTTGAGA

>NZ_CP053954|4|3|2214386-2214519|CRISPRCasFinder
GTTGATTTTTCTTCTTTCTTCGG	TTCTTCTTTTTTGTCACTAGTTGAACCGCTT
GTTGATTTCTCTTCTTTTTGAGA	CTTGTCTTCTGTTTTACTTTCAGGTTTCGTGCTC
GTTGACTTCTCTTCTTTTTGAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053954.1\|WP_000393110.1\|2209436_2210180_-\|capsular-polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|226453
NZ_CP053954.1\|WP_000568222.1\|2225028_2226891_-\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836
NZ_CP053954.1\|WP_001207164.1\|2208745_2209447_-\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP053954.1\|WP_097842330.1\|2222007_2223528_-\|NADH-quinone-oxidoreductase-subunit-NuoN	unknown	unknown	gnl\|CDD\|235603
NZ_CP053954.1\|WP_000008903.1\|2214063_2214198_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053954.1\|WP_000544012.1\|2213483_2213756_-\|sporulation-transcriptional-regulator-SpoIIID	unknown	unknown	gnl\|CDD\|378813
NZ_CP053954.1\|WP_002097926.1\|2207866_2208634_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226870
NZ_CP053954.1\|WP_000144441.1\|2215407_2216112_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925
NZ_CP053954.1\|WP_000672663.1\|2218242_2219262_-\|stage-II-sporulation-protein-D	unknown	unknown	gnl\|CDD\|274332
NZ_CP053954.1\|WP_084063842.1\|2217134_2218142_-\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP053954.1\|WP_000362293.1\|2206038_2206725_-\|sugar-transferase	unknown	unknown	gnl\|CDD\|376775
NZ_CP053954.1\|WP_000411274.1\|2219468_2220773_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NZ_CP053954.1\|WP_050822177.1\|2206742_2207624_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NZ_CP053954.1\|WP_000057889.1\|2221568_2221805_-\|DUF1146-domain-containing-protein	unknown	unknown	gnl\|CDD\|227173
NZ_CP053954.1\|WP_002005985.1\|2220812_2221523_-\|YwmB-family-TATA-box-binding-protein	unknown	unknown	gnl\|CDD\|370056
NZ_CP053954.1\|WP_000457978.1\|2212321_2213323_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237563
NZ_CP053954.1\|WP_000931959.1\|2211459_2211894_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	unknown	unknown	gnl\|CDD\|234568
NZ_CP053954.1\|WP_172852649.1\|2223529_2225032_-\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NZ_CP053954.1\|WP_000467941.1\|2210438_2211116_-\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP053954.1\|WP_000170864.1\|2216111_2216954_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054

Protein	Function_ID	Function_description	E-value
NZ_CP053954.1\|WP_000393110.1\|2209436_2210180_-\|capsular-polysaccharide-biosynthesis-protein	gnl\|CDD\|226453	COG3944, COG3944, Capsular polysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane].	1.60281e-83
NZ_CP053954.1\|WP_000568222.1\|2225028_2226891_-\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0
NZ_CP053954.1\|WP_001207164.1\|2208745_2209447_-\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	8.02666e-84
NZ_CP053954.1\|WP_097842330.1\|2222007_2223528_-\|NADH-quinone-oxidoreductase-subunit-NuoN	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	3.67718e-150
NZ_CP053954.1\|WP_000544012.1\|2213483_2213756_-\|sporulation-transcriptional-regulator-SpoIIID	gnl\|CDD\|378813	pfam12116, SpoIIID, Stage III sporulation protein D. This stage III sporulation protein is a small DNA-binding family that is essential for gene expression of the mother-cell compartment during sporulation. The domain is found in bacteria and viruses, and is about 40 amino acids in length. It has a conserved RGG sequence motif.	1.17272e-38
NZ_CP053954.1\|WP_002097926.1\|2207866_2208634_-\|hypothetical-protein	gnl\|CDD\|226870	COG4464, CapC, Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	1.45014e-105
NZ_CP053954.1\|WP_000144441.1\|2215407_2216112_-\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	0.00105718
NZ_CP053954.1\|WP_000672663.1\|2218242_2219262_-\|stage-II-sporulation-protein-D	gnl\|CDD\|274332	TIGR02870, Stage_II_sporulation_protein_D, stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination].	5.80584e-135
NZ_CP053954.1\|WP_084063842.1\|2217134_2218142_-\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.8738e-31
NZ_CP053954.1\|WP_000362293.1\|2206038_2206725_-\|sugar-transferase	gnl\|CDD\|376775	pfam02397, Bac_transf, Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.	8.0825e-104
NZ_CP053954.1\|WP_000411274.1\|2219468_2220773_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NZ_CP053954.1\|WP_050822177.1\|2206742_2207624_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	0
NZ_CP053954.1\|WP_000057889.1\|2221568_2221805_-\|DUF1146-domain-containing-protein	gnl\|CDD\|227173	COG4836, COG4836, Predicted membrane protein [Function unknown].	1.23409e-23
NZ_CP053954.1\|WP_002005985.1\|2220812_2221523_-\|YwmB-family-TATA-box-binding-protein	gnl\|CDD\|370056	pfam08680, DUF1779, TATA-box binding. TATA-box_bdg is a family of bacterial proteins. YwmB from Bacillus subtilis contains a circularly permuted TATA-box binding protein-like fold. Jian-Xiang Liu, Qi Xie, Jun Lin. Protein Structural Data Mining and Evolutionary Bioinformatic Analysis on Domains of TATA-box Binding Protein-like Fold. Life Science Journal 2014; 11(2): 298-302 (not yet in PubMed 27-02-2014).	5.16446e-34
NZ_CP053954.1\|WP_000457978.1\|2212321_2213323_-\|rod-shape-determining-protein	gnl\|CDD\|237563	PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional.	0
NZ_CP053954.1\|WP_000931959.1\|2211459_2211894_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	gnl\|CDD\|234568	PRK00006, fabZ, 3-hydroxyacyl-ACP dehydratase FabZ.	5.26499e-95
NZ_CP053954.1\|WP_172852649.1\|2223529_2225032_-\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	4.20415e-177
NZ_CP053954.1\|WP_000467941.1\|2210438_2211116_-\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	1.09777e-81
NZ_CP053954.1\|WP_000170864.1\|2216111_2216954_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.84744e-90

>NZ_CP053954.1|WP_000008903.1|2214063_2214198_-|hypothetical-protein
MSFLFVLSTAIILLFVLFTLYYYIAGKKEVPHHQLLEEELEREE
>NZ_CP053954.1|WP_000544012.1|2213483_2213756_-|sporulation-transcriptional-regulator-SpoIIID
MHDYIKERTIKIGKYIVETRKTVRVIAKEFGVSKSTVHKDLTERLPEINPELANEVKEILDYHKSIRHLRGGEATKQKYRKEDVEKPVRQ
>NZ_CP053954.1|WP_000457978.1|2212321_2213323_-|rod-shape-determining-protein
MFARDIGIDLGTANVLIHVKGKGIVLNEPSVVAIDRNSGKVLAVGEEARSMVGRTPGNIVAIRPLKDGVIADFEITEAMLKYFINKLDVKSFFSKPRILICCPTNITSVEQKAIREAAERSGGKTVFLEEEPKVAAVGAGMEIFQPSGNMVVDIGGGTTDIAVLSMGDIVTSSSIKMAGDKFDMEILNYIKRKYKLLIGERTSEDIKIKVGTVFPGARSEELEIRGRDMVTGLPRTITVCSEEITEALKENAAVIVQAAKGVLERTPPELSADIIDRGVILTGGGALLHGIDMLLAEELKVPVLIAENPMHCVAVGTGIMLENIDRLPKRALR
>NZ_CP053954.1|WP_000931959.1|2211459_2211894_-|3-hydroxyacyl-ACP-dehydratase-FabZ
MLNIEQIKEIIPHRYPFLLVDKILEVDEGKRAVGIKNVSANEEFFNGHFPDYAVMPGVLIVEALAQVGAVAVLKKEENRGRLAFFAGIDNCRFKKQVRPGDQLRLEVEMTRVRGPIGKGKAIATVDGEVACEAEITFAIGDKKE
>NZ_CP053954.1|WP_000467941.1|2210438_2211116_-|CpsD/CapB-family-tyrosine-protein-kinase
MFGRKKRKPLRQLITHKEPKSRITEQYRNIRTNIEFTSVDNHVRSIIVTSADPGDGKTTTIANLAVVFGQQGKKVLLIGADLRKPTIQNLFAIHISNGLTNLLSGQAKLMQCIQKTDIENVYLMAAGPIPPNPAELLGSRAMDEALLEAYNMFDIILIDTPPVLAVTDAQILANKCDGIVLVVRSEKTEKDKIVKAKQILDKASGKILGVVLNDKREEKEQYGYY
>NZ_CP053954.1|WP_000393110.1|2209436_2210180_-|capsular-polysaccharide-biosynthesis-protein
MEETISLKDLFHILKKRLAMILVIAFGAAIVSAIVSFFFMTPIYQSSTQILVNQKKQEGSSIQLGEIQSNIQLTNTYKVIIKSPVILDQVNEKLNLNMTAQALTGKINVANEKDSQVISLTVEDKDPKLARDIANATADVFKGEVAKIMSVDNVTVLSKAEVAENQSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKVRGQTIGS
>NZ_CP053954.1|WP_001207164.1|2208745_2209447_-|CpsD/CapB-family-tyrosine-protein-kinase
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>NZ_CP053954.1|WP_002097926.1|2207866_2208634_-|hypothetical-protein
MIDLHCHILPGIDDGAQTVTDSLAMAQQAVSEGIHTIVATPHHQNGKYINERTSIIHHVKQLNDELQQHNIPLTILPGQEVRLYGDLLEDYEADKIVTLNETNKYIFIEFPSNHVPRYAEQLLYELRVKGMIPIIVHPERNAELIERPDKLYNLVNKGALTQVTAGSLLGKFGKKIKKFSLQLVEHNLTHMVASDAHNTTSRGFHLAESYELIEKEFGMNVMSDLKENPYLLISGKAIYKEDPEQIRRKKLFGIF
>NZ_CP053954.1|WP_050822177.1|2206742_2207624_-|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQSLLEKGKHEMLEKVQASSKINIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIVQAKTPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPIEQSDRRYQVRQFVEKPAQGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQRVFAYDFEGTRYDVGEKLGFIKTTIEVALQQTELKEELIDYIRALAMKESVHV
>NZ_CP053954.1|WP_000362293.1|2206038_2206725_-|sugar-transferase
MDLAKVSSRDVAKEKNEEIDFEKVNSRKVYLVSKRCMDFIGALCGLIVLSPIFIVIAFLIKYEDSKGPVFFKQVRVGKNGKEFYMYKFRSMVTDAEEKLQDLLKYNEVSGAMFKMKEDPRVTRIGKFIRKTSLDELPQLLNVLKGEMSLVGPRPPLPREVEEYTQYDKQRLFVTPGCAGLWQVTERNSVGFKEMVELDLEYINKRSLSYDLKIILKTIQIMIRSNGAS
>NZ_CP053954.1|WP_000144441.1|2215407_2216112_-|ABC-transporter-permease
MTFSMRRVSAIFRKEVQDFKTNSQVLLMAFLPIILSFLFSRFGAGKEMLGITTITAFLFVAGFVQSMVIAEEKEKHTLRVLMLSPASSVEVLLGKSILTACLTLGICIVNLFILDQFSGNLLLLGFIFLCGTILFIVIGTMIGLLAASVPQTSIIGMPILMTMYLAVQFEPMVENKVIKTMIGYLPTSHIVKALNSLVGGAGFGSISGHVLNVAVWLIISLFVCLIVYKKKQLD
>NZ_CP053954.1|WP_000170864.1|2216111_2216954_-|ABC-transporter-ATP-binding-protein
MTLAIEMKDVMKSFSGKTALRNVNIEVKQGEIFGFLGPSGSGKTTTVKILTSQLLHSVGTVRVLGKDITGPSSIDYKRIGILTDNSGLYERLSIYDNLLLFCDLYDCKKERIDEVLAQVNLLDDKKTPVKKLSKGMKQRVTLARAILHKPDILFLDEPTSALDPVNVQNIHKILKDLNKEGTTIFLTTHNMDEAETLCNRIAFLCGGEIVALDTPENLRLQYAKDQIQVVLKDKKKETVQKDELGAKRISEWMNKGELLSIHSHEPTLGDIFIEVTGRGL
>NZ_CP053954.1|WP_084063842.1|2217134_2218142_-|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein
MALLELKQLGKTNQLPEIELKVEKGQCIVLQCNNHTAKVLHRIIIGEEEASTGNVLFEGEAIGKKNYFRIGFCFLKDEAYDRLKVKEYFKFLLGLYESKVSIEEVVQYVGLLDKLNVKIEKLSFSEKRRLHIGRIMIHNPDLVILEEPEQNVDTESTIIIRKAIMKMKEQGKAIFITSSFLSDALSLTEDVYILNNDGVKKVEIEQEEVEEVGEEKVIQMIPQMKLERIPAKVNDKIILLDPMEIHFIETQNGVTHIHVREGDFVCALTLSELEARLTGFGFFRCHRSYLVNLQRVREVITWTRNSFSLILDDERKSSIPLSKGRMDELKGVIGL
>NZ_CP053954.1|WP_000672663.1|2218242_2219262_-|stage-II-sporulation-protein-D
MKFSKPLFITVALLIALVIIVPAALVIPFAKAKVGEETASKTPPAIESIPAPGKVDTAVQVAVYREKQKKVETLPVEEYVTGVVASEMNASFEIEALKAQALAARTFVVQRMLSGGKKNNADVTDTVKDQVYKSKDELKKQWGNNYENNLKKIEEAVSKTAGQVLTYDGKPISASFFSTSNGRTENAADYWGNDYPYLKSVDSPWDQASPKFTSEQTFTVADFQKRLGVKVLADGKVGNIKDLTEGKRVKDVAFQGKTLTGKEVREKLDLRSSDFTWKQQGDKIIVTTKGFGHGVGMSQYGANGMAAEGKKYTDIVAHYYKGVEIKTMNDYEGKLMVKK
>NZ_CP053954.1|WP_000411274.1|2219468_2220773_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRHLNAEVVFENNQVTIDSSKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIGSRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKGTTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTFMVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPHPGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNSLQGAEVAATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVNFHKKLAALGATIERVNEKVEEVKEQEVSDLHA
>NZ_CP053954.1|WP_002005985.1|2220812_2221523_-|YwmB-family-TATA-box-binding-protein
MKLKLKAILIVALSVVLFLVGYREMKPISDEQKMESMIKALEKNDAKVEKWSWLARETKTISNIHTFQKLLNDVKEKANIQKWEVEQSPDGYKATSYKKLSSYEERVVVTWSKENTKENTFIIFEVSGAKWDPKYVQNMNKIFSEKPIIYTCVQGVLNDKIEGVLQNKTNQVLKDLSARAIEQVEERAFVSVSAYNKKWDDALSTNREKINVQIAIRSTDNKDTIVVGTPIITSEY
>NZ_CP053954.1|WP_000057889.1|2221568_2221805_-|DUF1146-domain-containing-protein
MAQLLGQQALIAIVSHLLFITITWWALQGIHIERLMKSGKVLQTRVLLILITIAIGTSVSNFFLDYLGYSKSLTYLVK
>NZ_CP053954.1|WP_097842330.1|2222007_2223528_-|NADH-quinone-oxidoreductase-subunit-NuoN
MDMNTLLSLSWHLMVPEFIILGAAILLSICDLFFKLNHRYVALGAIAAIVLAIVSLITLYSEPAGDILNGSFVLDGFSKGFKTLLLGASALILCTAMSDDKKNPIEDKGEYYYLFLMALLGAMFMASSVDFITLFVGLELLSLSSYILVGIRKKSRASNEAAMKYVISGGIGTAITLFGMSYLYGITGSTNIVDMQKVLTGELASGIQLLLALAFLLLLVGLSFKIATVPFHMWAPDVYEGAATPVTAFLGTISKIAGFLLIIRLFLMVFASVLIQGDMQSLYGHMSIYIAVLASITMIVGNVVALKQYNIKRLFAYSGIAHAGYLLVPLVALSPFTMDSMWFYMLAYMLMNIGAFAIIHGLILQNDEENITIFTGLYKRSPFAAIMMTIFILSLAGIPGTAGFIGKVNIFLGALHVEPAHYVLASIMMGTTVVSFVYYFRILQQMFFRTGETEERIRLPLNIKVVMSLCAISIVILGIMPMIGYNFFYEYFPLMKDFFFLGNVVQ
>NZ_CP053954.1|WP_172852649.1|2223529_2225032_-|NADH-quinone-oxidoreductase-subunit-M
MNDLLLTFFIFSPLLGILLLVLTPKKELRTVRALGLFGTALPFGIAIVLACTYASGKNLSLFDEKVKWIKFGDFTAVDKRWFSIYYELGIDGLSLVMMVLTALLAMLAAIAAFSIKRNLKAFYMLLLMLEIGMLGVFAAQNLMLFFIFFEITLPPMFLLIGKWGKLSSEKAAYSYLIYNGIGSAILLIVFSILFAKTGTTNIVELKEILRSVIAEGELVIPSSLQLGVFISIMIAFAIKLPVFPLHRWMVNVHIEAHPAVVMLHAGVLLKIGAYGIIRFGKGLFPEYFHDVATLIAILGVINLLYGAFLALIQTDFRKVLAYSSISHMGIVLMGLASLNAPGTQGALFQVVSHGLIAALLFFLLGVIEQRFGTSDITVLGGLAKSVPILSGFFLAGGMASLGLPGMSGFVSEFLAFLGLFQGEPVIAAVGVIGIILTAVYVLRATLQVTFGKKEWEAKSDIHGWEYVPVLLLIFCIIAIGVMPELLGDPLQNTLKTLGVK
>NZ_CP053954.1|WP_000568222.1|2225028_2226891_-|NADH-quinone-oxidoreductase-subunit-L
MIDYAWLIPLFPLVSFLLLIIFGKKIREGSSVLSIFFVFLSFILAVLVLIERFSEASVKHKWVWLRAGDVDISFGFEVTALGALMLFIVTLVSLLVHVYSKGYMKGDERLPTFYAYLGLFTFAMLGLVISTNLLQLYIFWELVGLGSFLLIGFYFFKEEAKAAAKKAFIMTRIGDVGLFIGMILIFWYAGSFEYDAIFRAIYTGDLPPYMITITAILIFIGAMGKSGQFPLHTWLPDAMEGPTPVSALIHAATMVAAGVYLVATMFPLFSASTVAMQTVAIVGAFTAIFAASIGLVQTDIKRVLAYSTVSQLGYMMLALGSAGYVAGIFHLTTHAFFKALLFLAAGSVIHAVHTQNINKMGGLQKKMKVTGTLFLIGTLAISGVPLLSGFFSKDEILAATWMNGNYVLFTLAVIAAFLTAFYMFRLYFLVFTGETKTKEEVHESPRVMTYPMIVLGVLAVVAGYINTPWFGTFLGDWLTKDVGFKVEEAHGPVWIMIVATLVSFAGIALAYFIYCKKSISRDWAGGTETSLYNLLKEKYYVDELYNMTVIPITKGIAHVLRLFEVYVVEGIAVLIGSVVKGTSNLGSKLQNGNVQVYGTVTAVSLAVLVIILLYTGGDLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP053954_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053954_5

3064170-3064242

Orphan

Consensus_repeat	Method
ATCATCATCATGGAGGACACAATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP053954_5

>merge|NZ_CP053954|5|3064170-3064242|CRISPRCasFinder
ATCATCATCATGGAGGACACAATCATGGTGGACATCATCACCATGGAGGACACAATCATGGTGGACATCATCA

>NZ_CP053954|5|4|3064170-3064242|CRISPRCasFinder
ATCATCATCATGGAGGACACAATCA	TGGTGGACATCATCACCATGGAG
GACACAATCATGGTGGACATCATCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053954.1\|WP_000095905.1\|3056760_3057951_+\|glycine-C-acetyltransferase	unknown	unknown	gnl\|CDD\|235893
NZ_CP053954.1\|WP_000760054.1\|3053895_3054954_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP053954.1\|WP_058840041.1\|3055815_3056547_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP053954.1\|WP_097797265.1\|3059020_3059443_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239217
NZ_CP053954.1\|WP_098596037.1\|3069860_3070571_+\|trehalose-operon-repressor	unknown	unknown	gnl\|CDD\|274116
NZ_CP053954.1\|WP_000743031.1\|3062388_3063918_-\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|171510
NZ_CP053954.1\|WP_000185796.1\|3074954_3076061_-\|GerAB/ArcD/ProY-family-transporter	unknown	unknown	gnl\|CDD\|281794
NZ_CP053954.1\|WP_000139248.1\|3076041_3077544_-\|spore-germination-protein-GerKA	unknown	unknown	gnl\|CDD\|377020
NZ_CP053954.1\|WP_001248850.1\|3059480_3061364_-\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|226921
NZ_CP053954.1\|WP_000513940.1\|3070713_3072141_+\|PTS-system-trehalose-specific-EIIBC-component	unknown	unknown	gnl\|CDD\|273916
NZ_CP053954.1\|WP_000484128.1\|3073849_3074974_-\|Ger(x)C-family-spore-germination-protein	unknown	unknown	gnl\|CDD\|274338
NZ_CP053954.1\|WP_087874946.1\|3066794_3067954_+\|IS3-like-element-ISBth8-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP053954.1\|WP_065704889.1\|3077732_3078704_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|225213
NZ_CP053954.1\|WP_000893350.1\|3064984_3066688_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236645
NZ_CP053954.1\|WP_000723125.1\|3057995_3058961_+\|L-threonine-3-dehydrogenase	unknown	unknown	gnl\|CDD\|187580
NZ_CP053954.1\|WP_001167962.1\|3054966_3055788_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP053954.1\|WP_000925232.1\|3052894_3053899_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP053954.1\|WP_098869247.1\|3072154_3073816_+\|alpha,alpha-phosphotrehalase	unknown	unknown	gnl\|CDD\|274115
NZ_CP053954.1\|WP_000892973.1\|3061367_3062261_-\|MoxR-family-ATPase	unknown	unknown	gnl\|CDD\|223786
NZ_CP053954.1\|WP_172852718.1\|3068010_3069408_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|129983

Protein	Function_ID	Function_description	E-value
NZ_CP053954.1\|WP_000095905.1\|3056760_3057951_+\|glycine-C-acetyltransferase	gnl\|CDD\|235893	PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzyme A ligase; Provisional.	0
NZ_CP053954.1\|WP_000760054.1\|3053895_3054954_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.69127e-87
NZ_CP053954.1\|WP_058840041.1\|3055815_3056547_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	8.94245e-21
NZ_CP053954.1\|WP_097797265.1\|3059020_3059443_+\|NUDIX-hydrolase	gnl\|CDD\|239217	cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzymes. Substrate specificity is used to define child families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. This superfamily consists of at least nine families: IPP (isopentenyl diphosphate) isomerase, ADP ribose pyrophosphatase, mutT pyrophosphohydrolase, coenzyme-A pyrophosphatase, MTH1-7,8-dihydro-8-oxoguanine-triphosphatase, diadenosine tetraphosphate hydrolase, NADH pyrophosphatase, GDP-mannose hydrolase and the c-terminal portion of the mutY adenine glycosylase.	1.42964e-24
NZ_CP053954.1\|WP_098596037.1\|3069860_3070571_+\|trehalose-operon-repressor	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	1.01272e-130
NZ_CP053954.1\|WP_000743031.1\|3062388_3063918_-\|cardiolipin-synthase	gnl\|CDD\|171510	PRK12452, PRK12452, cardiolipin synthase.	0
NZ_CP053954.1\|WP_000185796.1\|3074954_3076061_-\|GerAB/ArcD/ProY-family-transporter	gnl\|CDD\|281794	pfam03845, Spore_permease, Spore germination protein.	4.13579e-40
NZ_CP053954.1\|WP_000139248.1\|3076041_3077544_-\|spore-germination-protein-GerKA	gnl\|CDD\|377020	pfam03323, GerA, Bacillus/Clostridium GerA spore germination protein.	0
NZ_CP053954.1\|WP_001248850.1\|3059480_3061364_-\|VWA-domain-containing-protein	gnl\|CDD\|226921	COG4548, NorD, Nitric oxide reductase activation protein [Inorganic ion transport and metabolism].	9.09532e-99
NZ_CP053954.1\|WP_000513940.1\|3070713_3072141_+\|PTS-system-trehalose-specific-EIIBC-component	gnl\|CDD\|273916	TIGR01992, phosphotransferase_system_trehalose_permease, PTS system, trehalose-specific IIBC component. This model represents the fused enzyme II B and C components of the trehalose-specific PTS sugar transporter system. Trehalose is converted to trehalose-6-phosphate in the process of translocation into the cell. These transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci and Streptococci which contain their own A domain as a C-terminal fusion. This family is closely related to the sucrose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively). In E. coli, B. subtilis and P. fluorescens the presence of this gene is associated with the presence of trehalase which degrades T6P to glucose and glucose-6-P. Trehalose may also be transported (in Salmonella) via the mannose PTS or galactose permease systems, or (in Sinorhizobium, Thermococcus and Sulfolobus, for instance) by ABC transporters.	0
NZ_CP053954.1\|WP_000484128.1\|3073849_3074974_-\|Ger(x)C-family-spore-germination-protein	gnl\|CDD\|274338	TIGR02887, Spore_germination_protein_B3, germination protein, Ger(x)C family. Members of this protein family are restricted to endospore-forming members of the Firmicutes lineage of bacteria, including the genera Bacillus, Clostridium, Thermoanaerobacter, Carboxydothermus, etc. Members are nearly all predicted lipoproteins and belong to probable transport operons, some of which have been characterized as crucial to germination in response to alanine. Members typically have been gene symbols gerKC, gerAC, gerYC, etc. [Transport and binding proteins, Amino acids, peptides and amines, Cellular processes, Sporulation and germination].	8.07429e-93
NZ_CP053954.1\|WP_087874946.1\|3066794_3067954_+\|IS3-like-element-ISBth8-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.81378e-56
NZ_CP053954.1\|WP_065704889.1\|3077732_3078704_+\|phosphotransferase	gnl\|CDD\|225213	COG2334, COG2334, Putative homoserine kinase type II (protein kinase fold) [General function prediction only].	6.45046e-32
NZ_CP053954.1\|WP_000893350.1\|3064984_3066688_+\|EAL-domain-containing-protein	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	1.03886e-109
NZ_CP053954.1\|WP_000723125.1\|3057995_3058961_+\|L-threonine-3-dehydrogenase	gnl\|CDD\|187580	cd05272, TDH_SDR_e, L-threonine dehydrogenase, extended (e) SDRs. This subgroup contains members identified as L-threonine dehydrogenase (TDH). TDH catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)-dependent oxidation. This group is distinct from TDHs that are members of the medium chain dehydrogenase/reductase family. This group has the NAD-binding motif and active site tetrad of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	0
NZ_CP053954.1\|WP_001167962.1\|3054966_3055788_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	4.08785e-133
NZ_CP053954.1\|WP_000925232.1\|3052894_3053899_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.73454e-87
NZ_CP053954.1\|WP_098869247.1\|3072154_3073816_+\|alpha,alpha-phosphotrehalase	gnl\|CDD\|274115	TIGR02403, Trehalose-6-phosphate_hydrolase, alpha,alpha-phosphotrehalase. Trehalose is a glucose disaccharide that serves in many biological systems as a compatible solute for protection against hyperosmotic and thermal stress. This family describes trehalose-6-phosphate hydrolase, product of the treC (or treA) gene, which is often found together with a trehalose uptake transporter and a trehalose operon repressor.	0
NZ_CP053954.1\|WP_000892973.1\|3061367_3062261_-\|MoxR-family-ATPase	gnl\|CDD\|223786	COG0714, COG0714, MoxR-like ATPases [General function prediction only].	6.34644e-37
NZ_CP053954.1\|WP_172852718.1\|3068010_3069408_-\|amino-acid-permease	gnl\|CDD\|129983	TIGR00905, Arginine/ornithine_antiporter, transporter, basic amino acid/polyamine antiporter (APA) family. This family includes several families of antiporters that, rather commonly, are encoded next to decarboxylases that convert one of the antiporter substrates into the other. This arrangement allows a cycle that can remove proteins from the cytoplasm and thereby protect against acidic conditions. [Transport and binding proteins, Amino acids, peptides and amines].	1.82132e-97

>NZ_CP053954.1|WP_000743031.1|3062388_3063918_-|cardiolipin-synthase
MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGALWSITIVGISFVIFIENRSPQSTLAWFLVLALLPIIGVLLYAIFGRSRWRRKKHLHRSEEQRKLFREILEGRRLELLLTVPLNERSIHLTEVIQKFGGGPAADKTTTKLLTNGDQTFSEILRAIEQAKHHIHIQYYIYKSDEIGTKVRDALIQKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIEIVEFDPIFSAWLLETVNYRNHRKIVIVDGKIGFTGGLNVGDEYLGRSKKFPVWRDSHLKIEGKALYKLQAIFLEDWLYASSGLNTYSWDQFMNRQYFPGKEISNAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAIAGIDVRILYPGKSDSIISDQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDTIATIGTANMDVRSFELNYEIISVLYESKTVHDIKRDFEEDFKHSTEIKWNSFQKRSIKKRILESFMRLISPLL
>NZ_CP053954.1|WP_000892973.1|3061367_3062261_-|MoxR-family-ATPase
MLEQFHIHADLKQQLSTIHEKNKQEAGENAHLIGTKIYKASDNSIIEDAITALLLGKNILLKGPTGSGKTVLAETLSSLFQKPMHSINCSVDLDVEGILGYNTLQTKDGASEVSFVNGPLMKAMKNGHFLYIDEINMAKPETLPLLHGALDYRKMITNPFTQEVVYGDDEYRVIAAINEGYVGTSELNEALKNRFVIIEVPYIQGDTLKELLLAESKLNDVATIEKFVAFASDLMPLARDGRVSEEAASIRGIIDACDLGVYIPVMRAIERSIIAKLNDETEQMTVRELAESYFFEG
>NZ_CP053954.1|WP_001248850.1|3059480_3061364_-|VWA-domain-containing-protein
MRQIFSDKKIDASLFLQMENLMYALLKEDDAYLEYGYKAYYDEIEKKVVISHFWDDRKEEDTVIGLKSEVFLKALGNKHYSDMTLIRSYAIELQESPLKKFLTQLFVLLEDLRVEEIVKNLRPGTKHVFKRRKEMYRNYFGSQNEINRVRNYHGDRLFCLCYLSLTSDKYEMFNNEYFEQIEAILHETFQARNTEDIMYIVEKIRYRLEALLESDMLNNYFGHAPLYLSVLADEKNCRVEDLANDDTQLIDDDENKNKMDESFSTWHRENKNNENENFLRFELESGTKTNMMGDTARESEDGDQALGSVQGTSQKSTQSNFDGADTEEARASHASSQHDGAYGKYNVGASHTFKEARKANSDEKKDYQAIKSVVNKDVKELKKIIEKTIENKTNANSDKYYGRLRKKFLRIYTEKQPRMFYKKGQESQELDVAFQLLVDCSGSMYNKMEETKKSVVLFHEALKSLKIPHAISGFWEDASSAKPEDKPNVIHEVVNYKNSTLPNVGPEIMQLREEEDNRDGYIIRIVSEKLAKRPEKHKFLLVFTDGEPSALDYQQDGILDTHEAVKLARKSGMEVIGIFIEEGEAKEATYQLMKNIYNHHFLVANHAEDLRLKIKPLLKKLLLKTIE
>NZ_CP053954.1|WP_097797265.1|3059020_3059443_+|NUDIX-hydrolase
MQRVDVVYALIHDEETDKILMVHNVEQNVWSLPGGAVEKGEILEEALIREVKEETGLAATLSGLVAINEKFFEESGNHALFFTFRANVVKGELIAEDEGEISAIEWVDRTIANERFPYYDGGFESLLEIAIPYKFQPETK
>NZ_CP053954.1|WP_000723125.1|3057995_3058961_+|L-threonine-3-dehydrogenase
MKKILVTGSLGQIGSELVMKLRDVYGASNVIATDIRETDSEVVTSGPFETLDVTDGQKLHDIAKRNEVDTIIHLAALLSATAEKNPLFAWNLNMGGLVNALEAARELNCKFFTPSSIGAFGPSTPKDNTPQDTIQRPTTMYGVNKVAGELLCDYYHQKFGVDTRGVRFPGLISYVAPPGGGTTDYAVEIYYEAIKKGAYTSYIAEGTYMDMMYMPDALQAIISLMEADPSKLVHRNAFNITAMSFEPEQIAASIRKHIPTFTMDYAVDPARQTIADSWPNSIDATAAMKEWGFKAEYDLDKMTTDMLAKLKKKLTAELVMN
>NZ_CP053954.1|WP_000095905.1|3056760_3057951_+|glycine-C-acetyltransferase
MSSKTLAKFLEENLEDLKSKGLYNVIDPLESSNGPIITIGGKEYINLSSNNYLGLATDSRLQEAAIGAIHKYGVGAGAVRTINGTLDLHIKLEETIAKFKHTEAAIAYQSGFNCNMAAISAVMDKNDAILSDELNHASIIDGSRLSKAKIIVYKHSDMEDLRQKAIAAKESGLYNKLMVITDGVFSMDGDVAKLPEIVEIAEELDLMTYVDDAHGSGVLGKGAGTVKHFGLSDKVDFQIGTLSKAIGVIGGYVAGKQNLIDWLKVRSRPFLFSTALTPADAAACMRSIEILMESTELHDRLWENGRYLKQGLKELGFNIGESETPITPCIIGDEVLTQEFSKRLNEEGVYAKSIVFPTVAKGTGRVRNMPTAAHTKEMLDEAILKYEKVGKEMGII
>NZ_CP053954.1|WP_058840041.1|3055815_3056547_-|class-I-SAM-dependent-methyltransferase
MAFTESDVYNNTAFFEQYMKRRYRENSPNESIEKPIFFQLIGHVRGKQILDLGCGDAKFGAELLEKGCYSYTGIEGSELMYEKAKKQLENKNGTVHFLNLKDYTYPSSTFDLVTSRLALHYIEHLDAIFQNVFQTLKTNGTFTFSVQHPVITSSFESLQTSGKRMSWLVDDYFKLGKRVEPWIDQEVIKYHRTTEDYFTLLQQAGFTITSLKEATPNPTYFQNEEEYKRRLRIPLFLLFSCTK
>NZ_CP053954.1|WP_001167962.1|3054966_3055788_+|ABC-transporter-ATP-binding-protein
MQKALETKRLTLSYGETIIIDELNLEIPKGEITIFIGSNGCGKSTLLRSLARLLKPTTGDILLDNQAIQSMQTKQIARQMAILPQGPQAPEGLTVLQLVKQGRYPYQTWLKQWSEKDEEMVQKALAATGMTEFAERDVHALSGGQRQRAWIAMTLAQDTDIILLDEPTTYLDMTHQIEVLDLLFELNETEQRTIVMVLHDLNLACRYADNIVAIQDKQIYAQGKPEEVVDEKLVRDVFRMECQISTDPLFGTPLCIPHGRGRRVVKEVAQAMR
>NZ_CP053954.1|WP_000760054.1|3053895_3054954_+|iron-ABC-transporter-permease
MKKYIPFRIGKGELSFLMYKRACLVLLSLLVVLIGLFFASAGMGDMKIAPYDVWQAITGNGDAMSNMVVNKFRMPRILIAILVGIALAVAGCILQGLVRNPLASPDIIGITGGASVAVVLFLAIFSDKNNALTVSIHYMPLAAFVGATIVALFVYLFAWRNDGLSPISLVLIGVGFWALTKAATTLFMLLAPIYQASQANVWITGTVYGSSWQNVMVLAPWVLILTVISFIAARHLNAQELGDDIAVGLGVPLTKSRVFMLLLSTALIGGAVAFAGGIGFVGLMAPHISRRLVGSLYGALLPVAAIVGAILVLAADLIGRTVFTPLEIPAGVFTSAIGAPYFIYLLYKSRNS
>NZ_CP053954.1|WP_000925232.1|3052894_3053899_+|iron-ABC-transporter-permease
MLLKTNRAKWIGLFVGIIAVVICIWGSIIFGYTNTSWKLALDAFFHFNGSNEHIIIQNVRLPRALIAASVGASLAIAGCLMQTLTKNPLASPDFIGLNSGAAFFIVVAIVIFSVTSLSAFTWIAFLGAAVAAVLVFASSSLGKEGTTPLKLTLAGVAISALFSSLTQGLLVLNEKALEEVLFWLAGSVQGRKLEILQSVFPYLLIGWIASLMMAGKVNTLMMGEDVAKGLGQRTILMKSFVLLIIVLLSGGSVAVAGPIGFIGIITPHFARFLVGVDHRWRVPYSGLLGAILLILADIAARYVIMPQEVPVGVMTAFIGAPFFIYIARKRGLSK
>NZ_CP053954.1|WP_000893350.1|3064984_3066688_+|EAL-domain-containing-protein
MLEQRGHALYDSSLRDLKLALDESSIVAITDRKGLITYVNDKFCEISKYKREELIGKDHRILNSGHHPKTFFQNLWKRILNGKVWTGEIRNRAKDGTYYWVKTTIVPFLNEKGEPYQFIAIRNDISSRKEAEQRLRLSESRYRELAYHDALTSLPNRLQLITTVNKLIADKKEFGMIYFDLDRFKLVNDTLGHMIGDLLLSEVASRLHYVLGEKDVLARLGGDEFVLLTKNHRQDDMRQLATSVLSCFQAPFILEGHEVYISASLGLCSYPQDGQDVETLLKNSDLAMYSAKEQGRNAACFFTDELRAKINRRMKVEFALQKAIRDEELDVVLQPIIDLKTKRYSGIEALVRCMTEDGPISPNEFIPVAEESGLIIKLGDWVLEKSCRLFKTLPNYQEGLKLSVNLSIQQLMQKRFIFSVRSILKRTGFPPNRLILEITESIAVRHFDYIIATLQELRNMGVLIALDDFGTGYSSLYYLKQLPLDIVKIDRNFIREFHYDHAQPERTIVKSVIEIAHSLNLAVVAEGVETVEQESLLQSMSCDYVQGFYYAKPLSVGELKEKLITDF
>NZ_CP053954.1|WP_087874946.1|3066794_3067954_+|IS3-like-element-ISBth8-family-transposase
MARKGQSFQKYTEELKREAVRLRLEERKSLREIREQLGVKSDAQIIEWVKRAQQGESFDDQRGVWNRKNFNSLEEENAYLKAQVEYFKKAQSKSTREGMVLKKERFSLIDSLRQAYPLRWLLQIAEVSKAGYYKWRKYHNVQRLRQKRDMWHKEHILSIHRQHPYYGYKRMTRALAREGMVMNHKRVRRLMRELGIQSIIRKKRPFYGRKTSVVFKNHLNREFQAEKQNQKFVTDITYVRIGEQFAYLSAVLDLYNNEIVAWKLSSRNDLDLVLTTLRQLEGKSLTTKPLFHSDQGFQYTSKSYAKQLEKLGFVGSHSRRGNCFDNACIESFFSHLKTEKLYLVCPKTYEMAYRAIQEYIQFYNTERFQEKLHGLSPIEYREKAVA
>NZ_CP053954.1|WP_172852718.1|3068010_3069408_-|amino-acid-permease
METKTWGLWVLTAFVIGNMVGGGVFMLPANLAQVSGPMGSTLAWSITGLGVFMIALVFGNLAIRKPELKAGPQSYAQAMFPSKKAGKVAGYSMAWGYWAANWAATASVIISFAGYLSTFFPVLQSKQILFSINGFSLELGKGLTFLVCSLMLWGIQYILSQNIDRAGNMNLLATIAKIIGFTMFIVITLFIFNASNFGDGQTFMNEAGQSISLGGQINSAAIATLWAFIGIESAVMLSNRAKSQRDVKKATIFGLIIALLIYMSITLLTMGALPQDALKESQKPLVDALNLAIGNKGAYIMALLALISLFGSTVGWIVVSSEVPYQAAKNGLFPKFFGKTNKKGSPSKSLLITNIMTQIFLFSTISGTVSEAYSFAIVVATLAYLIPYLVSTLYQLKLVITGETYDILPGSRVKDGIITTLALVYSIWVIKTGTADLKTFFLGIGLFVLGLILYPVLMKDSQKTD
>NZ_CP053954.1|WP_098596037.1|3069860_3070571_+|trehalose-operon-repressor
MMSKYEQIYTEISKSIDNKQLKEGCKIPSETELMKQYEASRGTVRKAVDLLQERGYVQKIHGKGVFVLKRKNIEFNFGGIVSFQEENERLGRHCITEVVEMDKEKATKEIAKLLNVKEKTEIDHIKRVRNIDGEKVILDINYFVSEFIPGLTKEIATASIYKYIEKELGLHISYSQRVIEVQPCTEDDRKYLDLNGTDYVVVVKNFTHLYDGSQFEYTESRHRLDIFHFSDVARRK
>NZ_CP053954.1|WP_000513940.1|3070713_3072141_+|PTS-system-trehalose-specific-EIIBC-component
MGKDYRKTAEEVLQYIGGKDNIEQAAHCVTRLRIALKDESKIDNDKLQSVSLVKGAFHNAGIFQVVIGPGDVDRVYAELITLAGMKESTVADVKDSGNQKLNPAQKFVKIFSDVFMPILPAIVTAGLLMGINNLLGAKDLFFDGKNLLDVYPNLGGLWDLINMMANTAFVFLPALVGWSATKRFGGSPILGIVMGLMLVHPALLNAWDYGKAATGLDGQKIEYFDILGLFQIEKVGYQGQILPVLVAAFVLSKVEIFLKKHVPNAIQLLVVPITTIVVTGVLALGIIGPVTRHIGDLLTVGLVGVYETVPVVGAVLFGALYAPLVITGMHHMFIAIDLQLIAQHGGTFIWPMIALSNIAQGSAALAMFWISKNQNDKSMASTSAISAYFGITEPAMFGVNLRNKFPFYAAIIGSAVAAIFITLNGVLAPAIGIGGLPAFISIIPKSIPMFIVGMIIAVVIPFTLTWLFAKRVKQK
>NZ_CP053954.1|WP_098869247.1|3072154_3073816_+|alpha,alpha-phosphotrehalase
MKDWHKSVVYQIYPKSFNSYYNRETGDIKGVTEKLDYLKELGVDYIWLTPIYQSPQNDNGYDVSDYYSIDPSYGTMEEFEELLAEAKVRNIEIMLDIVVNHSSTEHKWFKEAKEDKNSPYRNYYIWRDEKNNWQSKFGGSAWKYDEKTEQYYLHLFDETQADLNWENEKLREEVYDMMRFWLDKGVTGFRLDVINLISKDQCFLNDEGSTVTSDGRKYYTDGPRVHEYLQEMNRNVFAGKDVITVGEMSSTTIDNCIKYSNPERNELSMTFSFHHLKVDYPNGDKWTKAEFDFIKLKEIMSNWQIEMQKGGGWNALFWCNHDQPRIVSRFGDDGKYRNESAKMLATAMHMLQGTPYIYQGEEIGMTNPKFESIEQYRDVESLNIYDIKLKEGLSKEEIIGILKQKSRDNSRTPMQWNEEMNSGFTTSTPWISAAENFKEINVEKALEDKESVFYHYKKLIELRKTYDVITEGEYAILDKNDPKIWAYTRTTESEVLLVINNFYGEEITYSVPAHVQLDGMKQEVLLSNYKDASKDIAKLNLRPYESIVYRYTK
>NZ_CP053954.1|WP_000484128.1|3073849_3074974_-|Ger(x)C-family-spore-germination-protein
MFPKRVKLLLILCTSSLLSGCWDQEPLREASLAYSVGADITEENKLQQTIELVKSSSGEQSSFENEIYSATGHNIMDTGDALKKNVTGNIRYFKYGVQLLGTKILKKGILPYLDVSFRDPTNPTALVKLIAVDGETSEILEKKKIGNLLIGDFLKKKVKSLEDMSVFPKETLETAATKMLDPGKDFTLPSIKIKGKEVVTNGLALFNNDKLTGHLPLQQSVLFVLLTGKMGTSARITQKLTSDESEKTSDYLTMEISNRKLKRDLKITTDKKGNVYAHIKLQLKVIALESPRDNMYTMDDREKLNKELSKQLTKEAKKITRKLQKANCDAFGIGRHLIAYHPNLWKKKNWNKDYAKVKFKPEVEVSILYSGVLK
>NZ_CP053954.1|WP_000185796.1|3074954_3076061_-|GerAB/ArcD/ProY-family-transporter
MTNTQSKISLVQFTFFVIQCQIGVGILSLPNRLHPIAKGGGWISALIAGLAIQLIILLMWLFLKRFPDADMYKSVCMLFGNKLGKLLGFSYVFYFTLIGMTVMLNACNVIKVWVLHATPWSAILILCTVACCYVAYNTFKVIVRFYVMASILIIPMALLIALGLSRADFSYIFPITEAGWWNIIQASKETITAMYGFEIILIAFPKVNGSSIAKLKAISIANGFVTLFYTFTVWICFIVFSPKQIELIPEPVAYLLRSLHIGIIDRTDLIFIPIWMITVVASIASYYCAASIGIGHIFNLANHKKAVPIVGIIAFSVALFIDTPEELKVISTFTDKFTYIFIVVLPLLFLLYSIIRKKKGEQYVPKKS
>NZ_CP053954.1|WP_000139248.1|3076041_3077544_-|spore-germination-protein-GerKA
MTEQKEQQESKNQKHMFPSLPENINYIENKLSHSDDIKKLDLPFQNGKGAILYIESLADPNLIHQLVLEPLLTRSDLSLDKAFSTLNMKKETNLNYGIQLLLQGKSLYFHEHVDSFCIFETTLSLKRDIAEPDNEGVVRGPHTGFVEDLATNLTSIRKLIKSPNLVVKYFTLGEEMHTKVAITYMQNIANDDLVIEVKRRLETIKTDALMPPGYIQEFIEDTSFSPFPQQLNTERPDRTVANLMEGRVAILSDGDPTALIVPVTLFAFYQSPDDYNNRWIVGSFVRMIRLVSFLIAFLLPALYIATVAFHPDVLPLELVYTIKASLEKVPLPPIFEALLMELIFELLREAGIRLPSRVGQTIGIVGGLVIGDAIVKAGLVSYTMIIVVALTAISSFLVPSNDMSSAVRILRFPLMLLAAIFGYVGISFGLIITFVHLCQLHSFHTPYLSPVAPMRIKDMKDSFIRLPIWSFWERPHDPKPKKMQRQHVTREDEDGDKHAK
>NZ_CP053954.1|WP_065704889.1|3077732_3078704_+|phosphotransferase
MEIAVERVFTKEILKRAASLFHVTVEEKPLGDFENYIFKAKGDRGEDYVLRLTHSSHRSKKEVEAELDFLRYVAENGAKVAGPLYSTSQNLVEEIGAEDETFFFASLFTYAKGEQVKGEESPYWGEPLFEAWGKAIGQLHRLTMEYPKTDYRDTWEEDESGIVNELEDDQVKKIAAVLMDEIKALSIERETFGLMHGDIHPGNFHYDGKELTIFDFDDAAYNYFIHDLAMVLYYSVLFTPWTAEEKTDFARKQLQVLRKGYEYEHRLADSWYESLPLFLRLRDIGLYGTLQKKFKGKDMPDNFLKLSEELYERIIKREAIVNI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP053954_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053954_6

3519904-3519996

Orphan

Consensus_repeat	Method
ATTAAATAGCAATGCAGGTATCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP053954_6

>merge|NZ_CP053954|6|3519904-3519996|CRISPRCasFinder
ATTAAATAGCAATGCAGGTATCGGAAAATTAGTAGATGGATCAGGCAAAGTAACAGATGGTTTACATGCATTAAATAGCAATGCAGGTATTGG

>NZ_CP053954|6|5|3519904-3519996|CRISPRCasFinder
ATTAAATAGCAATGCAGGTATCGG	AAAATTAGTAGATGGATCAGGCAAAGTAACAGATGGTTTACATGC
ATTAAATAGCAATGCAGGTATTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053954.1\|WP_000984162.1\|3514421_3515267_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053954.1\|WP_000620018.1\|3523356_3523866_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP053954.1\|WP_000897281.1\|3526166_3527156_+\|lipoate--protein-ligase	unknown	unknown	gnl\|CDD\|161920
NZ_CP053954.1\|WP_098781671.1\|3515900_3517850_+\|M56-family-metallopeptidase	unknown	unknown	gnl\|CDD\|310280
NZ_CP053954.1\|WP_001055203.1\|3527966_3529499_+\|fatty-acid--CoA-ligase-family-protein	unknown	unknown	gnl\|CDD\|236072
NZ_CP053954.1\|WP_000726800.1\|3507540_3508476_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|183526
NZ_CP053954.1\|WP_000567010.1\|3525113_3525242_-\|YhfH-family-protein	unknown	unknown	gnl\|CDD\|379490
NZ_CP053954.1\|WP_058839358.1\|3527376_3527805_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053954.1\|WP_000279264.1\|3511567_3513934_+\|chitobiase/beta-hexosaminidase-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|225249
NZ_CP053954.1\|WP_033667903.1\|3522321_3522534_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053954.1\|WP_000963381.1\|3518123_3518696_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP053954.1\|WP_000184503.1\|3515496_3515898_+\|BlaI/MecI/CopY-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367747
NZ_CP053954.1\|WP_001228100.1\|3508495_3509917_+\|protoporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|237009
NZ_CP053954.1\|WP_000103715.1\|3524060_3525074_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NZ_CP053954.1\|WP_000140286.1\|3522537_3522843_+\|DUF2087-domain-containing-protein	unknown	unknown	gnl\|CDD\|378279
NZ_CP053954.1\|WP_001068217.1\|3522869_3523223_-\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|379617
NZ_CP053954.1\|WP_001176849.1\|3514067_3514367_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053954.1\|WP_000453721.1\|3509973_3511326_-\|DUF4026-domain-containing-protein	unknown	unknown	gnl\|CDD\|338635
NZ_CP053954.1\|WP_000784679.1\|3525422_3526157_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293802
NZ_CP053954.1\|WP_172852785.1\|3506479_3507526_+\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644

Protein	Function_ID	Function_description	E-value
NZ_CP053954.1\|WP_000620018.1\|3523356_3523866_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	9.65074e-14
NZ_CP053954.1\|WP_000567010.1\|3525113_3525242_-\|YhfH-family-protein	gnl\|CDD\|379490	pfam14149, YhfH, YhfH-like protein. The YhfH-like protein family includes the B. subtilis YhfH protein, which is functionally uncharacterized. Its expression is repressed by the Spx paralogue MgsR, which regulates genes involved in stress response. This family of proteins is found in bacteria. Proteins in this family are typically between 42 and 53 amino acids in length.	3.52581e-13
NZ_CP053954.1\|WP_000897281.1\|3526166_3527156_+\|lipoate--protein-ligase	gnl\|CDD\|161920	TIGR00545, Probable_lipoate-protein_ligase_A, lipoyltransferase and lipoate-protein ligase. One member of this group of proteins is bovine lipoyltransferase, which transfers the lipoyl group from lipoyl-AMP to the specific Lys of lipoate-dependent enzymes. However, it does not first activate lipoic acid with ATP to create lipoyl-AMP and pyrophosphate. Another member of this group, lipoate-protein ligase A from E. coli, catalyzes both the activation and the transfer of lipoate. Homology between the two is full-length, except for the bovine mitochondrial targeting signal, but is strongest toward the N-terminus. [Protein fate, Protein modification and repair].	5.85636e-138
NZ_CP053954.1\|WP_000279264.1\|3511567_3513934_+\|chitobiase/beta-hexosaminidase-C-terminal-domain-containing-protein	gnl\|CDD\|225249	COG2374, COG2374, Predicted extracellular nuclease [General function prediction only].	2.92023e-71
NZ_CP053954.1\|WP_001055203.1\|3527966_3529499_+\|fatty-acid--CoA-ligase-family-protein	gnl\|CDD\|236072	PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated.	0
NZ_CP053954.1\|WP_000726800.1\|3507540_3508476_+\|ferrochelatase	gnl\|CDD\|183526	PRK12435, PRK12435, ferrochelatase; Provisional.	0
NZ_CP053954.1\|WP_098781671.1\|3515900_3517850_+\|M56-family-metallopeptidase	gnl\|CDD\|310280	pfam05569, Peptidase_M56, BlaR1 peptidase M56. Production of beta-Lactamase and penicillin-binding protein 2a (which mediate staphylococcal resistance to beta-lactam antibiotics) is regulated by a signal-transducing integral membrane protein and a transcriptional repressor. The signal transducer is a fusion protein with penicillin-binding and zinc metalloprotease domains. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. homologs to this peptidase domain, which corresponds to Merops family M56, are also found in a number of other bacterial genome sequences.	9.1204e-49
NZ_CP053954.1\|WP_000784679.1\|3525422_3526157_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293802	cd07716, RNaseZ_short-form-like_MBL-fold, uncharacterized bacterial subgroup of Ribonuclease Z, short form; MBL-fold metallo-hydrolase domain. The tRNA maturase RNase Z (also known as tRNase Z or 3' tRNase) catalyzes the endonucleolytic removal of the 3' extension of the majority of tRNA precursors. Two forms of RNase Z exist in eukaryotes, one long (ELAC2) and one short form (ELAC1), the former may have resulted from a duplication of the shorter enzyme. Only the short form exists in bacteria. Members of this bacterial subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	3.61062e-85
NZ_CP053954.1\|WP_000963381.1\|3518123_3518696_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.571e-14
NZ_CP053954.1\|WP_000184503.1\|3515496_3515898_+\|BlaI/MecI/CopY-family-transcriptional-regulator	gnl\|CDD\|367747	pfam03965, Penicillinase_R, Penicillinase repressor. The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.	6.07643e-46
NZ_CP053954.1\|WP_001228100.1\|3508495_3509917_+\|protoporphyrinogen-oxidase	gnl\|CDD\|237009	PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed.	0
NZ_CP053954.1\|WP_000103715.1\|3524060_3525074_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	2.56346e-114
NZ_CP053954.1\|WP_000140286.1\|3522537_3522843_+\|DUF2087-domain-containing-protein	gnl\|CDD\|378279	pfam09860, DUF2087, Uncharacterized protein conserved in bacteria (DUF2087). This domain, found in various hypothetical prokaryotic proteins and transcriptional activators, has no known function. Structural modelling suggests this domain may bind nucleic acids.	1.11798e-24
NZ_CP053954.1\|WP_001068217.1\|3522869_3523223_-\|PH-domain-containing-protein	gnl\|CDD\|379617	pfam14470, bPH_3, Bacterial PH domain. Proteins in this family are distantly related to PH domains.	1.2796e-19
NZ_CP053954.1\|WP_000453721.1\|3509973_3511326_-\|DUF4026-domain-containing-protein	gnl\|CDD\|338635	pfam13218, DUF4026, Protein of unknown function (DUF4026). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 450 amino acids in length. The family is found in association with pfam10077.	4.22408e-175
NZ_CP053954.1\|WP_172852785.1\|3506479_3507526_+\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0

>NZ_CP053954.1|WP_000963381.1|3518123_3518696_+|TetR/AcrR-family-transcriptional-regulator
MAIDRKRSIIEAATKSFSAFGYKATTMDQVAKLANVGKGTIYTFFKNKEELFGEIISNLITEMKQVAESAIRSDVSFFENVHRALYSILEFRKEHQLMIKLIQEERDMGTKEVQEVMQQVDVEIVSVIQSYLKIAIEKGEISKCDPEITAFIMLRLYVSLIFDWEKNHEPLEKEKIAELFELYLLKGLSN
>NZ_CP053954.1|WP_098781671.1|3515900_3517850_+|M56-family-metallopeptidase
MINTLINVYLPHFFDWLIETSLMASILVGFILCIKVLFRNKLTPRWQYMLWIVLMIRLLLPWSPDSSYSIYSLLSYSSSVSEVIPKNMPATENIVNIESDRKVELESNSKMVTKTSEPEVKVSSEKQTTFSLYKLALYVWLAGVIILAAITFLTNRRLYSYIKKQPDITDEQVTTVFNRCKQSMKMKKAVSLRLAGKIASPTVFSFFRPKVLLSKKHMKVLNEQQLQYVFYHELAHIKRNDVAVNWIMYSLILLNWFNPILWYAYFCMREDQELACDAYALTFIDKEEQIAYGHTIITLLEHYSYQVPSLANLSRNKRTLKRRIIMIKKFQKKSYRLSLLGVIAIAAIAGGFLLNARITEGDERQKEKVVEKKQSKAAFEKAIETVLGTPENASREWGMSITSYKKNTDFLYLAEKNFTKEEFEQYVRLFKEAQEIHKKAMVKKNVPENYDGDTKEYKPERLKKADQERLATIEKTLKPLGDKLEKSLTYTIEEAKEHVPYQIKEPTYIPEGYELKREWADSYFGRDIELVIKSEYTKGKYGFTIYQSRMYMDGNVNGGKDPLHYMMPGVENLESYSLDGKGMVYNKSSHGEGKLRGLKMFVPAQGKNSDYQIVIVNDIFTRDTKIYEEIIDDDLTKKEMEKILLSMSK
>NZ_CP053954.1|WP_000184503.1|3515496_3515898_+|BlaI/MecI/CopY-family-transcriptional-regulator
MTNQLPKISEAELEIMKVLWSNSPQTANEIIEELEDAMDWKPKTIRTLINRLVQKEAVSYHQDKGRMYAYYPLVSQDNYLQVETKSLLKRFCGAAFKPLLVNFLKEEKLSSEDINELKRILDEKTEENKRKDR
>NZ_CP053954.1|WP_000984162.1|3514421_3515267_-|hypothetical-protein
MMRALRLNIKQAFCNRVSLIIMFSGLALIFIYHYYYVIRYIGDGTDAFVTTAFKWIGFRDNEMDVYLLLMPVIASFPFSTSYNSDKSDGFKPFVSKGISLFPYSVTKYIVTFFCGGLLYTFPFILSLLFCKLTIPDGEPTAGSGIINDNGMFANLYYESPLTYITVYIGINFLFAGLMALLGLAASAWSQKDYMAILFPFAVASIPYVLLNTIFPTIGGAPFHLYDPKQPLHGMSPYILTIQCAFFLLVSLIMYIQGVKRDKKKYRRRLQKRERCRKAFQV
>NZ_CP053954.1|WP_001176849.1|3514067_3514367_+|hypothetical-protein
MQLQINGKVMNQFAIFFSTIVMLQFVADITGLTSNLDITYNLIHTAASYITFSLAVIFTLIGARRELSKYAIVSLCLVVGIKAIYFVAVVILWGLAGTP
>NZ_CP053954.1|WP_000279264.1|3511567_3513934_+|chitobiase/beta-hexosaminidase-C-terminal-domain-containing-protein
MAVKKLLSVFLSFLLLFSFTGTLAQAEETASMSVEKAIQVFKQQGKTKGIVEGYIVGYTQSSSKYTKDPAKFDDTNVAIADSPNETNPDKIMPVQLPKGDVRTAVNVKDHPENIGKKVSLTGTLELYFSNPGLKSVTAYKFQGEGQNRVSDVVASPNGGEVAKGTAVTLTTNTEGATIYYTLDGSNPTNKSVRYNGQIIVNENSVVKAIAEKEGLTSSAISTFSFIIVNNEQVRIHDIQGKSHISPYNGKKVNNVEGVVTALDKNGFYIEDNQPDNDPATSEGMYVYKKDANVAVGDLIQVDGVVEEYVGPGYAERFETDLTTTEIKASRVAVIAKDQSLPAPIVLGENGVKIPDQIIDNDAFGLFDPSEDAIDFYESIEGMRVTMPTPKIIAPQKNGNLYVTVKNGGDKIVTQYGTPLLDENQLNPERLSVKVPRDYVAKVGDTFTGDITGVVGYDYGSFRISPITELPAVVDGGFKQVGANIQPRLDKLTVATYNIENFSANKKETTDEKVKALAYSIKYNLKMPDIIGVEEMQDNNGSINDGTTDASLSAKRIIDAVLEIRGPKYEYVEIAPNNNQDGGAPGANIRVGFFYNPSRVKLATVPKLLDKNVVRIGDENPLFESTRKPLAAEFTFQGQNIVVVANHLNSKLGDATPFGKVQPLVLKSEDKRIQLAQEVNHFVQGIQKKNTNAPVVVLGDMNDFEFSKPLKTLEGTILKDMLNTVPKENRYTYIHEGNAQVLDHILVTNNIAPHTIVDPVHLNSNIMKEHGRVSDHDPVLAQIDLKKAS
>NZ_CP053954.1|WP_000453721.1|3509973_3511326_-|DUF4026-domain-containing-protein
MEVQTETYRAAMNGTLERHFSDMIAVIPTRITIEQLKQRLETIATKVDDLKIVYSDETSLIVELHMGETVIPYELHIDEPNDPEGYKMYNRQDATIVDRNFEDAAFGTEIFTRTLFVGDVLDCFFQQLQFLWNLSPDLLFVIDSSAAMKVISRSYIEYHVENELLPDIPDLYVIHSVYEDDKDGEPTQYWFHTHGLLRAGVTEIELIIPNRISSYYGISDLFQTFANNAVENGQVPMNEPIVIAHSQQGSIHTVAVPWEKGLSYIGHKTSMDQLSSIEDEEVKLQPIDAQNTFLGGMDDRDEYHQSPSVLLFKFNTSEEYIESFFKEHEEATGLMFYKTNSETDRMAYNAKNTFGYFSNIFHIEQSNEDFRFLAKFGVSYEEGKSEHMWFEMQNITEDFIQGILINEPYFIEDMSEGNSYHLDFDNLTEWVIYAGDAVIKPNNLYMFIGE
>NZ_CP053954.1|WP_001228100.1|3508495_3509917_+|protoporphyrinogen-oxidase
MRKKVVIVGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERGPDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPNGSMMGIPTQITPFLFSGLFSPIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDEMSLMSTFPQMYQIEQKHRSISLGMRTLAPKEEKAEPKKGMFQTVKTGLESIVKSLEAKMHEGTIIKGTRIEKVAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNIPSTSVANVALAFQKSAIQRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCYVGRAGDEAVVEQTEEELVQLVLEDLKKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKQLTTFMEKELPGIYLAGSSYAGAGLPDCINQGEEAAKRVLSHLEKVIDAELIAQ
>NZ_CP053954.1|WP_000726800.1|3507540_3508476_+|ferrochelatase
MKKKIGLLVMAYGTPYKEEDIERYYTHIRRGRKPSPEMLEDLTERYRAIGGISPLATITLEQAKKLEQRLNEVQDEVEYHMYLGLKHIEPFIEDAVKDMHNDGIQDAIALVLAPHYSTFSVKSYVGRAQEEAEKLGNLTIHGIDSWYKEPKFIQYWVDAVKGIYNGMSDAEREKAVLIVSAHSLPEKIIAMGDPYPDQLNETADYIARGAEVANYAVGWQSAGNTPDPWIGPDVQDLTRELNEKHGYTSFVYAPVGFVAEHLEVLYDNDFECKVVTDEIGAKYYRPEMPNASDAFIDCLTDVVLKKKESVL
>NZ_CP053954.1|WP_172852785.1|3506479_3507526_+|uroporphyrinogen-decarboxylase
MVRTINETFLKACRGERTDYVPAWYMRQAGRSQPEYRKIKEKYSLFEITHNPELCAYVTKLPVDQYNVDAAILYKDIMSPLPAIGVDVEIKSGIGPVIDNPIRSLQDVEKLGEINPEDDVPYILDTIRLLTTEMLDVPLIGFSGAPFTLASYMIEGGPSRNYHNTKAFMYAEPKAWFALMDKLADMVITYLKAQINAGAKAVQIFDSWVGTVNVADYRVFIKPAMELIFAEVRKMGVPMIMHGVGAAHLVNEWHDLPLDVVGLDWRLPIEEARARGVHKVVQGNMDPSFLLAPWSVIEEHVKGILDQGMKQPGYIFNLGHGVFPEVNPDTLKRLTTFIHEYSKGQLAK
>NZ_CP053954.1|WP_033667903.1|3522321_3522534_+|hypothetical-protein
MMKGNLTYYFIVNPLIIFLVYALSPILFDKEVYTSVKDAFGILTFYYVLMGGYYFIDILSEKIKKKSDGG
>NZ_CP053954.1|WP_000140286.1|3522537_3522843_+|DUF2087-domain-containing-protein
MTESEMKFRDTTIRNFFDKEDRLKSIPGQKKKKLVLLEHLISKLDAGNQYTEKEINTFIKQYHDDFCTIRREFIVHRFMDREDNMYRINGREVWTKWEELK
>NZ_CP053954.1|WP_001068217.1|3522869_3523223_-|PH-domain-containing-protein
MNPILTAAKQLLHKEEKILSTLKCSLTGYMITHKVPYPGMLLATNKRLLFFSQYKNTFIAEFDYEKILSIETKRRIFDKKIIFYYEDEYITLGYITSSNVEAFIDLLQRNSKTSTGL
>NZ_CP053954.1|WP_000620018.1|3523356_3523866_+|GNAT-family-N-acetyltransferase
MIRLAKEADAEAIMNIRKEIILSENTTKFFIVSPKKLPNDIDAEREKIRKSNEKGNLYIVYEVDYKVVGFLLFNRYELERLQHAGTMGMGIKEAYCNQGIGTKLIEFLISWAKGQKGLEKICLGVVSVNDRAIKVYKRMGFVEEGRQRKQIKYEDGSYGDDVLMGFYIK
>NZ_CP053954.1|WP_000103715.1|3524060_3525074_+|LacI-family-DNA-binding-transcriptional-regulator
MSTIEDVAKLAGLSRTTVSRVINNHPYVSDEKKKRVQLAMKHLGFVPNSAARRLRKQKTETIAVLVPRITNPFFSRFIEAIEIAASEHKYKLIICQTRYLPEKEMEYLQLLSTKQVDGIILCSLENPWEDVEPYLQHGPIVLCNEYIEEANIPTVKFDHAQGAYIAAKHVLDQGYRNLIFCRGNETKVVSQQRKMGFLRAITEKSRQVEAIDFLENAFSWEDGKRIFHEVLKDKKNPTAILAGGDEVAAGIISEAKRHNWSIPDDLAVIGFDNQILSQITEPGITTIEQPIDEMARKVVDLMMDKIHTKNYRKKELYEFELELLVKGSTMKDKMLLA
>NZ_CP053954.1|WP_000567010.1|3525113_3525242_-|YhfH-family-protein
MIDQPMEFFRNLPTKTCAHCGKEIDEQHEAYHNKCDDCVHEE
>NZ_CP053954.1|WP_000784679.1|3525422_3526157_+|MBL-fold-metallo-hydrolase
MKMTVVGFWGGFPEAGEATSGYLFEHDGFRLLVDCGSGVLAQLQKYITPSHIDAVVLSHYHHDHVADIGVLQYARLIMSGAKGQLPELPIYGHTFDENGFHSLTHEPHTKGIAYNPEETLQVGPFSISFLKTVHPVTCFAMRITAGDDAVVYSADSSYIPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPADLVTEAKQIFSGHITLAHSGYVWNS
>NZ_CP053954.1|WP_000897281.1|3526166_3527156_+|lipoate--protein-ligase
MLFIDNKGITDPRINLAIEEYCVKNLDINETYLLFYINEPSIIIGKNQNTVEEINADYVKEKGIHVVRRLSGGGAVYHDLGNLNFSFITKDDGDSFSNFKKFTEPVTKALSKLGVNAELSGRNDILAEGRKISGNAQFSTKGRMFSHGTLLFDSEIDHVVSALKVKMDKIQSKGIKSIRSRVANITEFLNEEMTTEEFRQLLLETIFEGETEIPTYELTEEDWKEIHKLSEERYQNWDWNYGKSPKFNLQHSHRFPVGQVDVRLEVKKGTVTECKIYGDFFGSLDVHDIEERLTGVQFDKDAFTVALEGVDIARYFGNITTEDFLHLFF
>NZ_CP053954.1|WP_058839358.1|3527376_3527805_+|hypothetical-protein
MKRVMYVVLLLSLVIGMTACSSGSPSSRTILSIGKPAEDNVIYFTHTDNKRKIHDIQDMFQNKKWKRNETFSTVNKTPDVVLSIDEDNIGLPALYVTVYFHEDGADALNLHGEHTTLNKEELDKLREKMSAYYPKMIFGLVL
>NZ_CP053954.1|WP_001055203.1|3527966_3529499_+|fatty-acid--CoA-ligase-family-protein
MNLVQSLAETAKKKGEKPAYIFMDQSVSYDQLNKMVTRFSSNLAEMGIGKGDNVALVVGNSPHYLVGLYGTMKAGATVIPVNPIYTADEMHYILQNGDVKTIIVLDVLLPVIQSLTTRLPSLENIIICETSSDFNHTETEKMKTFTSFVGTGDTTYEGPELDEEDVAVILYTSGTTGKPKGAMLTHKNLYSNANDVASYLQYTADDRVVAALPMFHVFCLTVAVNAPIVNGATILMLPKFSPKEVFRICRTYEPTIFAGVPTMYNYLYLFEEASAEDVKTLRLCISGGASMPVALLQNFEKRFNVIVSEGYGLSEASPVTCFNPLDRPRKPGSIGTNIWHVENKIVNELGEEVPVGAVGELIVRGPNVMKGYYNAPEDTAATLKDGWLYTGDLAKMDEEGYFYIVDRKKDIVLVGGYNVYPREVEEVLYTHESVAEVVVIGVPDENLGEAVRAYVVLKQANVTEEELMHYCTLHLAKYKVPKSIEFLIELPKNTTGKLLRRALREKAMQV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP053954_2	2.4\|724611\|18\|NZ_CP053954\|CRT	724611-724628	18	NZ_CP053954.1	725745-725762	0	1.0
NZ_CP053954_2	2.4\|724611\|18\|NZ_CP053954\|CRT	724611-724628	18	NZ_CP053954.1	725430-725447	1	0.944
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	725538-725555	0	1.0
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	725817-725834	0	1.0
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	725862-725879	0	1.0
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	725907-725924	0	1.0
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	725952-725969	0	1.0
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	726096-726113	0	1.0
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	726429-726446	0	1.0
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	726510-726527	0	1.0
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	726555-726572	0	1.0
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	726690-726707	0	1.0
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	725448-725465	1	0.944
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	725493-725510	1	0.944
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	725592-725609	1	0.944
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	725682-725699	1	0.944
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	725772-725789	1	0.944
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	726051-726068	1	0.944
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	726150-726167	1	0.944
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	726240-726257	1	0.944
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	726294-726311	1	0.944
NZ_CP053954_2	2.5\|724647\|18\|NZ_CP053954\|CRT	724647-724664	18	NZ_CP053954.1	726384-726401	1	0.944
NZ_CP053954_2	2.6\|724683\|27\|NZ_CP053954\|CRT	724683-724709	27	NZ_CP053954.1	726681-726707	2	0.926
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	725538-725555	0	1.0
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	725817-725834	0	1.0
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	725862-725879	0	1.0
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	725907-725924	0	1.0
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	725952-725969	0	1.0
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	726096-726113	0	1.0
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	726429-726446	0	1.0
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	726510-726527	0	1.0
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	726555-726572	0	1.0
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	726690-726707	0	1.0
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	725448-725465	1	0.944
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	725493-725510	1	0.944
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	725592-725609	1	0.944
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	725682-725699	1	0.944
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	725772-725789	1	0.944
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	726051-726068	1	0.944
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	726150-726167	1	0.944
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	726240-726257	1	0.944
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	726294-726311	1	0.944
NZ_CP053954_2	2.7\|724728\|18\|NZ_CP053954\|CRT	724728-724745	18	NZ_CP053954.1	726384-726401	1	0.944
NZ_CP053954_2	2.8\|724764\|27\|NZ_CP053954\|CRT	724764-724790	27	NZ_CP053954.1	726681-726707	2	0.926
NZ_CP053954_2	2.10\|724845\|18\|NZ_CP053954\|CRT	724845-724862	18	NZ_CP053954.1	725637-725654	1	0.944
NZ_CP053954_2	2.10\|724845\|18\|NZ_CP053954\|CRT	724845-724862	18	NZ_CP053954.1	725997-726014	1	0.944
NZ_CP053954_2	2.10\|724845\|18\|NZ_CP053954\|CRT	724845-724862	18	NZ_CP053954.1	726195-726212	1	0.944
NZ_CP053954_2	2.10\|724845\|18\|NZ_CP053954\|CRT	724845-724862	18	NZ_CP053954.1	726339-726356	1	0.944
NZ_CP053954_2	2.10\|724845\|18\|NZ_CP053954\|CRT	724845-724862	18	NZ_CP053954.1	726600-726617	1	0.944
NZ_CP053954_2	2.10\|724845\|18\|NZ_CP053954\|CRT	724845-724862	18	NZ_CP053954.1	726726-726743	1	0.944
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	725538-725555	0	1.0
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	725817-725834	0	1.0
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	725862-725879	0	1.0
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	725907-725924	0	1.0
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	725952-725969	0	1.0
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	726096-726113	0	1.0
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	726429-726446	0	1.0
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	726510-726527	0	1.0
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	726555-726572	0	1.0
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	726690-726707	0	1.0
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	725448-725465	1	0.944
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	725493-725510	1	0.944
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	725592-725609	1	0.944
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	725682-725699	1	0.944
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	725772-725789	1	0.944
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	726051-726068	1	0.944
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	726150-726167	1	0.944
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	726240-726257	1	0.944
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	726294-726311	1	0.944
NZ_CP053954_2	2.11\|724881\|18\|NZ_CP053954\|CRT	724881-724898	18	NZ_CP053954.1	726384-726401	1	0.944
NZ_CP053954_2	2.13\|724953\|27\|NZ_CP053954\|CRT	724953-724979	27	NZ_CP053954.1	726681-726707	2	0.926
NZ_CP053954_2	2.14\|724998\|27\|NZ_CP053954\|CRT	724998-725024	27	NZ_CP053954.1	726681-726707	2	0.926
NZ_CP053954_2	2.15\|725043\|27\|NZ_CP053954\|CRT	725043-725069	27	NZ_CP053954.1	726681-726707	1	0.963
NZ_CP053954_2	2.15\|725043\|27\|NZ_CP053954\|CRT	725043-725069	27	NZ_CP053954.1	725808-725834	2	0.926
NZ_CP053954_2	2.15\|725043\|27\|NZ_CP053954\|CRT	725043-725069	27	NZ_CP053954.1	725853-725879	2	0.926
NZ_CP053954_2	2.16\|725088\|18\|NZ_CP053954\|CRT	725088-725105	18	NZ_CP053954.1	725637-725654	1	0.944
NZ_CP053954_2	2.16\|725088\|18\|NZ_CP053954\|CRT	725088-725105	18	NZ_CP053954.1	725997-726014	1	0.944
NZ_CP053954_2	2.16\|725088\|18\|NZ_CP053954\|CRT	725088-725105	18	NZ_CP053954.1	726195-726212	1	0.944
NZ_CP053954_2	2.16\|725088\|18\|NZ_CP053954\|CRT	725088-725105	18	NZ_CP053954.1	726339-726356	1	0.944
NZ_CP053954_2	2.16\|725088\|18\|NZ_CP053954\|CRT	725088-725105	18	NZ_CP053954.1	726600-726617	1	0.944
NZ_CP053954_2	2.16\|725088\|18\|NZ_CP053954\|CRT	725088-725105	18	NZ_CP053954.1	726726-726743	1	0.944
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	725538-725555	0	1.0
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	725817-725834	0	1.0
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	725862-725879	0	1.0
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	725907-725924	0	1.0
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	725952-725969	0	1.0
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	726096-726113	0	1.0
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	726429-726446	0	1.0
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	726510-726527	0	1.0
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	726555-726572	0	1.0
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	726690-726707	0	1.0
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	725448-725465	1	0.944
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	725493-725510	1	0.944
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	725592-725609	1	0.944
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	725682-725699	1	0.944
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	725772-725789	1	0.944
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	726051-726068	1	0.944
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	726150-726167	1	0.944
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	726240-726257	1	0.944
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	726294-726311	1	0.944
NZ_CP053954_2	2.17\|725124\|18\|NZ_CP053954\|CRT	725124-725141	18	NZ_CP053954.1	726384-726401	1	0.944
NZ_CP053954_2	2.19\|725196\|27\|NZ_CP053954\|CRT	725196-725222	27	NZ_CP053954.1	726681-726707	2	0.926
NZ_CP053954_2	2.20\|725241\|27\|NZ_CP053954\|CRT	725241-725267	27	NZ_CP053954.1	726681-726707	2	0.926
NZ_CP053954_2	2.21\|725286\|27\|NZ_CP053954\|CRT	725286-725312	27	NZ_CP053954.1	726681-726707	1	0.963
NZ_CP053954_2	2.21\|725286\|27\|NZ_CP053954\|CRT	725286-725312	27	NZ_CP053954.1	725808-725834	2	0.926
NZ_CP053954_2	2.21\|725286\|27\|NZ_CP053954\|CRT	725286-725312	27	NZ_CP053954.1	725853-725879	2	0.926
NZ_CP053954_2	2.22\|725331\|27\|NZ_CP053954\|CRT	725331-725357	27	NZ_CP053954.1	726681-726707	1	0.963
NZ_CP053954_2	2.22\|725331\|27\|NZ_CP053954\|CRT	725331-725357	27	NZ_CP053954.1	725808-725834	2	0.926
NZ_CP053954_2	2.22\|725331\|27\|NZ_CP053954\|CRT	725331-725357	27	NZ_CP053954.1	725853-725879	2	0.926
NZ_CP053954_5	5.1\|3064195\|23\|NZ_CP053954\|CRISPRCasFinder	3064195-3064217	23	NZ_CP053954.1	3064228-3064250	0	1.0

1. spacer 2.4|724611|18|NZ_CP053954|CRT matches to position: 725745-725762, mismatch: 0, identity: 1.0

acctcaaggtaacacggg	CRISPR spacer
acctcaaggtaacacggg	Protospacer
******************

2. spacer 2.4|724611|18|NZ_CP053954|CRT matches to position: 725430-725447, mismatch: 1, identity: 0.944

acctcaaggtaacacggg	CRISPR spacer
acctcaaggtaacacagg	Protospacer
***************.**

3. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 725538-725555, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

4. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 725817-725834, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

5. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 725862-725879, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

6. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 725907-725924, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

7. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 725952-725969, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

8. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 726096-726113, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

9. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 726429-726446, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

10. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 726510-726527, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

11. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 726555-726572, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

12. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 726690-726707, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

13. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 725448-725465, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

14. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 725493-725510, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

15. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 725592-725609, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

16. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 725682-725699, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

17. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 725772-725789, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

18. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 726051-726068, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

19. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 726150-726167, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

20. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 726240-726257, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

21. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 726294-726311, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

22. spacer 2.5|724647|18|NZ_CP053954|CRT matches to position: 726384-726401, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

23. spacer 2.6|724683|27|NZ_CP053954|CRT matches to position: 726681-726707, mismatch: 2, identity: 0.926

cgctaccggtgccactgggcctcgagg	CRISPR spacer
cgctaccggtgccactggacctcaagg	Protospacer
******************.****.***

24. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 725538-725555, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

25. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 725817-725834, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

26. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 725862-725879, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

27. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 725907-725924, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

28. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 725952-725969, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

29. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 726096-726113, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

30. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 726429-726446, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

31. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 726510-726527, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

32. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 726555-726572, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

33. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 726690-726707, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

34. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 725448-725465, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

35. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 725493-725510, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

36. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 725592-725609, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

37. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 725682-725699, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

38. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 725772-725789, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

39. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 726051-726068, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

40. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 726150-726167, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

41. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 726240-726257, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

42. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 726294-726311, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

43. spacer 2.7|724728|18|NZ_CP053954|CRT matches to position: 726384-726401, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

44. spacer 2.8|724764|27|NZ_CP053954|CRT matches to position: 726681-726707, mismatch: 2, identity: 0.926

cgctaccggtgccactgggcctcgagg	CRISPR spacer
cgctaccggtgccactggacctcaagg	Protospacer
******************.****.***

45. spacer 2.10|724845|18|NZ_CP053954|CRT matches to position: 725637-725654, mismatch: 1, identity: 0.944

cgctactgggcctcaagg	CRISPR spacer
cgctactggacctcaagg	Protospacer
*********.********

46. spacer 2.10|724845|18|NZ_CP053954|CRT matches to position: 725997-726014, mismatch: 1, identity: 0.944

cgctactgggcctcaagg	CRISPR spacer
cgctactggacctcaagg	Protospacer
*********.********

47. spacer 2.10|724845|18|NZ_CP053954|CRT matches to position: 726195-726212, mismatch: 1, identity: 0.944

cgctactgggcctcaagg	CRISPR spacer
cgctactggacctcaagg	Protospacer
*********.********

48. spacer 2.10|724845|18|NZ_CP053954|CRT matches to position: 726339-726356, mismatch: 1, identity: 0.944

cgctactgggcctcaagg	CRISPR spacer
cgctactggacctcaagg	Protospacer
*********.********

49. spacer 2.10|724845|18|NZ_CP053954|CRT matches to position: 726600-726617, mismatch: 1, identity: 0.944

cgctactgggcctcaagg	CRISPR spacer
cgctactggacctcaagg	Protospacer
*********.********

50. spacer 2.10|724845|18|NZ_CP053954|CRT matches to position: 726726-726743, mismatch: 1, identity: 0.944

cgctactgggcctcaagg	CRISPR spacer
cgctaccgggcctcaagg	Protospacer
******.***********

51. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 725538-725555, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

52. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 725817-725834, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

53. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 725862-725879, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

54. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 725907-725924, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

55. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 725952-725969, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

56. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 726096-726113, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

57. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 726429-726446, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

58. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 726510-726527, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

59. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 726555-726572, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

60. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 726690-726707, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

61. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 725448-725465, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

62. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 725493-725510, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

63. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 725592-725609, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

64. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 725682-725699, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

65. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 725772-725789, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

66. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 726051-726068, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

67. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 726150-726167, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

68. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 726240-726257, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

69. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 726294-726311, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

70. spacer 2.11|724881|18|NZ_CP053954|CRT matches to position: 726384-726401, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

71. spacer 2.13|724953|27|NZ_CP053954|CRT matches to position: 726681-726707, mismatch: 2, identity: 0.926

cgctaccggtgccactgggcctcgagg	CRISPR spacer
cgctaccggtgccactggacctcaagg	Protospacer
******************.****.***

72. spacer 2.14|724998|27|NZ_CP053954|CRT matches to position: 726681-726707, mismatch: 2, identity: 0.926

cgctaccggtgccactgggcctcgagg	CRISPR spacer
cgctaccggtgccactggacctcaagg	Protospacer
******************.****.***

73. spacer 2.15|725043|27|NZ_CP053954|CRT matches to position: 726681-726707, mismatch: 1, identity: 0.963

cgctaccggtgccactgggcctcaagg	CRISPR spacer
cgctaccggtgccactggacctcaagg	Protospacer
******************.********

74. spacer 2.15|725043|27|NZ_CP053954|CRT matches to position: 725808-725834, mismatch: 2, identity: 0.926

cgctaccggtgccactgggcctcaagg	CRISPR spacer
cgctactggtgccactggacctcaagg	Protospacer
******.***********.********

75. spacer 2.15|725043|27|NZ_CP053954|CRT matches to position: 725853-725879, mismatch: 2, identity: 0.926

cgctaccggtgccactgggcctcaagg	CRISPR spacer
cgctactggtgccactggacctcaagg	Protospacer
******.***********.********

76. spacer 2.16|725088|18|NZ_CP053954|CRT matches to position: 725637-725654, mismatch: 1, identity: 0.944

cgctactgggcctcaagg	CRISPR spacer
cgctactggacctcaagg	Protospacer
*********.********

77. spacer 2.16|725088|18|NZ_CP053954|CRT matches to position: 725997-726014, mismatch: 1, identity: 0.944

cgctactgggcctcaagg	CRISPR spacer
cgctactggacctcaagg	Protospacer
*********.********

78. spacer 2.16|725088|18|NZ_CP053954|CRT matches to position: 726195-726212, mismatch: 1, identity: 0.944

cgctactgggcctcaagg	CRISPR spacer
cgctactggacctcaagg	Protospacer
*********.********

79. spacer 2.16|725088|18|NZ_CP053954|CRT matches to position: 726339-726356, mismatch: 1, identity: 0.944

cgctactgggcctcaagg	CRISPR spacer
cgctactggacctcaagg	Protospacer
*********.********

80. spacer 2.16|725088|18|NZ_CP053954|CRT matches to position: 726600-726617, mismatch: 1, identity: 0.944

cgctactgggcctcaagg	CRISPR spacer
cgctactggacctcaagg	Protospacer
*********.********

81. spacer 2.16|725088|18|NZ_CP053954|CRT matches to position: 726726-726743, mismatch: 1, identity: 0.944

cgctactgggcctcaagg	CRISPR spacer
cgctaccgggcctcaagg	Protospacer
******.***********

82. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 725538-725555, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

83. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 725817-725834, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

84. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 725862-725879, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

85. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 725907-725924, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

86. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 725952-725969, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

87. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 726096-726113, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

88. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 726429-726446, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

89. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 726510-726527, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

90. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 726555-726572, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

91. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 726690-726707, mismatch: 0, identity: 1.0

tgccactggacctcaagg	CRISPR spacer
tgccactggacctcaagg	Protospacer
******************

92. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 725448-725465, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

93. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 725493-725510, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

94. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 725592-725609, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

95. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 725682-725699, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

96. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 725772-725789, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

97. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 726051-726068, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

98. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 726150-726167, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

99. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 726240-726257, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

100. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 726294-726311, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

101. spacer 2.17|725124|18|NZ_CP053954|CRT matches to position: 726384-726401, mismatch: 1, identity: 0.944

tgccactggacctcaagg	CRISPR spacer
tgctactggacctcaagg	Protospacer
***.**************

102. spacer 2.19|725196|27|NZ_CP053954|CRT matches to position: 726681-726707, mismatch: 2, identity: 0.926

cgctaccggtgccactgggcctcgagg	CRISPR spacer
cgctaccggtgccactggacctcaagg	Protospacer
******************.****.***

103. spacer 2.20|725241|27|NZ_CP053954|CRT matches to position: 726681-726707, mismatch: 2, identity: 0.926

cgctaccggtgccactgggcctcgagg	CRISPR spacer
cgctaccggtgccactggacctcaagg	Protospacer
******************.****.***

104. spacer 2.21|725286|27|NZ_CP053954|CRT matches to position: 726681-726707, mismatch: 1, identity: 0.963

cgctaccggtgccactgggcctcaagg	CRISPR spacer
cgctaccggtgccactggacctcaagg	Protospacer
******************.********

105. spacer 2.21|725286|27|NZ_CP053954|CRT matches to position: 725808-725834, mismatch: 2, identity: 0.926

cgctaccggtgccactgggcctcaagg	CRISPR spacer
cgctactggtgccactggacctcaagg	Protospacer
******.***********.********

106. spacer 2.21|725286|27|NZ_CP053954|CRT matches to position: 725853-725879, mismatch: 2, identity: 0.926

cgctaccggtgccactgggcctcaagg	CRISPR spacer
cgctactggtgccactggacctcaagg	Protospacer
******.***********.********

107. spacer 2.22|725331|27|NZ_CP053954|CRT matches to position: 726681-726707, mismatch: 1, identity: 0.963

cgctaccggtgccactgggcctcaagg	CRISPR spacer
cgctaccggtgccactggacctcaagg	Protospacer
******************.********

108. spacer 2.22|725331|27|NZ_CP053954|CRT matches to position: 725808-725834, mismatch: 2, identity: 0.926

cgctaccggtgccactgggcctcaagg	CRISPR spacer
cgctactggtgccactggacctcaagg	Protospacer
******.***********.********

109. spacer 2.22|725331|27|NZ_CP053954|CRT matches to position: 725853-725879, mismatch: 2, identity: 0.926

cgctaccggtgccactgggcctcaagg	CRISPR spacer
cgctactggtgccactggacctcaagg	Protospacer
******.***********.********

110. spacer 5.1|3064195|23|NZ_CP053954|CRISPRCasFinder matches to position: 3064228-3064250, mismatch: 0, identity: 1.0

tggtggacatcatcaccatggag	CRISPR spacer
tggtggacatcatcaccatggag	Protospacer
***********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP053954_5	5.1\|3064195\|23\|NZ_CP053954\|CRISPRCasFinder	3064195-3064217	23	MN270889	Ralstonia phage P-PSG-11, complete genome	2610-2632	2	0.913
NZ_CP053954_5	5.1\|3064195\|23\|NZ_CP053954\|CRISPRCasFinder	3064195-3064217	23	MN270890	Ralstonia phage P-PSG-11-1, complete genome	2610-2632	2	0.913
NZ_CP053954_5	5.1\|3064195\|23\|NZ_CP053954\|CRISPRCasFinder	3064195-3064217	23	MN685189	UNVERIFIED: Ralstonia phage vRsoP-WF2 genomic sequence	18510-18532	2	0.913
NZ_CP053954_5	5.1\|3064195\|23\|NZ_CP053954\|CRISPRCasFinder	3064195-3064217	23	MF979559	Ralstonia phage DU_RP_I, complete genome	17559-17581	2	0.913
NZ_CP053954_5	5.1\|3064195\|23\|NZ_CP053954\|CRISPRCasFinder	3064195-3064217	23	MN685191	UNVERIFIED: Ralstonia phage vRsoP-WR2 genomic sequence	18510-18532	2	0.913
NZ_CP053954_5	5.1\|3064195\|23\|NZ_CP053954\|CRISPRCasFinder	3064195-3064217	23	MN685190	UNVERIFIED: Ralstonia phage vRsoP-WM2 genomic sequence	18982-19004	2	0.913
NZ_CP053954_5	5.1\|3064195\|23\|NZ_CP053954\|CRISPRCasFinder	3064195-3064217	23	NC_047946	Ralstonia phage RsoP1EGY, complete genome	30446-30468	2	0.913
NZ_CP053954_5	5.1\|3064195\|23\|NZ_CP053954\|CRISPRCasFinder	3064195-3064217	23	NZ_CP022541	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-1, complete sequence	193033-193055	3	0.87
NZ_CP053954_2	2.6\|724683\|27\|NZ_CP053954\|CRT	724683-724709	27	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	17010-17036	5	0.815
NZ_CP053954_2	2.8\|724764\|27\|NZ_CP053954\|CRT	724764-724790	27	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	17010-17036	5	0.815
NZ_CP053954_2	2.13\|724953\|27\|NZ_CP053954\|CRT	724953-724979	27	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	17010-17036	5	0.815
NZ_CP053954_2	2.14\|724998\|27\|NZ_CP053954\|CRT	724998-725024	27	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	17010-17036	5	0.815
NZ_CP053954_2	2.15\|725043\|27\|NZ_CP053954\|CRT	725043-725069	27	NZ_CP049038	Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_1, complete sequence	138828-138854	5	0.815
NZ_CP053954_2	2.15\|725043\|27\|NZ_CP053954\|CRT	725043-725069	27	NZ_CP010871	Confluentimicrobium sp. EMB200-NS6 strain EMBL200_NS6 plasmid pNS6002, complete sequence	13155-13181	5	0.815
NZ_CP053954_2	2.19\|725196\|27\|NZ_CP053954\|CRT	725196-725222	27	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	17010-17036	5	0.815
NZ_CP053954_2	2.20\|725241\|27\|NZ_CP053954\|CRT	725241-725267	27	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	17010-17036	5	0.815
NZ_CP053954_2	2.21\|725286\|27\|NZ_CP053954\|CRT	725286-725312	27	NZ_CP049038	Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_1, complete sequence	138828-138854	5	0.815
NZ_CP053954_2	2.21\|725286\|27\|NZ_CP053954\|CRT	725286-725312	27	NZ_CP010871	Confluentimicrobium sp. EMB200-NS6 strain EMBL200_NS6 plasmid pNS6002, complete sequence	13155-13181	5	0.815
NZ_CP053954_2	2.22\|725331\|27\|NZ_CP053954\|CRT	725331-725357	27	NZ_CP049038	Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_1, complete sequence	138828-138854	5	0.815
NZ_CP053954_2	2.22\|725331\|27\|NZ_CP053954\|CRT	725331-725357	27	NZ_CP010871	Confluentimicrobium sp. EMB200-NS6 strain EMBL200_NS6 plasmid pNS6002, complete sequence	13155-13181	5	0.815
NZ_CP053954_2	2.15\|725043\|27\|NZ_CP053954\|CRT	725043-725069	27	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	17010-17036	6	0.778
NZ_CP053954_2	2.21\|725286\|27\|NZ_CP053954\|CRT	725286-725312	27	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	17010-17036	6	0.778
NZ_CP053954_2	2.22\|725331\|27\|NZ_CP053954\|CRT	725331-725357	27	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	17010-17036	6	0.778
NZ_CP053954_2	2.6\|724683\|27\|NZ_CP053954\|CRT	724683-724709	27	NZ_CP049142	Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence	141375-141401	7	0.741
NZ_CP053954_2	2.8\|724764\|27\|NZ_CP053954\|CRT	724764-724790	27	NZ_CP049142	Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence	141375-141401	7	0.741
NZ_CP053954_2	2.13\|724953\|27\|NZ_CP053954\|CRT	724953-724979	27	NZ_CP049142	Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence	141375-141401	7	0.741
NZ_CP053954_2	2.14\|724998\|27\|NZ_CP053954\|CRT	724998-725024	27	NZ_CP049142	Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence	141375-141401	7	0.741
NZ_CP053954_2	2.19\|725196\|27\|NZ_CP053954\|CRT	725196-725222	27	NZ_CP049142	Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence	141375-141401	7	0.741
NZ_CP053954_2	2.20\|725241\|27\|NZ_CP053954\|CRT	725241-725267	27	NZ_CP049142	Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence	141375-141401	7	0.741
NZ_CP053954_4	4.1\|2214409\|31\|NZ_CP053954\|CRISPRCasFinder	2214409-2214439	31	JX238501	Bacillus phage phiAGATE, complete genome	124559-124589	8	0.742

1. spacer 5.1|3064195|23|NZ_CP053954|CRISPRCasFinder matches to MN270889 (Ralstonia phage P-PSG-11, complete genome) position: , mismatch: 2, identity: 0.913

tggtggacatcatcaccatggag	CRISPR spacer
tgctggacatcatcaccaaggag	Protospacer
** *************** ****

2. spacer 5.1|3064195|23|NZ_CP053954|CRISPRCasFinder matches to MN270890 (Ralstonia phage P-PSG-11-1, complete genome) position: , mismatch: 2, identity: 0.913

tggtggacatcatcaccatggag	CRISPR spacer
tgctggacatcatcaccaaggag	Protospacer
** *************** ****

3. spacer 5.1|3064195|23|NZ_CP053954|CRISPRCasFinder matches to MN685189 (UNVERIFIED: Ralstonia phage vRsoP-WF2 genomic sequence) position: , mismatch: 2, identity: 0.913

tggtggacatcatcaccatggag	CRISPR spacer
tgctggacatcatcaccaaggag	Protospacer
** *************** ****

4. spacer 5.1|3064195|23|NZ_CP053954|CRISPRCasFinder matches to MF979559 (Ralstonia phage DU_RP_I, complete genome) position: , mismatch: 2, identity: 0.913

tggtggacatcatcaccatggag	CRISPR spacer
tgctggacatcatcaccaaggag	Protospacer
** *************** ****

5. spacer 5.1|3064195|23|NZ_CP053954|CRISPRCasFinder matches to MN685191 (UNVERIFIED: Ralstonia phage vRsoP-WR2 genomic sequence) position: , mismatch: 2, identity: 0.913

tggtggacatcatcaccatggag	CRISPR spacer
tgctggacatcatcaccaaggag	Protospacer
** *************** ****

6. spacer 5.1|3064195|23|NZ_CP053954|CRISPRCasFinder matches to MN685190 (UNVERIFIED: Ralstonia phage vRsoP-WM2 genomic sequence) position: , mismatch: 2, identity: 0.913

tggtggacatcatcaccatggag	CRISPR spacer
tgctggacatcatcaccaaggag	Protospacer
** *************** ****

7. spacer 5.1|3064195|23|NZ_CP053954|CRISPRCasFinder matches to NC_047946 (Ralstonia phage RsoP1EGY, complete genome) position: , mismatch: 2, identity: 0.913

tggtggacatcatcaccatggag	CRISPR spacer
tgctggacatcatcaccaaggag	Protospacer
** *************** ****

8. spacer 5.1|3064195|23|NZ_CP053954|CRISPRCasFinder matches to NZ_CP022541 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-1, complete sequence) position: , mismatch: 3, identity: 0.87

tggtggacatcatcaccatggag	CRISPR spacer
tggtggacatcatcaccacggca	Protospacer
******************.** .

9. spacer 2.6|724683|27|NZ_CP053954|CRT matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 5, identity: 0.815

cgctaccggtgccactgggcctcgagg	CRISPR spacer
cgccaccggcgccactgggcctcgtac	Protospacer
***.*****.************** .

10. spacer 2.8|724764|27|NZ_CP053954|CRT matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 5, identity: 0.815

cgctaccggtgccactgggcctcgagg	CRISPR spacer
cgccaccggcgccactgggcctcgtac	Protospacer
***.*****.************** .

11. spacer 2.13|724953|27|NZ_CP053954|CRT matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 5, identity: 0.815

cgctaccggtgccactgggcctcgagg	CRISPR spacer
cgccaccggcgccactgggcctcgtac	Protospacer
***.*****.************** .

12. spacer 2.14|724998|27|NZ_CP053954|CRT matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 5, identity: 0.815

cgctaccggtgccactgggcctcgagg	CRISPR spacer
cgccaccggcgccactgggcctcgtac	Protospacer
***.*****.************** .

13. spacer 2.15|725043|27|NZ_CP053954|CRT matches to NZ_CP049038 (Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_1, complete sequence) position: , mismatch: 5, identity: 0.815

cgctaccggtgccactgggcctcaagg	CRISPR spacer
tcttgccggtgccactgggccccaagg	Protospacer
. .*.****************.*****

14. spacer 2.15|725043|27|NZ_CP053954|CRT matches to NZ_CP010871 (Confluentimicrobium sp. EMB200-NS6 strain EMBL200_NS6 plasmid pNS6002, complete sequence) position: , mismatch: 5, identity: 0.815

cgctaccggtgccactgggcctcaagg	CRISPR spacer
tcttgccggtgccactgggccccaagg	Protospacer
. .*.****************.*****

15. spacer 2.19|725196|27|NZ_CP053954|CRT matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 5, identity: 0.815

cgctaccggtgccactgggcctcgagg	CRISPR spacer
cgccaccggcgccactgggcctcgtac	Protospacer
***.*****.************** .

16. spacer 2.20|725241|27|NZ_CP053954|CRT matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 5, identity: 0.815

cgctaccggtgccactgggcctcgagg	CRISPR spacer
cgccaccggcgccactgggcctcgtac	Protospacer
***.*****.************** .

17. spacer 2.21|725286|27|NZ_CP053954|CRT matches to NZ_CP049038 (Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_1, complete sequence) position: , mismatch: 5, identity: 0.815

cgctaccggtgccactgggcctcaagg	CRISPR spacer
tcttgccggtgccactgggccccaagg	Protospacer
. .*.****************.*****

18. spacer 2.21|725286|27|NZ_CP053954|CRT matches to NZ_CP010871 (Confluentimicrobium sp. EMB200-NS6 strain EMBL200_NS6 plasmid pNS6002, complete sequence) position: , mismatch: 5, identity: 0.815

cgctaccggtgccactgggcctcaagg	CRISPR spacer
tcttgccggtgccactgggccccaagg	Protospacer
. .*.****************.*****

19. spacer 2.22|725331|27|NZ_CP053954|CRT matches to NZ_CP049038 (Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_1, complete sequence) position: , mismatch: 5, identity: 0.815

cgctaccggtgccactgggcctcaagg	CRISPR spacer
tcttgccggtgccactgggccccaagg	Protospacer
. .*.****************.*****

20. spacer 2.22|725331|27|NZ_CP053954|CRT matches to NZ_CP010871 (Confluentimicrobium sp. EMB200-NS6 strain EMBL200_NS6 plasmid pNS6002, complete sequence) position: , mismatch: 5, identity: 0.815

cgctaccggtgccactgggcctcaagg	CRISPR spacer
tcttgccggtgccactgggccccaagg	Protospacer
. .*.****************.*****

21. spacer 2.15|725043|27|NZ_CP053954|CRT matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 6, identity: 0.778

cgctaccggtgccactgggcctcaagg	CRISPR spacer
cgccaccggcgccactgggcctcgtac	Protospacer
***.*****.*************. .

22. spacer 2.21|725286|27|NZ_CP053954|CRT matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 6, identity: 0.778

cgctaccggtgccactgggcctcaagg	CRISPR spacer
cgccaccggcgccactgggcctcgtac	Protospacer
***.*****.*************. .

23. spacer 2.22|725331|27|NZ_CP053954|CRT matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 6, identity: 0.778

cgctaccggtgccactgggcctcaagg	CRISPR spacer
cgccaccggcgccactgggcctcgtac	Protospacer
***.*****.*************. .

24. spacer 2.6|724683|27|NZ_CP053954|CRT matches to NZ_CP049142 (Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence) position: , mismatch: 7, identity: 0.741

cgctaccggtgccactgggcctcgagg	CRISPR spacer
tcgaaccggtgccgctgggcctcgaat	Protospacer
.   *********.***********.

25. spacer 2.8|724764|27|NZ_CP053954|CRT matches to NZ_CP049142 (Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence) position: , mismatch: 7, identity: 0.741

cgctaccggtgccactgggcctcgagg	CRISPR spacer
tcgaaccggtgccgctgggcctcgaat	Protospacer
.   *********.***********.

26. spacer 2.13|724953|27|NZ_CP053954|CRT matches to NZ_CP049142 (Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence) position: , mismatch: 7, identity: 0.741

cgctaccggtgccactgggcctcgagg	CRISPR spacer
tcgaaccggtgccgctgggcctcgaat	Protospacer
.   *********.***********.

27. spacer 2.14|724998|27|NZ_CP053954|CRT matches to NZ_CP049142 (Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence) position: , mismatch: 7, identity: 0.741

cgctaccggtgccactgggcctcgagg	CRISPR spacer
tcgaaccggtgccgctgggcctcgaat	Protospacer
.   *********.***********.

28. spacer 2.19|725196|27|NZ_CP053954|CRT matches to NZ_CP049142 (Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence) position: , mismatch: 7, identity: 0.741

cgctaccggtgccactgggcctcgagg	CRISPR spacer
tcgaaccggtgccgctgggcctcgaat	Protospacer
.   *********.***********.

29. spacer 2.20|725241|27|NZ_CP053954|CRT matches to NZ_CP049142 (Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence) position: , mismatch: 7, identity: 0.741

cgctaccggtgccactgggcctcgagg	CRISPR spacer
tcgaaccggtgccgctgggcctcgaat	Protospacer
.   *********.***********.

30. spacer 4.1|2214409|31|NZ_CP053954|CRISPRCasFinder matches to JX238501 (Bacillus phage phiAGATE, complete genome) position: , mismatch: 8, identity: 0.742

ttcttcttttttgtcactagttgaaccgctt	CRISPR spacer
ctaaccttttttgccactagttaaaccgccc	Protospacer
.*  .********.********.******..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

187192 : 205067

Mycobacterium_phage(50.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852266.1\|187192_188623_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_141543160.1\|188855_190286_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_172852456.1\|190551_191982_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_172852458.1\|192275_192755_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_172852460.1\|193000_194407_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	3.9e-32	28.1
WP_141528530.1\|194684_196115_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_141528530.1\|196351_197782_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000536355.1\|198116_199028_-	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_000701557.1\|199317_199917_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_000562836.1\|200008_200839_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000428354.1\|201005_201410_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	5.5e-48	72.2
WP_000826532.1\|201435_202476_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_001270993.1\|202494_202932_-	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
WP_002103330.1\|202992_203298_-	arsenical resistance operon transcriptional regulator ArsR	NA	NA	NA	NA
WP_061663671.1\|204410_205067_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_2

1495936 : 1503621

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000221066.1\|1495936_1496860_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-45	43.5
WP_172852581.1\|1496985_1497921_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.6e-21	24.8
WP_000018029.1\|1497922_1498615_-	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	1.4e-06	28.8
WP_001293578.1\|1498783_1498957_+	hypothetical protein	NA	NA	NA	NA
WP_001014310.1\|1498957_1499152_+	YwbE family protein	NA	NA	NA	NA
WP_098541173.1\|1499190_1500390_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	8.0e-71	41.2
WP_000587818.1\|1500684_1501008_+	heme oxygenase	NA	NA	NA	NA
WP_001086122.1\|1501080_1501845_-	class B sortase	NA	NA	NA	NA
WP_000403761.1\|1501877_1502648_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.6e-14	28.6
WP_098280954.1\|1502637_1503621_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	5.5e-17	26.6

DBSCAN-SWA_3

1612102 : 1627968

Bacillus_phage(30.77%)

protease,integrase,head,capsid

attL 1601759:1601773|attR 1626224:1626238

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1601759:1601773	attL	NA	NA	NA	NA
WP_042988818.1\|1612102_1612363_-	hypothetical protein	A0A0S2SXU9	Bacillus_phage	1.8e-28	69.8
WP_172852592.1\|1612542_1612728_-	hypothetical protein	A0A2H4J841	uncultured_Caudovirales_phage	4.9e-12	94.9
WP_172852593.1\|1612724_1612970_-	hypothetical protein	A0A1B1P7N2	Bacillus_phage	4.8e-31	85.3
WP_172852594.1\|1613110_1613326_-	hypothetical protein	NA	NA	NA	NA
WP_172852595.1\|1613605_1614373_+	hypothetical protein	NA	NA	NA	NA
WP_172852596.1\|1614537_1615725_-	ImmA/IrrE family metallo-endopeptidase	A0A0A7RTT7	Clostridium_phage	3.8e-97	46.2
WP_172852597.1\|1615753_1616524_-	hypothetical protein	NA	NA	NA	NA
WP_172852598.1\|1616615_1617575_-\|capsid	phage major capsid protein	A0A2H4J9Y4	uncultured_Caudovirales_phage	6.9e-65	43.0
WP_172852599.1\|1617601_1618204_-\|head,protease	HK97 family phage prohead protease	B4XYP5	Lactobacillus_phage	4.5e-14	30.3
WP_170968783.1\|1618209_1618365_-	hypothetical protein	NA	NA	NA	NA
WP_172852600.1\|1618720_1619005_-	hypothetical protein	NA	NA	NA	NA
WP_172852601.1\|1619025_1619406_-	hypothetical protein	A0A288WG73	Bacillus_phage	1.1e-50	78.0
WP_172852602.1\|1619427_1619649_-	hypothetical protein	NA	NA	NA	NA
WP_172852603.1\|1619988_1622271_-	DNA primase	A0A2H4JCU9	uncultured_Caudovirales_phage	5.5e-161	41.5
WP_172852604.1\|1622373_1622766_-	hypothetical protein	NA	NA	NA	NA
WP_001014689.1\|1622779_1622926_-	hypothetical protein	A0A1B2APZ0	Phage_Wrath	1.1e-09	68.9
WP_098432480.1\|1623083_1623353_-	hypothetical protein	NA	NA	NA	NA
WP_098432482.1\|1623402_1623597_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_172852605.1\|1623748_1624459_+	helix-turn-helix transcriptional regulator	I2E8Y1	Clostridium_phage	2.4e-06	35.8
WP_172852606.1\|1624481_1625702_+\|integrase	site-specific integrase	A0A1Q1PVS7	Staphylococcus_phage	2.6e-40	31.4
WP_001063532.1\|1626023_1626281_-	hypothetical protein	A0A0S2SXU9	Bacillus_phage	2.0e-24	65.4
1626224:1626238	attR	NA	NA	NA	NA
WP_001288257.1\|1626273_1626450_-	hypothetical protein	NA	NA	NA	NA
WP_044584905.1\|1627006_1627789_+	hypothetical protein	NA	NA	NA	NA
WP_002196925.1\|1627797_1627968_+	hypothetical protein	A0A2H4J549	uncultured_Caudovirales_phage	2.7e-09	55.4

DBSCAN-SWA_4

2687720 : 2695668

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917311.1\|2687720_2688005_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	54.8
WP_001029993.1\|2688043_2689678_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.5e-157	58.0
WP_162841983.1\|2690081_2691623_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	8.9e-22	31.7
WP_000833096.1\|2692008_2693334_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	4.1e-44	29.4
WP_000929880.1\|2693477_2694179_+	response regulator transcription factor	W8CYM9	Bacillus_phage	9.5e-40	36.0
WP_000719210.1\|2694162_2695668_+	aminopeptidase AmpS	W8CYF6	Bacillus_phage	7.8e-31	30.0

DBSCAN-SWA_5

2741291 : 2749667

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625682.1\|2741291_2742599_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
WP_001170544.1\|2742687_2743407_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	4.0e-49	44.3
WP_000278823.1\|2743399_2743654_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666787.1\|2743650_2744334_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_172852692.1\|2744317_2746537_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	5.1e-164	41.3
WP_000879032.1\|2746521_2747937_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.3e-55	35.2
WP_001262439.1\|2748042_2749083_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-67	45.9
WP_000088589.1\|2749079_2749667_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.1e-28	37.4

DBSCAN-SWA_6

4102022 : 4118873

Brevibacillus_phage(100.0%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002062978.1\|4102022_4102541_+	hypothetical protein	A0A0K2CP30	Brevibacillus_phage	4.4e-26	45.8
WP_000077128.1\|4102540_4103629_+	hypothetical protein	A0A0K2CNX7	Brevibacillus_phage	1.2e-94	55.8
WP_000004089.1\|4103860_4104331_+	hypothetical protein	A0A0K2CPC8	Brevibacillus_phage	1.4e-34	52.9
WP_000743719.1\|4104417_4104660_+	hypothetical protein	A0A0K2CP74	Brevibacillus_phage	2.1e-18	55.0
WP_172852855.1\|4104732_4110066_+\|tail	phage tail tape measure protein	A0A0K2CPN3	Brevibacillus_phage	3.0e-141	26.6
WP_000068593.1\|4110124_4110742_+	S-layer homology domain-containing protein	A0A0K2CPJ2	Brevibacillus_phage	1.4e-71	60.7
WP_061663908.1\|4110744_4111818_+	hypothetical protein	A0A0K2CP35	Brevibacillus_phage	5.3e-74	40.3
WP_172852856.1\|4111830_4115022_+	M23 family metallopeptidase	A0A0K2CNY2	Brevibacillus_phage	3.7e-06	50.0
WP_172852857.1\|4115100_4115817_+	hypothetical protein	NA	NA	NA	NA
WP_000007798.1\|4115831_4116272_+	hypothetical protein	NA	NA	NA	NA
WP_172852858.1\|4116287_4118873_+	hypothetical protein	A0A0K2CPJ7	Brevibacillus_phage	1.6e-31	44.2

DBSCAN-SWA_7

4131786 : 4146352

Brevibacillus_phage(55.56%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098507678.1\|4131786_4132908_+	hypothetical protein	A0A0K2CPP1	Brevibacillus_phage	7.3e-66	37.3
WP_172852862.1\|4132919_4133651_+	hypothetical protein	NA	NA	NA	NA
WP_098507680.1\|4133729_4134173_+	hypothetical protein	A0A0K2CPK2	Brevibacillus_phage	3.0e-23	40.6
WP_001111329.1\|4134248_4134740_+	hypothetical protein	A0A0K2CNZ3	Brevibacillus_phage	2.0e-36	54.5
WP_000602965.1\|4134780_4135392_+	hypothetical protein	A0A127AW14	Bacillus_phage	2.2e-48	51.6
WP_172852863.1\|4135376_4138271_+	halomucin	A0A0K2CPP4	Brevibacillus_phage	2.2e-13	30.4
WP_098507682.1\|4138313_4142669_+	DNRLRE domain-containing protein	A0A127AWB0	Bacillus_phage	6.4e-25	27.5
WP_001125914.1\|4143239_4143608_+	hypothetical protein	NA	NA	NA	NA
WP_000655296.1\|4143607_4143985_+	hypothetical protein	NA	NA	NA	NA
WP_097999166.1\|4144184_4145192_+	N-acetylmuramoyl-L-alanine amidase	A0A127AWA8	Bacillus_phage	1.6e-11	50.0
WP_000998964.1\|4145208_4145508_+	hypothetical protein	A0A0K2CPL0	Brevibacillus_phage	5.0e-22	59.3
WP_053514173.1\|4145527_4146352_+	hypothetical protein	A7KV11	Bacillus_phage	2.5e-79	70.5

DBSCAN-SWA_8

4154472 : 4163858

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000177372.1\|4154472_4155180_-	DNA polymerase I	A0A0K2CNW2	Brevibacillus_phage	7.3e-64	53.5
WP_000781409.1\|4155348_4155753_-	hypothetical protein	NA	NA	NA	NA
WP_098507687.1\|4156376_4157771_-	DNA polymerase I	A0A0K2CP19	Brevibacillus_phage	9.2e-103	45.6
WP_053514165.1\|4157857_4158517_-	hypothetical protein	A0A0K2CPH8	Brevibacillus_phage	8.1e-57	56.4
WP_001090550.1\|4158979_4159537_-	sigma-70 family RNA polymerase sigma factor	A0A0K2CPD2	Brevibacillus_phage	2.4e-25	41.1
WP_098507688.1\|4159564_4160641_-	toprim domain-containing protein	A0A0K2CNW6	Brevibacillus_phage	1.4e-103	54.0
WP_098507689.1\|4160665_4161958_-	DNA helicase	A0A0K2CP24	Brevibacillus_phage	7.9e-141	57.9
WP_001005179.1\|4162437_4163208_-	ATP-binding protein	A0A0K2CNX1	Brevibacillus_phage	2.0e-62	48.4
WP_000278596.1\|4163267_4163858_-	helix-turn-helix domain-containing protein	A0A0K2CNS5	Brevibacillus_phage	7.8e-27	44.3

DBSCAN-SWA_9

4948616 : 5003880

Bacillus_phage(80.56%)

head,tail,terminase,integrase,bacteriocin,holin

attL 4939479:4939495|attR 4967361:4967377

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4939479:4939495	attL	NA	NA	NA	NA
WP_001071364.1\|4948616_4948937_+\|bacteriocin	heterocycloanthracin/sonorensin family bacteriocin	NA	NA	NA	NA
WP_002063155.1\|4949426_4949912_+	hypothetical protein	NA	NA	NA	NA
WP_088069144.1\|4950221_4950923_+	DUF3962 domain-containing protein	NA	NA	NA	NA
WP_172852973.1\|4950961_4952071_-\|integrase	tyrosine-type recombinase/integrase	A0A0U3U8Y8	Bacillus_phage	8.3e-147	78.8
WP_172852974.1\|4952368_4952833_+	hypothetical protein	NA	NA	NA	NA
WP_149216295.1\|4952876_4953086_-	hypothetical protein	NA	NA	NA	NA
WP_172852975.1\|4953905_4955084_+	hypothetical protein	A0A1B1P895	Bacillus_phage	4.5e-127	57.1
WP_164876569.1\|4955080_4955227_+	hypothetical protein	NA	NA	NA	NA
WP_098023290.1\|4955537_4955906_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	2.4e-10	39.0
WP_128974839.1\|4956148_4956349_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_172852976.1\|4956427_4956703_+	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	4.1e-31	75.3
WP_172852977.1\|4956847_4957168_+	hypothetical protein	I3WU08	Bacillus_phage	3.2e-27	59.2
WP_172852978.1\|4957168_4957363_+	hypothetical protein	NA	NA	NA	NA
WP_172852979.1\|4957439_4957940_+	HNH endonuclease	A0A2H4J6F5	uncultured_Caudovirales_phage	5.1e-19	37.1
WP_172852980.1\|4957940_4958885_+	YqaJ viral recombinase family protein	A6XMH8	Bacillus_virus	2.6e-85	53.0
WP_172852981.1\|4958898_4959147_+	hypothetical protein	NA	NA	NA	NA
WP_172852982.1\|4959136_4959943_+	recombination protein RecT	S6AVW6	Thermus_phage	4.1e-95	65.4
WP_172852407.1\|4959935_4960112_+	hypothetical protein	NA	NA	NA	NA
WP_172852983.1\|4960113_4960971_+	DnaD domain protein	A0A0S2MVA0	Bacillus_phage	1.6e-73	56.1
WP_172853098.1\|4961041_4961734_+	ATP-binding protein	S6B1M2	Thermus_phage	3.0e-62	51.9
WP_149216304.1\|4961739_4961928_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.5e-13	52.5
WP_172852984.1\|4961908_4962391_+	YpiB family protein	NA	NA	NA	NA
WP_172853099.1\|4962538_4962853_+	hypothetical protein	A0A0A7AQW3	Bacillus_phage	4.3e-24	48.5
WP_172852985.1\|4963431_4963848_+	DUF1064 domain-containing protein	A0A0U4ISA7	Bacillus_phage	8.2e-31	51.5
WP_172852986.1\|4963862_4964573_+	2-methylcitrate dehydratase	NA	NA	NA	NA
WP_172853100.1\|4964666_4965536_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_172852987.1\|4965545_4965935_+	hypothetical protein	NA	NA	NA	NA
WP_172852988.1\|4966160_4966691_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_065212698.1\|4966980_4967175_-	hypothetical protein	NA	NA	NA	NA
WP_172852989.1\|4968360_4968657_+	hypothetical protein	A0A0M4REQ3	Bacillus_phage	1.5e-34	76.8
4967361:4967377	attR	NA	NA	NA	NA
WP_172852990.1\|4968863_4969154_-	DUF4183 domain-containing protein	NA	NA	NA	NA
WP_172852991.1\|4969703_4970111_+	hypothetical protein	NA	NA	NA	NA
WP_172852992.1\|4970553_4970841_-	hypothetical protein	NA	NA	NA	NA
WP_172852993.1\|4972227_4972494_+	hypothetical protein	NA	NA	NA	NA
WP_172852994.1\|4972603_4972894_-	hypothetical protein	NA	NA	NA	NA
WP_172852995.1\|4973093_4973723_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_172852996.1\|4973910_4974228_+	transglycosylase	NA	NA	NA	NA
WP_172852409.1\|4974244_4974433_+	hypothetical protein	NA	NA	NA	NA
WP_172852997.1\|4975046_4976342_+	collagen-like repeat preface domain-containing protein	A0A2R8FCV3	Brazilian_cedratvirus	4.5e-19	40.2
WP_172852998.1\|4976666_4977041_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	3.0e-16	39.7
WP_098394576.1\|4977661_4977868_-	hypothetical protein	NA	NA	NA	NA
WP_172852999.1\|4978234_4978441_+	hypothetical protein	NA	NA	NA	NA
WP_172853000.1\|4979175_4979505_-	WGxxGxxG-CTERM domain-containing protein	NA	NA	NA	NA
WP_088009814.1\|4979851_4980367_+	DUF3231 family protein	NA	NA	NA	NA
WP_172853001.1\|4981592_4982531_+\|terminase	terminase small subunit	A0A0S2MVB6	Bacillus_phage	1.6e-114	83.5
WP_172853002.1\|4982517_4983789_+\|terminase	PBSX family phage terminase large subunit	A0A1L2JY46	Aeribacillus_phage	2.2e-220	84.2
WP_172853003.1\|4985308_4986076_+\|head	phage head protein	A0A0S2MVF0	Bacillus_phage	2.7e-136	94.1
WP_172853004.1\|4986148_4986859_+	DUF4355 domain-containing protein	A0A0A7AQU8	Bacillus_phage	2.4e-70	69.9
WP_071730467.1\|4986967_4987813_+	hypothetical protein	A0A0S2MVF8	Bacillus_phage	1.2e-150	96.8
WP_098284890.1\|4987856_4988165_+	hypothetical protein	A0A0A7AQX9	Bacillus_phage	6.4e-49	92.2
WP_172853005.1\|4988161_4988509_+\|head,tail	head-tail adaptor protein	A0A0S2MVD7	Bacillus_phage	5.2e-55	90.4
WP_097879993.1\|4988483_4988891_+	HK97 gp10 family phage protein	A0A0A7AQU9	Bacillus_phage	3.4e-66	94.8
WP_098430317.1\|4988896_4989259_+	hypothetical protein	A0A0A7AQF9	Bacillus_phage	1.5e-60	92.5
WP_071730458.1\|4989273_4989867_+	hypothetical protein	A0A0S2MV81	Bacillus_phage	1.3e-106	97.0
WP_172853006.1\|4989913_4990342_+	hypothetical protein	A0A0S2MV94	Bacillus_phage	1.1e-67	94.4
WP_000375621.1\|4990446_4990653_+	hypothetical protein	A0A0S2MV68	Bacillus_phage	2.1e-32	98.5
WP_172853007.1\|4993576_4995058_+\|tail	phage tail family protein	A0A0S2MV63	Bacillus_phage	4.5e-265	87.8
WP_172853008.1\|4995054_4999362_+	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	63.3
WP_172853009.1\|4999378_4999756_+	hypothetical protein	A0A0S2MVE0	Bacillus_phage	6.0e-41	64.0
WP_000390479.1\|4999883_5000108_+	hypothetical protein	A0A1B1P780	Bacillus_phage	8.5e-27	89.2
WP_172853010.1\|5000182_5000590_+\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	7.4e-61	88.6
WP_172853011.1\|5000608_5001418_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	5.8e-150	90.0
WP_172853012.1\|5001872_5002085_+	alpha/beta-type small acid-soluble spore protein	Q77YX0	Bacillus_phage	6.4e-16	66.2
WP_172853013.1\|5002361_5002877_+	DUF3231 family protein	NA	NA	NA	NA
WP_172853014.1\|5002909_5003392_-	YndM family protein	NA	NA	NA	NA
WP_000069660.1\|5003667_5003880_+	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	1.6e-14	68.3

DBSCAN-SWA_10

5042706 : 5047943

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001139345.1\|5042706_5042922_-	spore germination protein	A0A2H4J3A3	uncultured_Caudovirales_phage	3.4e-25	83.8
WP_000369348.1\|5043158_5043290_+	DUF3983 domain-containing protein	A0A1B1P7V8	Bacillus_phage	2.9e-11	79.1
WP_000097509.1\|5043654_5044455_+	C1 family peptidase	A0A2K9L1Z4	Tupanvirus	1.0e-37	37.2
WP_172853023.1\|5044474_5044687_+	hypothetical protein	NA	NA	NA	NA
WP_002061469.1\|5044751_5044952_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	1.0e-15	90.9
WP_172853024.1\|5045089_5045971_-	serine/threonine protein kinase	NA	NA	NA	NA
WP_000372690.1\|5046098_5046608_+	GrpB family protein	A0A2K5B2B6	Erysipelothrix_phage	1.4e-16	36.0
WP_000411453.1\|5046725_5047256_+	hypothetical protein	NA	NA	NA	NA
WP_001163828.1\|5047268_5047943_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.8e-28	30.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP053953

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP053953_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053953_1

257384-257617

TypeV

Consensus_repeat	Method
AAAGCCAGAAACTAAGCCAGAGACAAAACC	CRT

4 spacers

cas14k

The CRISPR arrays of NZ_CP053953_1

>merge|NZ_CP053953|1|257384-257617|CRT
AAAGCCAGAAACTAAGCCAGAGACAAAGCCAGAAATTAAGCCAGAGACAAAGCCAGAAACTAAGCCAGAGACAAAACCAGAGACAAAACCAGAGACAAAACCAGAGACAAAGCCAGAGACAAAACCAGAGACAAAGCCAGAGACAAAGCCAGAGACAAAGCCAGAAACTAAGCCAGAGACAAAACCTGAAACAAAACCAGAGACAAAGCCAGAAACTAAGCCAGAGACAAAACC

>NZ_CP053953|1|1|257384-257617|CRT
AAAGCCAGAAACTAAGCCAGAGACAAAGCC	AGAAATTAAGCCAGAGAC
AAAGCCAGAAACTAAGCCAGAGACAAAACC	AGAGACAAAACCAGAGAC
AAAACCAGAGACAAAGCCAGAGACAAAACC	AGAGACAAAGCCAGAGACAAAGCCAGAGAC
AAAGCCAGAAACTAAGCCAGAGACAAAACC	TGAAACAAAACCAGAGAC
AAAGCCAGAAACTAAGCCAGAGACAAAACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053953.1\|WP_001002944.1\|253112_254066_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053953.1\|WP_172852333.1\|264765_265698_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053953.1\|WP_172852330.1\|258242_260588_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053953.1\|WP_000353169.1\|261067_261253_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053953.1\|WP_000411523.1\|248482_248791_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053953.1\|WP_172852327.1\|254085_255585_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053953.1\|WP_000879955.1\|266877_267081_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053953.1\|WP_001181739.1\|256076_256472_+\|DUF4320-family-protein	unknown	unknown	gnl\|CDD\|379505
NZ_CP053953.1\|WP_000564664.1\|247335_247941_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133393
NZ_CP053953.1\|WP_172852332.1\|262504_263323_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379293
NZ_CP053953.1\|WP_172852325.1\|245059_246367_-\|plasmid-replication-protein-RepX	unknown	unknown	gnl\|CDD\|333832
NZ_CP053953.1\|WP_172852328.1\|255601_256051_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053953.1\|WP_172852324.1\|243338_244625_-\|replication-relaxation-family-protein	unknown	unknown	gnl\|CDD\|379384
NZ_CP053953.1\|WP_172852331.1\|261627_262488_+\|Flp-pilus-assembly-protein-CpaB	unknown	unknown	gnl\|CDD\|274472
NZ_CP053953.1\|WP_033690429.1\|246407_246737_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053953.1\|WP_172852326.1\|250787_252257_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14k	-	gnl\|CDD\|223747
NZ_CP053953.1\|WP_000956352.1\|266607_266811_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053953.1\|WP_000264602.1\|263339_264773_+\|CpaF-family-protein	unknown	unknown	gnl\|CDD\|227297
NZ_CP053953.1\|WP_000358430.1\|260719_260881_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053953.1\|WP_172852334.1\|265699_266566_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP053953.1\|WP_172852332.1\|262504_263323_+\|AAA-family-ATPase	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	2.99313e-13
NZ_CP053953.1\|WP_172852325.1\|245059_246367_-\|plasmid-replication-protein-RepX	gnl\|CDD\|333832	pfam00091, Tubulin, Tubulin/FtsZ family, GTPase domain. This family includes the tubulin alpha, beta and gamma chains, as well as the bacterial FtsZ family of proteins. Members of this family are involved in polymer formation. FtsZ is the polymer-forming protein of bacterial cell division. It is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells. FtsZ and tubulin are GTPases. FtsZ can polymerize into tubes, sheets, and rings in vitro and is ubiquitous in eubacteria and archaea. Tubulin is the major component of microtubules.	7.79488e-14
NZ_CP053953.1\|WP_172852324.1\|243338_244625_-\|replication-relaxation-family-protein	gnl\|CDD\|379384	pfam13814, Replic_Relax, Replication-relaxation. This family includes proteins which are essential for plasmid replication and plasmid DNA relaxation.	2.60214e-19
NZ_CP053953.1\|WP_172852331.1\|261627_262488_+\|Flp-pilus-assembly-protein-CpaB	gnl\|CDD\|274472	TIGR03177, pilus_cpaB, Flp pilus assembly protein CpaB. Members of this protein family are the CpaB protein of Flp-type pilus assembly. Similar proteins include the FlgA protein of bacterial flagellum biosynthesis.	5.74367e-18
NZ_CP053953.1\|WP_172852326.1\|250787_252257_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.26031e-23
NZ_CP053953.1\|WP_000264602.1\|263339_264773_+\|CpaF-family-protein	gnl\|CDD\|227297	COG4962, CpaF, Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion].	4.36479e-56
NZ_CP053953.1\|WP_001181739.1\|256076_256472_+\|DUF4320-family-protein	gnl\|CDD\|379505	pfam14208, DUF4320, Domain of unknown function (DUF4320). This family of proteins is found in bacteria. Proteins in this family are typically between 120 and 131 amino acids in length. There are two completely conserved residues (G and Y) that may be functionally important.	6.24284e-28
NZ_CP053953.1\|WP_000564664.1\|247335_247941_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133393	cd04765, HTH_MlrA-like_sg2, Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators. Putative helix-turn-helix (HTH) MlrA-like transcription regulators (subgroup 2), N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	0.000963573

>NZ_CP053953.1|WP_001181739.1|256076_256472_+|DUF4320-family-protein
MQNTVTTALFLTLSLLLITLIPEGVLYGMQLIKAHDFASSTVELAEKTGGFQYTYEGKNVNLIPDIEKKMKEQNMDGWKYEYTKGRVDHNQPLNFKIKAEHHFFIFKMIGIDSVKAPIWANKDGMGQIYFR
>NZ_CP053953.1|WP_172852328.1|255601_256051_+|hypothetical-protein
MQKFIIGAASLLLFVGCLFLMTDMIIGDTTHTDNKSALERAGSTAMDKSVKVGVLRAQEEIAIEPEIAKKEFEKSYNQNATFKDPASKREFSVHAVQEQPAMIAVEGEAEAASYTKQFDEKQGSIKSNAKHIFIYEADSDNQKAGGNVK
>NZ_CP053953.1|WP_172852327.1|254085_255585_+|hypothetical-protein
MVKKIVLAISDTVYTAYLREDFIGAGFEVADSDVMHIKYLDEILDTEQPNILCINDKRLNIDAGHEEKRELIILQKLRDIRFNRDIRIVVFTERENDDEFLAKLIYLGIYDIFNSRKIDIDNKVIPQLLQESDIKNVAEIVGASQAPQQTKLPEVPVDEEEEEASSELGEGGNSEPASNSNKLFKNKQKRKSVPDEMPKAPIIKKQYKFAFEPVYEKQIGIAIPRRTIVVASMNRRSGATFVSHLLAAYLNELQIDVNYIENLYDDGYTYPLLKGYTEAPENYRSEFMLQRYKEMLQKESDILSIPKWKQGRINYIVKNPIVDQELKNETEQDFDHFIKVLLANQEAPISIIDAGSDWDKDLYHEICEMADYIFFVVEPDLHQLLKITHPLTQKERKLVSYLALEKTRIIGNKFSPALLKHEVIEECFGDKLLTALPPYDVEGVFESQLNSSTLLSNRNYYKELEGILKEIAELLLPNQLLNQKKSSILSGFRFRKSES
>NZ_CP053953.1|WP_001002944.1|253112_254066_+|hypothetical-protein
MNEIVNMSKERFTKYCEGNAAFEENISCIINHYFLLLGNKANILQEREFNNEIEEKTFKNNVKRFETLFPAAVKNAFLKGYQLCLEFIHHPETQIPENLYTDPNFIKDIPFALANASEYELYEIIRTDETQEFSVFAIRTYEGIRPLLEQVFCEVAYSGAEYAFEHERLERGFELVKGDTTLLTKVPVDRFFSITPSVNGVVVHAEEHCEIWTLNWNSKVTIDNPFIEVAEVTFIHQTKDMIQKNIEDGVLYHSFLYLDTPLHEIQDRLEIRLKLNSDFGAPRSMEQVEMEYILNEIIGKVHLQTQIPIENMILIQR
>NZ_CP053953.1|WP_172852326.1|250787_252257_+|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MTKENPSNYKTLQIWIKKGHRMYSYFQECCHNAKNMYNTTNFYIRQVYTGLTQEKELQPLQKEVLDHIHKNIGKMNDTQRLAYQKKLEKEKVKPKEEQKEITCNLFSEPNFEKPYVDYNFLDALFKAMIQNDYRALPTQCSQSIMKGLFQNWKSFFASLKDYKKNPNKYAGMPRIPKYIRSSEKEILYTNQDCIIKKDRFLKFPKTKLQLNIGKLGFTEGKLKQVRVIPKYNEYVVELVIDVPSEQQMIEENARYMSIDLGIDNLATIVTNTGMKPVLVKGKHVKSINQYYNKMKSHFTSILRNGKQTNEGPFTSKRIEKLHQKRYLKIKDVFHKVSHRIVKLAQEEEVCKIVIGQNKSWKQETNMGKRNNQSFCHIPHNLLIQMITYKANAVGIHVVVTEESYTSKASFLDNDFIPTYGENDQNTTFSGKRIKRGIYRSANKTLINADVNAAANILRKVIPNAWTNGIEGLGVKQLANVLTPLTLIVR
>NZ_CP053953.1|WP_000411523.1|248482_248791_-|hypothetical-protein
MEKINSIPKPFFETLGEHGTTYLVYGYRVAQPKLYLGEFNSLKEARRFIYKYAYNNPQWLNADGDINEYNNKPSRPESDNKRYKGVIEKEYKKYADFKGWKK
>NZ_CP053953.1|WP_000564664.1|247335_247941_+|MerR-family-transcriptional-regulator
MIDEQLSDGYYRVSEVATMLDIPESTLRRWLNDFDEYLNIKKERQLKYVHEDSIDTVKKIKHYYSESKKKHEIVGLLDMDPTVIRNVYAEDVDGDGEPKETSLVKAQQVNLDFIEALTEKITEEVTAKVTEELTKQNMEFFAAVAKQSQDNFDRINKRLEERDEKLMSTIRLIQEQKSANAQRQENTEQKGGFFSKLFGKK
>NZ_CP053953.1|WP_033690429.1|246407_246737_-|hypothetical-protein
MSSNEIIDVLCENLNDGIWALRVLYAEGAMHKEKLWDCINQYHKEYQIENEKDYEGKKILPSRYALDIMTARLEGAGLISFKPFGRVRVYEVTDLGNVLIKELEKRKKS
>NZ_CP053953.1|WP_172852325.1|245059_246367_-|plasmid-replication-protein-RepX
MAGNFSEIESQGNISLKFGFLGLGMGGCAIAAECANKETQIKNNKYPYRAILVNTNSQDFNKIEIKNGGNVRKIQLEGYEQGAARNPQVGEEAFVKHESKIFEAVKQEFEDRDFIWITCGLGGGTGTGALLKAIEMLYEHDYNFGLLLTLPRDAEALKVLENATSRIRSIAMNQEAFGSIVLIDNAKLYRKFEEENPSALANEYTSYSNKYIADALHEINLVTSSFTPFSDTHFDASEFAQVINTPGVLSLAKLELKSNQLDTENPLGYLTQLGNALEKGVLYDTEREELESAKKSALSIVTSPLRAGRLYNFSFLNQMENFLKERTPYVDERPIAPYVNKHTAKKEEDIVKFYSVVAGLPLPKRVSDIIDEITRIKEEREQANSKKSNAVLNKLFAFDDSVQEEKPKKKKLNFGAEPEVEVADDSQPVKKKLSF
>NZ_CP053953.1|WP_172852324.1|243338_244625_-|replication-relaxation-family-protein
MKSKTYKYTSKGTQKSFRLKEADLFVFTYLYYKRHLTTRQITQLYSAFEGRDFSEDSVFTKLNRFSKYGAILTKKIDKRDDSITRRATFSLKDRMVDYLQEIGRIPEGSSKRRYSSSISLHTLCSREILVRTLLEVSKKTNTNKILSELDIRSYHQKQKKTEIEDAGLLLIPDEHISYQDKNIYIEMDMCKETNATLVEKVGKYIEYAQKNTKNITVVFVMYDKSMFLAEDAEPPYVRMKNLLFSMREYHELLMNLPYLNMYICSLKEAGDVISDIILGIDDNQNFEQDILLPLSQRTVGDADWRYAFVEKVQTFKETIDGGLRRTYRRDKAAMQDFFFIFGNENDYRMIARLDDVVFSRREGDEGVPLVVIYPKRKKARDILLMDIYDNVLLLSLQNESVTIDADEQLMARTANNIHPKRRKLVELY
>NZ_CP053953.1|WP_172852330.1|258242_260588_+|hypothetical-protein
MRLKRGLLFICTSTMLAIPSMASAKNNDVPFYNGQNDSFLTSLNLQLPGKYYRPGSGYAAKESLYRADVHFPAVYNGSFNWDNPWENLVQAEDTSEPYIRIANEGYLNSKVPAGDRMVTEVERVNNSVISSKYWGNPEFVLEYMDKHMIQTYESFRELGQFYWIRDIAYLSGGYAGASGVNNINKYSLWYVRTSKPQVKDFQAMSGKKDIPVKFTFKGFEYVSKNKGYNDRDPNGTTVNPYQKAAGERNRVKWMLDITKDGETVYHQENYLRSTPQKDNQKLNEGDAGEFKSEELKWQPQMCGRYTAKIKVLDAVQRESNEKAVDFTIDGNCGTEVTPNPNPGDEDDFKYKIDFSADRIEGETAKEGKDIKTRVDVSRDNFKPERDQYRAKVNNNINKSQQEINSAESARDSAQSSLSYCRRNPIHEVDAEGKDHYYDRDCSWEENKLDNAASKLDNARQKLEKEKNKIKKLDVLEEKYTNPETVVVLKHNGQQVALQKVRLTEGEKKTLNLDWQHKGKGTIQAEINPAGNRLDIEETTYKNNPIKTAIYEPSREKAMCGVTSVKGVVETVSERVSEEDTAGEMFYETLSGSIDNLSPSKLHSGYGFSYQVNGTYKNQWNENYPGVFTAATAQYPFADEGLKTTQDLEAISNTGLASRFQPKNMYMSEITGHVFDSKKPTKSLYWDGQEKIIDGQRKWYAPLKTKDGKYAFNVETKPAGVNEVSLCLTSEVEIKGVAYDDFKKRRVLADLPFPVQTPGWNWVGKEHIITDLSNWYYMKNRK
>NZ_CP053953.1|WP_000358430.1|260719_260881_+|hypothetical-protein
MDKKKKQRVRRVIIMGVVAIIVSLYIGSEFQDRNGKSYAPAKYFETGTKLISF
>NZ_CP053953.1|WP_000353169.1|261067_261253_-|hypothetical-protein
MDILFMIAIEILKVIAREVAVFFAKHIGKYLSTFWKKRQKKRRKTKRTTQRRKRTWWFNKK
>NZ_CP053953.1|WP_172852331.1|261627_262488_+|Flp-pilus-assembly-protein-CpaB
MKPSKFQKKQIAAVGLAAATVAGIYGYNHFAVENAVKPTKIVVAAKDIPAHTEIKEDMLVERTLPGDAIPPNALRANKKEVVGKWTNDGQPITENSYLFKNKVVKKEELPDSAILNLKGGEVAFPLLVDLETSSGNSIIPNTYVDLYFKQVVKEGDNEKVVFGGLFQRVRVTAAKDSNTEDAFVLEKKESKEEQEGKQKPKVTRLYTLAVSPEQLQYLNRAKTLGDVIPVAVGQKVEQTGKELEPAEGFSQISDQKNILDYVEKHSTNPISKNVKEYVAQYLNESK
>NZ_CP053953.1|WP_172852332.1|262504_263323_+|AAA-family-ATPase
MDRQVKIIAFYATNENVGKSTLSITMANELAHLEKKVLYVEADQVRPSFAVGTGLSHESKNMLELVRKENEYNLSQYICTKQDLLEKKVNPRLMQKLHDKMDFLVFPSGYSLAQFPEIQNKELFVTTFIESLVDTEYDYIILSVPTELSEVLSYPILYQSDLVVHVLNGNPRGAIAIKRELQLIENAKLTLPRMIHVLNMADENYVEDIEKLSSQKIAVTIPYDRDRTSYEWGMQFGSPQINTKVHHIMEAAGLGIPSQQSSMKKGLFGLRN
>NZ_CP053953.1|WP_000264602.1|263339_264773_+|CpaF-family-protein
MWGYLQEKQIALKRNRVDLYHFGYMIRSKSARKLGTTTAQQIKDITDEIRAFLVKDHRDILSESFMNKEKRAAVEQIIKSFLLSNQVVISEVPSEQLLNMVCDEIVGFGIIEPLKEDKDVTDIYINGTKEIIYEKIGEGECTFPYRFETEEEVKALAYKMVNSTSESLNTAKPYVDCVFPYIRINIALDELGGLGTTITIRKNADHLRASEERMLSTNQASKEMLDFLAAAVKAKMNILVAGATGTGKSEFMKYLASHIPKGKKKERTLVVEDNPELYLHRIFPEHHFVPMQCRASEVEENAIDFDRLLTNALRQGPKRLIVGESRGKEALKMINFFQTGHPGFTSVHARSAKEAVRRLMLMCLQSGANIDAQYLYELISQTFDVIVFLEKKDDGNRYITEMIELLDYQDDIQFNQLSQFIPSGEEYDEMNERVGKIHGDHIITAKMSAEMEKKFRSSTVNPALYASFLSQQEVQYA
>NZ_CP053953.1|WP_172852333.1|264765_265698_+|hypothetical-protein
MHSLLAYGCIFLIFISVGLLVLLFTKSKGSALSQFVQENEKEERRLELRNIKGIRMYLPQSVIQEAQKYEWKLTKSMYWIYTILSGMSIAAVFYFSFGRDPFTLITVLSGFLVPRFLLYRRKKRYYLVVIDRLSIYMKAVANALQISNNAKRVLVQVKPMMHESIQEEIEKVSLLLEGGTTMHRAFRGFNETFNFRELVFFHEMLEVCSREGGTNSVQVLLDIAEDFEKQKLYLARLRSSLSQAQRAFVQNCLIVIVMPIVIMLMSKEAYGFLAGSMMGKIALAVNMFIVFFLATRVEKIANYNPTERGE
>NZ_CP053953.1|WP_172852334.1|265699_266566_+|hypothetical-protein
MATILAVVVFVVMYWVSSTFLQSKKDSGSLLTNYVENAKRIEKKNLNQMMLAPFQSLSHKYLTEEKKEQIQKKLEEAGLDTKPEEYLKMKVAYPIIFTSVFLICTVFHDYYLFKVGVLASPLLYFYPDYLLKRRIKQAIEARKFELPEYLIPMLQLLKTHTTLEAVKKAQIYAGRHLRPYVSTLTAELEMYAGSDQPFRNFAAALNSPEVNTFTIALQQAQKTDKVQSLRIMDAQIKMMRELKHENYNRLIQNKPMEMNKFNVAVIGCIVIYPMVIVIQSLMQGFASL
>NZ_CP053953.1|WP_000956352.1|266607_266811_+|hypothetical-protein
MLTKMKNWLKNEDSQLSSENGMLIALAVIIVLVIGPFVWKAIQGGYDTILARFTKASNNADVNSWNK
>NZ_CP053953.1|WP_000879955.1|266877_267081_+|hypothetical-protein
MLAKMKNWLKNEDSQLSSENGMLIALAVIIVLVIGPFVWKAIQGGYDTILARFTKASSNADVNSWNK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP053953_1	1.2\|257462\|18\|NZ_CP053953\|CRT	257462-257479	18	NZ_CP053953.1	257366-257383	1	0.944
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053953.1	257378-257407	2	0.933

1. spacer 1.2|257462|18|NZ_CP053953|CRT matches to position: 257366-257383, mismatch: 1, identity: 0.944

agagacaaaaccagagac	CRISPR spacer
agaaacaaaaccagagac	Protospacer
***.**************

2. spacer 1.3|257510|30|NZ_CP053953|CRT matches to position: 257378-257407, mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaactaagccagagac	Protospacer
***************.** ***********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83505-83534	0	1.0
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53436-53465	0	1.0
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257510-257539	0	1.0
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151757-151786	0	1.0
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83517-83546	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83709-83738	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53388-53417	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53400-53429	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53424-53453	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53448-53477	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257474-257503	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257486-257515	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257498-257527	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257522-257551	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151721-151750	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151733-151762	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151745-151774	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151769-151798	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33883-33912	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33895-33924	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409313-409342	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409325-409354	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385310-385339	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385322-385351	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31028-31057	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31040-31069	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31076-31105	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31088-31117	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31160-31189	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31316-31345	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31328-31357	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46376-46405	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46412-46441	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387581-387610	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387593-387622	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297041-297070	1	0.967
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83133-83162	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83289-83318	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83493-83522	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83529-83558	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83553-83582	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83565-83594	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83589-83618	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83625-83654	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53220-53249	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53232-53261	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53316-53345	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53328-53357	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53340-53369	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53352-53381	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53364-53393	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53376-53405	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53412-53441	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257378-257407	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257426-257455	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257450-257479	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257462-257491	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257534-257563	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257582-257611	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151625-151654	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151673-151702	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151697-151726	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151709-151738	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151781-151810	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151829-151858	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33799-33828	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33823-33852	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33871-33900	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33907-33936	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33919-33948	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33931-33960	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33943-33972	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33955-33984	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409253-409282	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409265-409294	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409277-409306	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409289-409318	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409301-409330	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409337-409366	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409385-409414	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409409-409438	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385226-385255	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385250-385279	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385298-385327	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385334-385363	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385346-385375	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385358-385387	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385370-385399	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385382-385411	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	30968-30997	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	30980-31009	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	30992-31021	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31016-31045	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31052-31081	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31100-31129	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31148-31177	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31208-31237	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31232-31261	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31244-31273	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31256-31285	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31268-31297	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31280-31309	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31292-31321	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31340-31369	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46268-46297	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46316-46345	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46388-46417	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46400-46429	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46424-46453	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387497-387526	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387521-387550	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387569-387598	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387605-387634	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387617-387646	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387629-387658	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387641-387670	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387653-387682	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297029-297058	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297053-297082	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297065-297094	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297077-297106	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297113-297142	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297137-297166	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297161-297190	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297185-297214	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_KT186230	Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence	68406-68435	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	373685-373714	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	373745-373774	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP022045	Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence	5250-5279	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_007322	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence	68341-68370	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_012579	Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence	68647-68676	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP015777	Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence	68341-68370	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP018904	Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence	68445-68474	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	382144-382173	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP023002	Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence	137653-137682	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_AP019732	Bacillus anthracis strain PCr plasmid PCr-pXO1	132260-132289	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_AP018444	Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence	68425-68454	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP029324	Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence	155715-155744	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_012656	Bacillus anthracis str. A0248 plasmid pXO1, complete sequence	68605-68634	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_010934	Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence	126449-126478	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP019589	Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence	68341-68370	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP015592	Bacillus cereus strain AR156 plasmid pAR460, complete sequence	393620-393649	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010853	Bacillus anthracis strain A1144 plasmid pXO1, complete sequence	68310-68339	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007665	Bacillus anthracis str. Vollum plasmid unnamed, complete sequence	133584-133613	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP008847	Bacillus anthracis strain HYU01 plasmid pX01, complete sequence	68427-68456	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP006743	Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence	68330-68359	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_AP014834	Bacillus anthracis strain Shikan-NIID plasmid pXO1	68425-68454	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP029806	Bacillus anthracis strain London_499 plasmid pX01, complete sequence	67327-67356	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_001496	Bacillus anthracis virulence plasmid PX01, complete sequence	68290-68319	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP014177	Bacillus anthracis strain Stendal plasmid pXO1, complete sequence	68341-68370	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009597	Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence	42012-42041	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009901	Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence	39251-39280	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009340	Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence	8587-8616	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009696	Bacillus anthracis strain RA3 plasmid pXO1, complete sequence	128799-128828	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009463	Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence	174655-174684	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009699	Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence	137693-137722	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009699	Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence	137705-137734	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009592	Bacillus cereus G9241 plasmid pBCX01, complete sequence	7819-7848	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009543	Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence	154931-154960	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010321	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence	136516-136545	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009540	Bacillus anthracis str. Sterne plasmid pXO1, complete sequence	107082-107111	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009330	Bacillus anthracis strain K3 plasmid 1, complete sequence	106217-106246	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009324	Bacillus anthracis strain PAK-1 plasmid 1, complete sequence	131727-131756	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009327	Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence	112142-112171	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP001975	Bacillus anthracis str. A16R plasmid pXO1, complete sequence	68426-68455	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009980	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence	39397-39426	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP001971	Bacillus anthracis str. A16 plasmid pXO1, complete sequence	68426-68455	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP047132	Bacillus anthracis str. BF1 plasmid pXO1, complete sequence	154835-154864	2	0.933
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46328-46357	3	0.9
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297125-297154	3	0.9
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297149-297178	3	0.9
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297173-297202	3	0.9
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257390-257419	4	0.867
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151637-151666	4	0.867
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	372939-372968	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	63762-63791	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	314663-314692	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_KT186230	Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence	68442-68471	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_KT186230	Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence	68394-68423	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	303393-303422	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP022045	Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence	5286-5315	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP022045	Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence	5238-5267	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_007322	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence	68377-68406	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_007322	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence	68329-68358	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_012579	Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence	68683-68712	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_012579	Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence	68635-68664	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP015777	Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence	68377-68406	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP015777	Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence	68329-68358	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP018904	Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence	68481-68510	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP018904	Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence	68433-68462	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	382132-382161	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP023002	Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence	137617-137646	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP023002	Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence	137665-137694	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_AP019732	Bacillus anthracis strain PCr plasmid PCr-pXO1	132224-132253	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_AP019732	Bacillus anthracis strain PCr plasmid PCr-pXO1	132272-132301	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_AP018444	Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence	68461-68490	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_AP018444	Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence	68413-68442	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP029324	Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence	155679-155708	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP029324	Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence	155727-155756	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_012656	Bacillus anthracis str. A0248 plasmid pXO1, complete sequence	68641-68670	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_012656	Bacillus anthracis str. A0248 plasmid pXO1, complete sequence	68593-68622	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_010934	Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence	126437-126466	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP019589	Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence	68377-68406	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP019589	Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence	68329-68358	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010853	Bacillus anthracis strain A1144 plasmid pXO1, complete sequence	68346-68375	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010853	Bacillus anthracis strain A1144 plasmid pXO1, complete sequence	68298-68327	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007665	Bacillus anthracis str. Vollum plasmid unnamed, complete sequence	133548-133577	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP007665	Bacillus anthracis str. Vollum plasmid unnamed, complete sequence	133596-133625	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP008847	Bacillus anthracis strain HYU01 plasmid pX01, complete sequence	68451-68480	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP008847	Bacillus anthracis strain HYU01 plasmid pX01, complete sequence	68415-68444	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP006743	Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence	68366-68395	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP006743	Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence	68318-68347	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_AP014834	Bacillus anthracis strain Shikan-NIID plasmid pXO1	68461-68490	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_AP014834	Bacillus anthracis strain Shikan-NIID plasmid pXO1	68413-68442	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP029806	Bacillus anthracis strain London_499 plasmid pX01, complete sequence	67351-67380	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP029806	Bacillus anthracis strain London_499 plasmid pX01, complete sequence	67315-67344	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_001496	Bacillus anthracis virulence plasmid PX01, complete sequence	68326-68355	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_001496	Bacillus anthracis virulence plasmid PX01, complete sequence	68278-68307	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP014177	Bacillus anthracis strain Stendal plasmid pXO1, complete sequence	68377-68406	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP014177	Bacillus anthracis strain Stendal plasmid pXO1, complete sequence	68329-68358	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009597	Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence	42048-42077	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009597	Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence	42000-42029	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009901	Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence	39287-39316	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009901	Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence	39239-39268	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009340	Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence	8551-8580	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009340	Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence	8599-8628	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009696	Bacillus anthracis strain RA3 plasmid pXO1, complete sequence	128763-128792	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009696	Bacillus anthracis strain RA3 plasmid pXO1, complete sequence	128811-128840	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009463	Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence	174619-174648	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009463	Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence	174667-174696	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009699	Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence	137657-137686	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009699	Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence	137717-137746	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009592	Bacillus cereus G9241 plasmid pBCX01, complete sequence	7807-7836	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009543	Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence	154967-154996	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009543	Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence	154919-154948	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010321	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence	136552-136581	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP010321	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence	136504-136533	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009540	Bacillus anthracis str. Sterne plasmid pXO1, complete sequence	107046-107075	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009540	Bacillus anthracis str. Sterne plasmid pXO1, complete sequence	107094-107123	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009330	Bacillus anthracis strain K3 plasmid 1, complete sequence	106253-106282	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009330	Bacillus anthracis strain K3 plasmid 1, complete sequence	106205-106234	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009324	Bacillus anthracis strain PAK-1 plasmid 1, complete sequence	131691-131720	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009324	Bacillus anthracis strain PAK-1 plasmid 1, complete sequence	131739-131768	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009327	Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence	112178-112207	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009327	Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence	112130-112159	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP001975	Bacillus anthracis str. A16R plasmid pXO1, complete sequence	68462-68491	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP001975	Bacillus anthracis str. A16R plasmid pXO1, complete sequence	68414-68443	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009980	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence	39361-39390	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009980	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence	39409-39438	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP001971	Bacillus anthracis str. A16 plasmid pXO1, complete sequence	68462-68491	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP001971	Bacillus anthracis str. A16 plasmid pXO1, complete sequence	68414-68443	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP047132	Bacillus anthracis str. BF1 plasmid pXO1, complete sequence	154799-154828	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP047132	Bacillus anthracis str. BF1 plasmid pXO1, complete sequence	154847-154876	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_014331	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO1, complete sequence	68402-68431	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP014283	Bacillus thuringiensis strain Bt185 plasmid pBT1850636, complete sequence	248804-248833	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP032614	Bacillus thuringiensis strain QZL38 plasmid p.1, complete sequence	422393-422422	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_017726	Bacillus anthracis str. H9401 plasmid BAP1, complete sequence	68436-68465	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_017726	Bacillus anthracis str. H9401 plasmid BAP1, complete sequence	68400-68429	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP023246	Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence	475042-475071	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP050184	Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence	348620-348649	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_019775	Anabaena cylindrica PCC 7122 plasmid pANACY.06, complete sequence	18532-18561	5	0.833
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83649-83678	6	0.8
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83733-83762	6	0.8
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	468435-468464	6	0.8
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	468519-468548	6	0.8
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	471848-471877	6	0.8
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_010934	Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence	126485-126514	6	0.8
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP015592	Bacillus cereus strain AR156 plasmid pAR460, complete sequence	393608-393637	6	0.8
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP009592	Bacillus cereus G9241 plasmid pBCX01, complete sequence	7855-7884	6	0.8
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	69481-69510	6	0.8
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	180834-180863	6	0.8
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	233766-233795	6	0.8
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123302-123331	6	0.8
NZ_CP053953_1	1.3\|257510\|30\|NZ_CP053953\|CRT	257510-257539	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83817-83846	7	0.767

1. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaagccagagac	Protospacer
******************************

2. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 0, identity: 1.0

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaagccagagac	Protospacer
******************************

3. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaagccagagac	Protospacer
******************************

4. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaagccagagac	Protospacer
******************************

5. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacgaagccagagacaaagccagagac	Protospacer
******.***********************

6. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaagccagagac	Protospacer
***************.**************

7. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
*********.********************

8. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagagac	Protospacer
*********************.********

9. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
*********.********************

10. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagagac	Protospacer
*********************.********

11. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
*********.********************

12. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagagac	Protospacer
*********************.********

13. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
*********.********************

14. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaagccagaaac	Protospacer
***************************.**

15. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
*********.********************

16. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagagac	Protospacer
*********************.********

17. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
*********.********************

18. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaagccagaaac	Protospacer
***************************.**

19. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagagacaaagccagagac	Protospacer
***.**************************

20. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagagac	Protospacer
*********************.********

21. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagagac	Protospacer
*********************.********

22. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagagacaaagccagagac	Protospacer
***.**************************

23. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagagacaaagccagagac	Protospacer
***.**************************

24. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagagac	Protospacer
*********************.********

25. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
*********.********************

26. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaagccagaaac	Protospacer
***************************.**

27. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
*********.********************

28. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaagccagaaac	Protospacer
***************************.**

29. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaagccagagac	Protospacer
***************.**************

30. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
*********.********************

31. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaagccagaaac	Protospacer
***************************.**

32. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
*********.********************

33. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagagacaaagccagagac	Protospacer
***.**************************

34. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagagacaaagccagagac	Protospacer
***.**************************

35. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagagac	Protospacer
*********************.********

36. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagagacaaagccagagac	Protospacer
***.**************************

37. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaaaccagagacaaagccagagac	Protospacer
***.*****.********************

38. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacgaagccagagacaaaaccagagac	Protospacer
******.**************.********

39. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagaaac	Protospacer
*********************.*****.**

40. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacgaagccagagac	Protospacer
*********.********.***********

41. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaaaccagagac	Protospacer
***************.*****.********

42. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
*********.*****************.**

43. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaaaccagagac	Protospacer
***************.*****.********

44. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaagccagaaac	Protospacer
***************.***********.**

45. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

46. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

47. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

48. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

49. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

50. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

51. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

52. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

53. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

54. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaactaagccagagac	Protospacer
***************.** ***********

55. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaactaagccagagac	Protospacer
***************.** ***********

56. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

57. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

58. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaactaagccagagac	Protospacer
***************.** ***********

59. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaactaagccagagac	Protospacer
***************.** ***********

60. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaactaagccagagac	Protospacer
***************.** ***********

61. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaactaagccagagac	Protospacer
***************.** ***********

62. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

63. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

64. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaactaagccagagac	Protospacer
***************.** ***********

65. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaactaagccagagac	Protospacer
***************.** ***********

66. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaaaccagagac	Protospacer
***************.*****.********

67. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaagccagaaac	Protospacer
***************.***********.**

68. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
*********.*****.**************

69. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

70. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
*********.*****************.**

71. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaactaagccagagac	Protospacer
***************.** ***********

72. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaactaagccagagacaaagccagagac	Protospacer
***.** ***********************

73. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagaaac	Protospacer
*********************.*****.**

74. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagaaac	Protospacer
*********************.*****.**

75. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaactaagccagagacaaagccagagac	Protospacer
***.** ***********************

76. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaactaagccagagac	Protospacer
***************.** ***********

77. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
*********.*****************.**

78. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

79. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
*********.*****.**************

80. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaagccagaaac	Protospacer
***************.***********.**

81. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaaaccagagac	Protospacer
***************.*****.********

82. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaaaccagagac	Protospacer
***************.*****.********

83. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaagccagaaac	Protospacer
***************.***********.**

84. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
*********.*****.**************

85. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

86. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
*********.*****************.**

87. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaactaagccagagac	Protospacer
***************.** ***********

88. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaactaagccagagacaaagccagagac	Protospacer
***.** ***********************

89. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagaaac	Protospacer
*********************.*****.**

90. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagactaagccagagacaaaaccagagac	Protospacer
****** **************.********

91. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
*********.*****************.**

92. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaaaccagagac	Protospacer
***************.*****.********

93. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

94. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaaaccagagac	Protospacer
***************.*****.********

95. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaagccagaaac	Protospacer
***************.***********.**

96. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
*********.*****************.**

97. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaaaccagagac	Protospacer
***************.*****.********

98. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

99. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

100. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

101. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

102. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
*********.*****************.**

103. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaaaccagagac	Protospacer
***************.*****.********

104. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaagccagaaac	Protospacer
***************.***********.**

105. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccggagacaaaaccagagac	Protospacer
************.********.********

106. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccggagacaaaaccagagac	Protospacer
************.********.********

107. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagaaac	Protospacer
*********************.*****.**

108. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
*********.*****.**************

109. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagaaac	Protospacer
*********************.*****.**

110. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaaaccagagac	Protospacer
***************.*****.********

111. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaagccagaaac	Protospacer
***************.***********.**

112. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
*********.*****.**************

113. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
*********.***********.********

114. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
*********.*****************.**

115. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaactaagccagagac	Protospacer
***************.** ***********

116. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaactaagccagagacaaagccagagac	Protospacer
***.** ***********************

117. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagaaac	Protospacer
*********************.*****.**

118. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagaaac	Protospacer
*********************.*****.**

119. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
*********.*****.**************

120. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagagacaaaaccagaaac	Protospacer
*********************.*****.**

121. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaaaccagagacaaagccagagac	Protospacer
***.*****.********************

122. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccggagac	Protospacer
*********.**************.*****

123. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccggagacaaaaccagagac	Protospacer
************.********.********

124. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccggagacaaaaccagagac	Protospacer
************.********.********

125. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccggagacaaaaccagagac	Protospacer
************.********.********

126. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_KT186230 (Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

127. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaacccagagacaaagccagaaac	Protospacer
********* *****************.**

128. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagagacaaagacagagac	Protospacer
***.****************** *******

129. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP022045 (Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

130. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_007322 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

131. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_012579 (Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

132. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP015777 (Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

133. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP018904 (Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

134. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagccaaagccagagacaaaaccagagac	Protospacer
**** ****************.********

135. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP023002 (Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

136. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_AP019732 (Bacillus anthracis strain PCr plasmid PCr-pXO1) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

137. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_AP018444 (Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

138. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP029324 (Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

139. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_012656 (Bacillus anthracis str. A0248 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

140. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_010934 (Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

141. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP019589 (Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

142. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP015592 (Bacillus cereus strain AR156 plasmid pAR460, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
*********.*****************.**

143. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010853 (Bacillus anthracis strain A1144 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

144. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007665 (Bacillus anthracis str. Vollum plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

145. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP008847 (Bacillus anthracis strain HYU01 plasmid pX01, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

146. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP006743 (Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

147. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_AP014834 (Bacillus anthracis strain Shikan-NIID plasmid pXO1) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

148. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP029806 (Bacillus anthracis strain London_499 plasmid pX01, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

149. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_001496 (Bacillus anthracis virulence plasmid PX01, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

150. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP014177 (Bacillus anthracis strain Stendal plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

151. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009597 (Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

152. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009901 (Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

153. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009340 (Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

154. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009696 (Bacillus anthracis strain RA3 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

155. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009463 (Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

156. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009699 (Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagactaagccagagactaagccagagac	Protospacer
****** *********** ***********

157. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009699 (Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

158. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009592 (Bacillus cereus G9241 plasmid pBCX01, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

159. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009543 (Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

160. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010321 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

161. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009540 (Bacillus anthracis str. Sterne plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

162. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009330 (Bacillus anthracis strain K3 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

163. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009324 (Bacillus anthracis strain PAK-1 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

164. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009327 (Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

165. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP001975 (Bacillus anthracis str. A16R plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

166. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009980 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

167. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP001971 (Bacillus anthracis str. A16 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

168. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP047132 (Bacillus anthracis str. BF1 plasmid pXO1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
*********.******** ***********

169. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

agagacaaagccagagacaaagccagagac	CRISPR spacer
ggagacaaaaccagagacaaagccggagac	Protospacer
.********.**************.*****

170. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 3, identity: 0.9

agagacaaagccagagacaaagccagagac	CRISPR spacer
ggagacaaaaccagagacaaaaccagagac	Protospacer
.********.***********.********

171. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 3, identity: 0.9

agagacaaagccagagacaaagccagagac	CRISPR spacer
ggagacaaaaccagagacaaagccggagac	Protospacer
.********.**************.*****

172. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 3, identity: 0.9

agagacaaagccagagacaaagccagagac	CRISPR spacer
ggagacaaaaccagagacaaagccggagac	Protospacer
.********.**************.*****

173. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.867

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaactaagccagagacaaagccagaaat	Protospacer
***.** ********************.*.

174. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.867

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaactaagccagagacaaagccagaaat	Protospacer
***.** ********************.*.

175. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagccaaagccagagacaaaaccaggggt	Protospacer
**** ****************.****.*..

176. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagccaaagccagagacaaaaccaggggt	Protospacer
**** ****************.****.*..

177. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagccaaagccagagacaaaaccaggggt	Protospacer
**** ****************.****.*..

178. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_KT186230 (Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

179. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_KT186230 (Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

180. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagccaaagccagagacaaaaccaggggt	Protospacer
**** ****************.****.*..

181. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP022045 (Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

182. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP022045 (Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

183. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_007322 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

184. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_007322 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

185. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_012579 (Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

186. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_012579 (Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

187. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP015777 (Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

188. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP015777 (Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

189. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP018904 (Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

190. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP018904 (Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

191. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaaaccagagacaaaaccaggggt	Protospacer
*********.***********.****.*..

192. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP023002 (Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

193. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP023002 (Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

194. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_AP019732 (Bacillus anthracis strain PCr plasmid PCr-pXO1) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

195. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_AP019732 (Bacillus anthracis strain PCr plasmid PCr-pXO1) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

196. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_AP018444 (Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

197. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_AP018444 (Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

198. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP029324 (Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

199. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP029324 (Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

200. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_012656 (Bacillus anthracis str. A0248 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

201. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_012656 (Bacillus anthracis str. A0248 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

202. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_010934 (Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

203. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP019589 (Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

204. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP019589 (Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

205. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010853 (Bacillus anthracis strain A1144 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

206. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010853 (Bacillus anthracis strain A1144 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

207. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007665 (Bacillus anthracis str. Vollum plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

208. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP007665 (Bacillus anthracis str. Vollum plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

209. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP008847 (Bacillus anthracis strain HYU01 plasmid pX01, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagactaagccagaaacaaagccagacgt	Protospacer
****** ********.*********** ..

210. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP008847 (Bacillus anthracis strain HYU01 plasmid pX01, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

211. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP006743 (Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

212. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP006743 (Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

213. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_AP014834 (Bacillus anthracis strain Shikan-NIID plasmid pXO1) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

214. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_AP014834 (Bacillus anthracis strain Shikan-NIID plasmid pXO1) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

215. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP029806 (Bacillus anthracis strain London_499 plasmid pX01, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagactaagccagaaacaaagccagacgt	Protospacer
****** ********.*********** ..

216. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP029806 (Bacillus anthracis strain London_499 plasmid pX01, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

217. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_001496 (Bacillus anthracis virulence plasmid PX01, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

218. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_001496 (Bacillus anthracis virulence plasmid PX01, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

219. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP014177 (Bacillus anthracis strain Stendal plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

220. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP014177 (Bacillus anthracis strain Stendal plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

221. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009597 (Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

222. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009597 (Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

223. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009901 (Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

224. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009901 (Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

225. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009340 (Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

226. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009340 (Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

227. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009696 (Bacillus anthracis strain RA3 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

228. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009696 (Bacillus anthracis strain RA3 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

229. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009463 (Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

230. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009463 (Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

231. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009699 (Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

232. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009699 (Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

233. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009592 (Bacillus cereus G9241 plasmid pBCX01, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

234. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009543 (Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

235. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009543 (Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

236. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010321 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

237. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP010321 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

238. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009540 (Bacillus anthracis str. Sterne plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

239. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009540 (Bacillus anthracis str. Sterne plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

240. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009330 (Bacillus anthracis strain K3 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

241. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009330 (Bacillus anthracis strain K3 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

242. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009324 (Bacillus anthracis strain PAK-1 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

243. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009324 (Bacillus anthracis strain PAK-1 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

244. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009327 (Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

245. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009327 (Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

246. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP001975 (Bacillus anthracis str. A16R plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

247. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP001975 (Bacillus anthracis str. A16R plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

248. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009980 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

249. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009980 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

250. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP001971 (Bacillus anthracis str. A16 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

251. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP001971 (Bacillus anthracis str. A16 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

252. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP047132 (Bacillus anthracis str. BF1 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

253. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP047132 (Bacillus anthracis str. BF1 plasmid pXO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

254. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_014331 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

255. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP014283 (Bacillus thuringiensis strain Bt185 plasmid pBT1850636, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagccaaagccagagacaaaaccaggggt	Protospacer
**** ****************.****.*..

256. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP032614 (Bacillus thuringiensis strain QZL38 plasmid p.1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagccaaagccagagacaaaaccaggggt	Protospacer
**** ****************.****.*..

257. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_017726 (Bacillus anthracis str. H9401 plasmid BAP1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaacaaagccagaaacaaagccagacgt	Protospacer
***.***********.*********** ..

258. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_017726 (Bacillus anthracis str. H9401 plasmid BAP1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaaaccagagac	Protospacer
***....**************.********

259. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP023246 (Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagccaaagccagagacaaaaccaggggt	Protospacer
**** ****************.****.*..

260. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP050184 (Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagccaaagccagagacaaaaccaggggt	Protospacer
**** ****************.****.*..

261. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_019775 (Anabaena cylindrica PCC 7122 plasmid pANACY.06, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaaaccaagccagagacaaagccagaagt	Protospacer
***.** ********************...

262. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaagccagagacaaagccagagac	CRISPR spacer
agtagaaaagccagaaacaaaaccagagac	Protospacer
** .. *********.*****.********

263. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaagccagagacaaagccagagac	CRISPR spacer
agtagaaaagccagaaacaaaaccagagac	Protospacer
** .. *********.*****.********

264. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtaaagccagagacaaaaccagaaat	Protospacer
***...***************.*****.*.

265. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaagccagagacaaagccagagac	CRISPR spacer
agaagtgaagccagagacaaagcctgaaac	Protospacer
***....***************** **.**

266. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaagccagagacaaagccagagac	CRISPR spacer
tgaaactaagccagagacaaagccagaagt	Protospacer
 **.** ********************...

267. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_010934 (Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaagccagagacaaagccagagac	CRISPR spacer
cgaaacaaagccagaaacaaagccagacgt	Protospacer
 **.***********.*********** ..

268. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP015592 (Bacillus cereus strain AR156 plasmid pAR460, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaagccagagacaaagccagagac	CRISPR spacer
agagacaaagccagaaacaaaaccaggagt	Protospacer
***************.*****.****....

269. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP009592 (Bacillus cereus G9241 plasmid pBCX01, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaagccagagacaaagccagagac	CRISPR spacer
cgaaacaaagccagaaacaaagccagacgt	Protospacer
 **.***********.*********** ..

270. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaagccagagacaaagccagagac	CRISPR spacer
tgaaactaagccagagacaaagccagaagt	Protospacer
 **.** ********************...

271. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaagccagagacaaagccagagac	CRISPR spacer
tgaaactaagccagagacaaagccagaagt	Protospacer
 **.** ********************...

272. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaagccagagacaaagccagagac	CRISPR spacer
tgaaactaagccagagacaaagccagaagt	Protospacer
 **.** ********************...

273. spacer 1.3|257510|30|NZ_CP053953|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaagccagagacaaagccagagac	CRISPR spacer
tgaaactaagccagagacaaagccagaagt	Protospacer
 **.** ********************...

274. spacer 1.3|257510|30|NZ_CP053953|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

agagacaaagccagagacaaagccagagac	CRISPR spacer
tggaaataaaccagaaacaaagccagagac	Protospacer
 *..*  **.*****.**************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

35493 : 84351

Bacillus_phage(54.55%)

integrase,protease,transposase

attL 67874:67896|attR 90033:90055

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852188.1\|35493_36039_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	5.9e-29	43.9
WP_172852189.1\|36756_36900_+	hypothetical protein	NA	NA	NA	NA
WP_172852190.1\|38136_38880_+	hypothetical protein	NA	NA	NA	NA
WP_172852378.1\|39128_39398_-	hypothetical protein	D2XQ01	Bacillus_virus	2.9e-13	41.4
WP_172852191.1\|40173_40566_+	gamma-type small acid-soluble spore protein	NA	NA	NA	NA
WP_172852192.1\|42979_43366_+	ArpU family transcriptional regulator	D2XQ27	Bacillus_virus	3.2e-61	96.1
WP_172852193.1\|44740_45229_+	hypothetical protein	NA	NA	NA	NA
WP_172852194.1\|45612_45780_+	hypothetical protein	NA	NA	NA	NA
WP_172852195.1\|46189_46462_+	hypothetical protein	NA	NA	NA	NA
WP_000376550.1\|46590_46728_-	DUF3956 domain-containing protein	NA	NA	NA	NA
WP_172852196.1\|47217_47865_+	hypothetical protein	NA	NA	NA	NA
WP_172852379.1\|48170_48902_+	hypothetical protein	NA	NA	NA	NA
WP_172852197.1\|48951_49275_+	hypothetical protein	NA	NA	NA	NA
WP_167319661.1\|50326_50446_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_172852198.1\|50986_51184_-	hypothetical protein	NA	NA	NA	NA
WP_172852199.1\|51656_52217_-	recombinase family protein	A0A219YB42	Aeromonas_phage	2.7e-29	41.5
WP_172852200.1\|54223_54751_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_172852201.1\|55366_55960_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_172852202.1\|55987_57238_+	MFS transporter	NA	NA	NA	NA
WP_172852203.1\|57708_58152_+	hypothetical protein	NA	NA	NA	NA
WP_172852204.1\|58865_59984_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_172852381.1\|60097_60751_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_172852205.1\|60782_61706_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_172852206.1\|62181_62688_-	DinB family protein	NA	NA	NA	NA
WP_172852207.1\|63409_64786_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_172852208.1\|65141_65825_+	hypothetical protein	A0A0A7AR45	Bacillus_phage	1.0e-38	41.6
WP_172852209.1\|66379_66502_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_172852210.1\|66938_67103_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_000516897.1\|67462_67786_-\|transposase	transposase	NA	NA	NA	NA
67874:67896	attL	NA	NA	NA	NA
WP_172852211.1\|68307_69582_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_063549519.1\|70049_70301_+	hypothetical protein	NA	NA	NA	NA
WP_063549517.1\|70483_70933_+	hypothetical protein	NA	NA	NA	NA
WP_172852212.1\|71225_71600_-	hypothetical protein	D2XQ01	Bacillus_virus	2.9e-27	47.1
WP_172852213.1\|71646_71955_-	YolD-like family protein	NA	NA	NA	NA
WP_172852214.1\|71983_73249_-	Y-family DNA polymerase	O64031	Bacillus_phage	1.1e-102	46.6
WP_137050358.1\|73530_74690_-\|transposase	IS3-like element ISBth8 family transposase	A0A0C5AEA5	Paenibacillus_phage	1.9e-37	42.5
WP_172852215.1\|75219_76095_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_172852383.1\|76242_77052_+	YitT family protein	NA	NA	NA	NA
WP_172852216.1\|77368_78685_+	amidohydrolase family protein	NA	NA	NA	NA
WP_001043945.1\|79904_80177_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	3.3e-25	70.0
WP_172852384.1\|80423_80618_-	hypothetical protein	NA	NA	NA	NA
WP_172852217.1\|82188_82515_-	helix-turn-helix transcriptional regulator	A0A0A7AQV8	Bacillus_phage	1.4e-22	50.0
WP_172852218.1\|82727_83771_-\|integrase	tyrosine-type recombinase/integrase	A0A0E3T6D9	Bacillus_phage	4.9e-08	23.1
WP_172852219.1\|84000_84351_+\|transposase	transposase	NA	NA	NA	NA
90033:90055	attR	NA	NA	NA	NA

DBSCAN-SWA_2

109937 : 218091

Bacillus_phage(39.13%)

integrase,transposase

attL 211748:211765|attR 219753:219770

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172852232.1\|109937_110255_-\|transposase	transposase	NA	NA	NA	NA
WP_172852233.1\|110284_110734_-	hypothetical protein	NA	NA	NA	NA
WP_172852234.1\|110964_111105_+	hypothetical protein	NA	NA	NA	NA
WP_172852235.1\|111295_111481_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_172852236.1\|111968_112853_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	4.1e-32	33.2
WP_172852237.1\|112896_113604_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.3e-43	41.7
WP_172852387.1\|113754_115641_-	ABC transporter permease	NA	NA	NA	NA
WP_172852238.1\|115657_116419_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.2e-33	36.4
WP_172852239.1\|116475_117516_-	DUF418 domain-containing protein	NA	NA	NA	NA
WP_131252118.1\|117613_117982_-	YxeA family protein	NA	NA	NA	NA
WP_172852240.1\|118645_118822_-	hypothetical protein	NA	NA	NA	NA
WP_172852241.1\|119057_119171_-\|transposase	transposase	NA	NA	NA	NA
WP_172852237.1\|119250_119958_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.3e-43	41.7
WP_172852242.1\|120435_121233_-	hypothetical protein	NA	NA	NA	NA
WP_172852243.1\|121685_122759_+	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	6.3e-75	42.0
WP_000976103.1\|122755_122911_+	hypothetical protein	NA	NA	NA	NA
WP_172852389.1\|123128_123647_-	hypothetical protein	NA	NA	NA	NA
WP_172852391.1\|123911_124178_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016078679.1\|124566_124860_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_172852244.1\|124945_125380_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_172852245.1\|125422_125710_-	hypothetical protein	NA	NA	NA	NA
WP_172852246.1\|125787_125988_-	hypothetical protein	NA	NA	NA	NA
WP_172852247.1\|126039_126684_-	thermonuclease family protein	A0A2P1JU10	Anoxybacillus_phage	4.1e-05	31.0
WP_172852248.1\|128041_128752_-	conjugal transfer protein TraX	NA	NA	NA	NA
WP_172852249.1\|128981_130829_-	ABC transporter permease	NA	NA	NA	NA
WP_172852250.1\|130818_131580_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.8e-26	34.5
WP_172852251.1\|131695_132691_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_172852252.1\|132687_133380_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.7e-23	29.6
WP_172852253.1\|133926_135342_-	peptidase M56	NA	NA	NA	NA
WP_172852254.1\|135344_135743_-	BlaI/MecI/CopY family transcriptional regulator	NA	NA	NA	NA
WP_172852255.1\|136103_136943_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_172852256.1\|137381_138386_-	VanZ family protein	NA	NA	NA	NA
WP_172852165.1\|138542_138785_-	hypothetical protein	NA	NA	NA	NA
WP_172852257.1\|139922_141353_-\|transposase	IS4-like element ISBce10 family transposase	NA	NA	NA	NA
WP_000956453.1\|141555_141750_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000040564.1\|141749_142211_+	hypothetical protein	NA	NA	NA	NA
WP_172852258.1\|142997_144425_-	beta-lactamase family protein	A0A2P1JR59	Mycobacterium_phage	1.8e-08	23.2
WP_172852259.1\|144882_145539_-	GAP family protein	NA	NA	NA	NA
WP_172852260.1\|145552_146311_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_113734020.1\|146986_147538_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_172852261.1\|148139_148784_-	YitT family protein	NA	NA	NA	NA
WP_172852262.1\|149146_150388_-	allantoate deiminase	NA	NA	NA	NA
WP_172852263.1\|150513_151785_-	MFS transporter	NA	NA	NA	NA
WP_172852264.1\|152240_153863_+	PucR family transcriptional regulator	NA	NA	NA	NA
WP_172852265.1\|154309_155542_+	cytochrome P450	A0A2I2L481	Orpheovirus	3.2e-06	27.7
WP_141528530.1\|155903_157334_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_172852266.1\|157607_159038_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_141528530.1\|159610_161041_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_172852267.1\|161359_161653_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_172852268.1\|161752_162163_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_001996145.1\|162205_162493_-	hypothetical protein	NA	NA	NA	NA
WP_088021417.1\|162569_162770_-	hypothetical protein	NA	NA	NA	NA
WP_172852269.1\|162821_163466_-	thermonuclease family protein	A0A2P1JU10	Anoxybacillus_phage	7.0e-05	38.6
WP_172852270.1\|164367_165252_-\|transposase	PD-(D/E)XK nuclease family transposase	NA	NA	NA	NA
WP_172852271.1\|165677_166718_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_172852272.1\|166770_168183_+	tyrosine phenol-lyase	NA	NA	NA	NA
WP_172852273.1\|168735_169632_-\|transposase	PD-(D/E)XK nuclease family transposase	NA	NA	NA	NA
WP_172852274.1\|170608_171781_+	hypothetical protein	NA	NA	NA	NA
WP_172852393.1\|172038_172740_+	hypothetical protein	NA	NA	NA	NA
WP_172852275.1\|173459_174233_+	DUF4393 domain-containing protein	A0A0M4RU42	Bacillus_phage	2.0e-51	56.1
WP_172852276.1\|174522_174669_+	hypothetical protein	NA	NA	NA	NA
WP_172852277.1\|174864_175065_-	hypothetical protein	A0A0A7AQJ2	Bacillus_phage	6.2e-29	98.5
WP_116345108.1\|176290_176629_+	hypothetical protein	NA	NA	NA	NA
WP_172852278.1\|176689_177076_-	ArpU family transcriptional regulator	A0A1B1P853	Bacillus_phage	2.2e-22	44.0
WP_172852279.1\|177214_177832_-	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	2.2e-48	60.7
WP_172852280.1\|178813_179029_+	spore germination protein	A0A2H4J3A3	uncultured_Caudovirales_phage	1.8e-29	94.4
WP_172852281.1\|179596_179770_-	hypothetical protein	I7J6W4	Bacillus_phage	7.6e-07	51.9
WP_172852282.1\|180904_182734_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.4e-47	31.5
WP_172852283.1\|182726_184490_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.0e-39	26.9
WP_172852284.1\|184615_185239_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_172852285.1\|185644_186388_-	GTP pyrophosphokinase family protein	F8K9M7	Nitrososphaera_phage	2.1e-08	27.6
WP_172852395.1\|186884_186968_+	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_172852286.1\|187189_187780_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_172852287.1\|187993_189508_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_172852288.1\|189674_190937_+	cytochrome P450	NA	NA	NA	NA
WP_172852289.1\|191367_192513_-	metallophosphoesterase	NA	NA	NA	NA
WP_153218695.1\|195442_196039_-	TetR/AcrR family transcriptional regulator C-terminal domain-containing protein	NA	NA	NA	NA
WP_172852290.1\|196511_197282_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_172852291.1\|197358_198870_+	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	7.1e-24	27.7
WP_172852292.1\|200034_200418_-	hypothetical protein	NA	NA	NA	NA
WP_172852293.1\|200543_201128_+	hypothetical protein	NA	NA	NA	NA
WP_172852396.1\|201147_201726_+	hypothetical protein	NA	NA	NA	NA
WP_172852294.1\|201776_202412_-	hypothetical protein	NA	NA	NA	NA
WP_172852295.1\|202411_203041_-	hypothetical protein	NA	NA	NA	NA
WP_172852296.1\|203359_204073_-\|transposase	transposase	NA	NA	NA	NA
WP_172852297.1\|204176_204320_-	hypothetical protein	NA	NA	NA	NA
WP_172852298.1\|204335_204749_-	hypothetical protein	NA	NA	NA	NA
WP_172852299.1\|205890_206358_-	hypothetical protein	NA	NA	NA	NA
WP_172852300.1\|206830_208525_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002204018.1\|208910_209108_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_172852301.1\|209134_209461_+	hypothetical protein	NA	NA	NA	NA
WP_172852302.1\|209526_209715_+	hypothetical protein	NA	NA	NA	NA
WP_172852303.1\|210456_211575_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	3.2e-170	80.9
211748:211765	attL	NA	NA	NA	NA
WP_172852304.1\|211988_212405_+	alpha-ketoglutarate permease	NA	NA	NA	NA
WP_172852305.1\|212696_212855_+	hypothetical protein	NA	NA	NA	NA
WP_172852306.1\|214211_215921_+	hypothetical protein	NA	NA	NA	NA
WP_172852307.1\|217143_218091_+\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	2.3e-36	30.7
219753:219770	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP053952

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP053954

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP053953

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection