CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP033367	Mesorhizobium loti R88b chromosome, complete genome	8 crisprs	csa3,DEDDh,WYL,cas3,PD-DExK	0	2	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP033367_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP033367_1

1027180-1027308

Orphan

Consensus_repeat	Method
ACGACGCAAATCGCCGCCAACACC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP033367_1

>merge|NZ_CP033367|1|1027180-1027308|CRISPRCasFinder
ACGACGCAAATCGCCGCCAACACCCAAGAACTCGCCGGCCACGAGACGCGCATCACCAACAATACGACGCAGATCGCCGCCAACACCACCGAGCTCGCCAATCATGAGACGCGTATCACCAACAACACC

>NZ_CP033367|1|1|1027180-1027308|CRISPRCasFinder
ACGACGCAAATCGCCGCCAACACC	CAAGAACTCGCCGGCCACGAGACGCGCATCACCAACAAT
ACGACGCAGATCGCCGCCAACACC	ACCGAGCTCGCCAATCAT
GAGACGCGTATCACCAACAACACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP033367.1\|WP_027032070.1\|1036674_1038018_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|226906
NZ_CP033367.1\|WP_027032069.1\|1038344_1038545_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_155256441.1\|1031511_1035567_+\|autotransporter-outer-membrane-beta-barrel-domain-containing-protein	unknown	unknown	gnl\|CDD\|226973
NZ_CP033367.1\|WP_027032079.1\|1021632_1022646_-\|taurine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226904
NZ_CP033367.1\|WP_032926577.1\|1029680_1030835_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197715
NZ_CP033367.1\|WP_051429727.1\|1027819_1028449_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027032073.1\|1031254_1031515_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027032082.1\|1019663_1019852_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_171878134.1\|1024771_1025920_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197715
NZ_CP033367.1\|WP_171878133.1\|1023525_1024647_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225360
NZ_CP033367.1\|WP_155256442.1\|1026303_1026732_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_155256444.1\|1023108_1023447_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027032083.1\|1018548_1019502_-\|aliphatic-sulfonate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270275
NZ_CP033367.1\|WP_027032068.1\|1038850_1039621_-\|type-1-glutamine-amidotransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|153235
NZ_CP033367.1\|WP_080680873.1\|1028473_1029118_-\|LysE-family-transporter	unknown	unknown	gnl\|CDD\|224199
NZ_CP033367.1\|WP_027032071.1\|1036199_1036649_+\|Rrf2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224870
NZ_CP033367.1\|WP_155256440.1\|1035875_1036052_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027032084.1\|1017296_1018451_-\|FMNH2-dependent-alkanesulfonate-monooxygenase	unknown	unknown	gnl\|CDD\|274652
NZ_CP033367.1\|WP_027032080.1\|1020735_1021509_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226905
NZ_CP033367.1\|WP_027032081.1\|1019878_1020739_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182276

Protein	Function_ID	Function_description	E-value
NZ_CP033367.1\|WP_027032070.1\|1036674_1038018_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|226906	COG4529, COG4529, Uncharacterized protein conserved in bacteria [Function unknown].	5.29737e-163
NZ_CP033367.1\|WP_155256441.1\|1031511_1035567_+\|autotransporter-outer-membrane-beta-barrel-domain-containing-protein	gnl\|CDD\|226973	COG4625, COG4625, Uncharacterized protein with a C-terminal OMP (outer membrane protein) domain [Function unknown].	2.89338e-93
NZ_CP033367.1\|WP_027032080.1\|1020735_1021509_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226905	COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism].	1.83421e-136
NZ_CP033367.1\|WP_032926577.1\|1029680_1030835_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	1.80992e-12
NZ_CP033367.1\|WP_080680873.1\|1028473_1029118_-\|LysE-family-transporter	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	5.98462e-10
NZ_CP033367.1\|WP_171878134.1\|1024771_1025920_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	2.19809e-12
NZ_CP033367.1\|WP_171878133.1\|1023525_1024647_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225360	COG2771, CsgD, DNA-binding HTH domain-containing proteins [Transcription].	3.58276e-11
NZ_CP033367.1\|WP_027032079.1\|1021632_1022646_-\|taurine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|226904	COG4521, TauA, ABC-type taurine transport system, periplasmic component [Inorganic ion transport and metabolism].	3.56946e-180
NZ_CP033367.1\|WP_027032083.1\|1018548_1019502_-\|aliphatic-sulfonate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270275	cd13557, PBP2_SsuA, Substrate binding domain of sulfonate binding protein, a member of the type 2 periplasmic binding fold superfamily. This subfamily includes the sulfonate binding domains SsuA found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBPII superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	6.02598e-136
NZ_CP033367.1\|WP_027032068.1\|1038850_1039621_-\|type-1-glutamine-amidotransferase-domain-containing-protein	gnl\|CDD\|153235	cd03141, GATase1_Hsp31_like, Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein. Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein (EcHsp31). This group includes EcHsp31 and Saccharomyces cerevisiae Ydr533c protein. EcHsp31 has chaperone activity. Ydr533c is upregulated in response to various stress conditions along with the heat shock family. EcHsp31 coordinates a metal ion using a 2-His-1-carboxylate motif present in various ions that use iron as a cofactor such as Carboxypeptidase A. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with a typical GATase1 domain, a reactive Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For EcHsp31, this Cys together with a different His and, an Asp (rather than a Glu) residue form a different catalytic triad from the typical GATase1 domain. For Ydr533c a catalytic triad forms from the conserved Cys together with a different His and Glu from that of the typical GATase1domain. Ydr533c protein and EcHsp31 are homodimers.	8.89709e-80
NZ_CP033367.1\|WP_027032071.1\|1036199_1036649_+\|Rrf2-family-transcriptional-regulator	gnl\|CDD\|224870	COG1959, COG1959, Predicted transcriptional regulator [Transcription].	1.84066e-52
NZ_CP033367.1\|WP_027032084.1\|1017296_1018451_-\|FMNH2-dependent-alkanesulfonate-monooxygenase	gnl\|CDD\|274652	TIGR03565, alk_sulf_monoox, alkanesulfonate monooxygenase, FMNH(2)-dependent. Members of this protein family are monooxygenases that catalyze desulfonation of aliphatic sulfonates such as methane sulfonate. This enzyme uses reduced FMN, although various others members of the same luciferase-like monooxygenase family (pfam00296) are F420-dependent enzymes. [Central intermediary metabolism, Sulfur metabolism].	0
NZ_CP033367.1\|WP_027032081.1\|1019878_1020739_-\|ABC-transporter-permease-subunit	gnl\|CDD\|182276	PRK10160, PRK10160, taurine ABC transporter permease TauC.	1.62175e-99

>NZ_CP033367.1|WP_155256442.1|1026303_1026732_+|hypothetical-protein
MSVIAETSERMGVSGSEDAATGTISRTIAIGRQVLKSIESAAAAVFGGLASSQVPTLGTAAIMVVAAAGFVAFAPGTARGGGFICQDFNGLNGGAAYAGGSANSVACGVSANSNGFVSTAVGWAAGAIADYSVALGYLANAG
>NZ_CP033367.1|WP_171878134.1|1024771_1025920_-|helix-turn-helix-transcriptional-regulator
MRSAFSMAQLSDLIGLIYDAAIDPARWPVAIDEIRIALGFGTAAIRLQSLPSGEVLLNVTSNIPQPYVDQMVSYGAEIVELWGGMAVVGSLPMDRPAVLSQLNPNLDTTTNRYFVECGKPQGMVDSLALPLARDGRGLGSLSFSRHVDAPPISDLQIEAARLLIPHLQRAATINRLLDMAAIARSTFQTVLDTLTAPIFLTTADLHVVHANPAAQDIVATGELLNIRNGVLTASVSAVSSALAVAVSQAAQDESAIDRKGLGVPIRWKDGSAGALHVLPLRPGRGAFDASVVAAVFVARADTPFVAPTALVAALFGLTPAEARVFEQIAAGRTVEETSDALDIGRSTVRTHLLRLFEKTGVRRQAELVQLAASLASPVATGV
>NZ_CP033367.1|WP_171878133.1|1023525_1024647_-|helix-turn-helix-transcriptional-regulator
MSELIGLIYDAAIDPSRWAVAIEEIRIALDFENAALNLQALPSGEVLLNVTSNMPQDYVDRIADYAVDVIDQWGGLAVLLALPLDQPAVMSRVNPEASTTNRYSLEWAKPRGLVDVMGLGLARDERGFGSLGLGRHESAEPIGEYEIEAARLLIPHLQRAATINRLLDMAAIARSTFQTVLDTLTAPIFLTTADLHVVHANPAAQDIVATAELLNIRNGVLSASVAAVSSALAVAVSQAAQDESAIDRKGLGVPIRWRDGSAGALHVLPLRPGRGAFDASVVAAVFVARADTPFVAPTALVAALFGLTPAEARVFEQIAAGRTVEETSDALDIGRSTVRTHLLRLFDKTGTRRQAELVQLAASLASPLAGMAS
>NZ_CP033367.1|WP_155256444.1|1023108_1023447_+|hypothetical-protein
MTVEDDCDCNTICPQYQHCICIYHYDEGYCDCTCGPLQILSERVAKRPSDSIINICVKGAELSAVAEFLSRYSEEELFIPAARAKTKISLEIKKVSLASVIEQVGLRVGLPG
>NZ_CP033367.1|WP_027032079.1|1021632_1022646_-|taurine-ABC-transporter-substrate-binding-protein
MSTISRRILLLSSAALAGAAILSPALAEDLKITIGYQTVVEPSKVPQADGTYEKATKASIDWRKFDSGADVIAAVASGSVDIGYVGSSPLAAAASRELPIQTIFVVGLIGPSEALVARNGAGIEKVADLAGKKVAVPFVSTTHYSLLAALKHENVDPKSVEILNLRPPEIAAAFARGDIDAAYVWDPALGQIKTKGKVVLDSSQVAAWGAPTFDAWIVRTDFAEKNPEAVRDFVKVTGAAYAEYLAKPGAWSVSSPQAGKIAKLTGAKLEEVPELLKGYVFPTLEEQASDKFLGGGTVKAVAAASAFLKEQGKVDAVLPDYSKYVTSKYVTEALASN
>NZ_CP033367.1|WP_027032080.1|1020735_1021509_-|ATP-binding-cassette-domain-containing-protein
MPHLVLDKISIHYEGQSAPAVERVSIGVAKGDFVVLVGRSGCGKTSLLNVAAGLVTPSRGTAMTNGKPIIAPGSDRAVVFQNDALFPWLTARENVAFALRLRGVRTAERARRADELLALVKLTDAGDKRIWELSGGMRQRVGLARALAAEPEFLLLDEPLGALDALTRERMQTTLLDLWTASHVGVLMVTHGIEEALVLATRIVVLAPGPGRVVRTFEPGFSRRYAAGEAIRTIKADSAFASARGELTDAIFEGEAA
>NZ_CP033367.1|WP_027032081.1|1019878_1020739_-|ABC-transporter-permease-subunit
MTVTPYAERPSQKIDEVDGLSVPWSPAAPKRKGVSARMISAVTILVVLAVWALSARLQLVSPVFLPSPAAVWNKFFVVANDGFVDATLLQHAIASLGRVFAALVAALLVGVPVGLAIGISTIGRGIFDPLLEFLRPIPPLAYLPLVIIWFGIGEPSKILVIAIAMLAPVALSTASGVRGVSQERINAARSLGATKRQVVRHVILPSALPSILTGLRIALGAGWSTLVAAELVAATRGLGFMIQSAAQFLVTDVVIMGILVIAAIAFVLEFIIRRIERVLVPWAGRE
>NZ_CP033367.1|WP_027032082.1|1019663_1019852_-|hypothetical-protein
MTHSTAVLFAHFGAWLLGLASDDKAARQESQRSPAPVQFQAGRDRLPPRDESFYWAWQYWSQ
>NZ_CP033367.1|WP_027032083.1|1018548_1019502_-|aliphatic-sulfonate-ABC-transporter-substrate-binding-protein
MFSLTRRVFGIGLLAAGVALSFGASAQELRQLSIGYQKTGLPVVARQQQVIEKALSDKGVVVKWVEFTAGPPLVEALNVGAVDVGYTGDAPPIFGQSAGANIVYVAAMPPNGDGEAVFVKPASPIQSVADLKGKRVGVGKGTSAHNLLVATLEKAGLPYDQITPIYLSPADAAAAFASDQIDAWAVWDPFFAIAETRYQPRVLARSSDVLKVNSYILANKDFAKAHPEVVTTTIAALGEAAKWADQNRDKVAEALHEVTGVPLDAQIIAANRSKFGIFPLSDEIVASQQATADRFYKLGLIPKAVRISDAVWTAPGN
>NZ_CP033367.1|WP_027032084.1|1017296_1018451_-|FMNH2-dependent-alkanesulfonate-monooxygenase
MTPEGQLDFFWFIPTHGDGSYLGSEQQQRPPEFGYFKEIAQAVDRLGFPGVLLPTGQNCEDSWITATGLATLTEKLKFLVALRPGVTLPTFAARQTAALDRLSNGRLLLNVVVGGNPTELAGDGVFLPHDERYAQAHEFLTIWRGLVSGERVNFDGKYYRVENGRLDLLPSQERPPLYFGGSSDAGQDLAADLVDMYLTWGEPPAQVAEKLASAREKAALRGRKLRFGIRLHFIVRETEDEAWRAADRLISHVTSAQIENAQARFLNQMDSVGQRRMAELHGGRRDRLVVSPNLWAGVGLVRGGAGTALVGTPEQITERIREYQAIGIDTIIGSGYPHLEEAYRVAELLFPKLGLGTSRQRAHQNIANEFSVGFHGAARLQASS
>NZ_CP033367.1|WP_051429727.1|1027819_1028449_+|hypothetical-protein
MKHPRFLSIGRMTHTAVTGLLLAGLLAASGGVAEAQTKKTEKSDKVRAAHPASIDRNGVLILIRGTLLALDQANKTGNYTVLRDLGSPNFQANSAAGLGDIFANQRKQALDFGAVAVLDPQLTLLPQIEPNGMLHMAGFFPSVPMQVNFELLFEPVNRQWKIYGVSVNLTSGAPQAPDTPVAEQSKPDDTAPPPDAPSMAVQPKKAAKP
>NZ_CP033367.1|WP_080680873.1|1028473_1029118_-|LysE-family-transporter
MSGTADLFLSVMRGALLGFAVAAPIGPTGLLCVQRTIAGGIGPGLATGYGAATTHSVYASVAAAGLGAVAHVLIGWHMLLQLCAGIFLLYMAVTAARLTPSLDTALQRRMPSGRAYVTGLIWTLGNPMTLLGFFTLTPGILGAAMPSWQTLALVSAGVLLGSATWWTTLTLVTNLLRKRLSARGLRTVNLVFSSGLFVFALSLLASALRLELLS
>NZ_CP033367.1|WP_032926577.1|1029680_1030835_+|helix-turn-helix-transcriptional-regulator
MTDRSYPAERISELIGTIYDCVLDPDRWPSVVDNIRRELEFCYAVLGVYPLPGGEVTLGVATGIDSVKLGELPAYGQDLVDLWGGDIRVKQYPLEEPIAQSRAVPDSALVASRYFLEWAQPQGVVDAVAIGLERNARMVSTLSFGRHETVGIVGNGELDALRLLAPHFRRAIAIGQMLELQSIAAANVTSVLESLSVGVVLVDELMALIHANPVAESMLARKEPIKVSNGRVVVSDASPAISSAIEDAVAQAARDEAALGRRGGTGFPTRGLSGEPRIIHVLPLKRRESRPGLFRRATAALFIAPVDRPISLPFDAFAALYGLTPAEVRIVELIVAGQTQREIAKSLGLASATVKTHLLHVFEKTDVRRQVDLVRLVASLASPL
>NZ_CP033367.1|WP_027032073.1|1031254_1031515_+|hypothetical-protein
MTRGLGIVASPGFERTLHRVAHIQQKSAAAALMASTAVWVAGPAYAQCTVTAPPDTCVCAGANGFGIGHDALKGIGLKHSLDGDPQ
>NZ_CP033367.1|WP_155256441.1|1031511_1035567_+|autotransporter-outer-membrane-beta-barrel-domain-containing-protein
MTPAIGLRAGPRGKFRLSRLLATTALVACLATPAFATNYLVGTEQELRSALSSHANGDTITLSNDITLTAGGGGNLPEVHSDVTISGGGHTLSGGGAYRGLFVTAGTVRVEDLKITDTLAQGGTSNGGGAGAGLGGALFVNEGATVTVSNVDLSGNQAKGGAASTNTSFGYGAGGAGMLGDGGNTSASQGGVGGSPNGGTGGTTPAGGDITSNGPIAETAQDGSAGAAGGTGGGGGGGAAGPHLQVATTSGDATVDGGTGGAGGVGGFGGGGGQGGSGSWNTATAHDPGTASASGGDGGDGGAGGFGGGGGAGGVGGLKGTTQYNGNFFVSQITSGNGGDGGQAGFGGSGGLRGNSSSLAPGGLGGVALGDGSGAGMGGALFVRQGGQLIVEGNLALNGNSVAAGGAGSQAFGSGIFLQGGGNLSFKPGAGETQTISDDIDDMVGVVAQGYVPPAGTYTGNERWGVTVDGDGTLVLSGTNSFSGGVLVSKGTLSVGADASLGNPDGGITLATGTLMTTASFATDRDITLSLGGTVSQAAGTIFTVNGIVSGGGGLTKAGAGTVVLAGDNSYGGGTSLEAGTLRLDHDHALGTGSLNARDGTTIQYGLDDLSVANAIAIEGDVKFDYEQPGPIIIAVPEQAGAISGTGRLIRTGTGGLTLSHANSYEGGTIVEGGRLIASVTGALGTGDADVRGGAVLAFTGSQATPTDAGSRTITVENDGQLQFSDHSNATTTTVLNEAGGLVALKGNAAPVEVGSLSGAGDVDLDFGTMIVGGLGSDDTISGAIRDGNVPPVLLPAAQAGSLVKTGAGTLTLSGTNSYFGTTTVEEGKLVVNGSIAASSLTTVGSGAVLGGGGTIGATRVEGTIAPGNSIGTLNVKGAFTQVAGSTYAVQLDATTSDRIAVTGTADLQGGTLDVEAAPGGYSLGARYTILTTTGGLTGTYAALTGDAGPLSAFVSVIDSYDTNNAYLDVAKVRDFADAGLTPNQIATGEGLDSIAESGALFSAVAGLATDAAARGAFDQLSGEIHASAKGMLVGDSRFVRDAATNRIAAAFDDGGTTAAIPVMAYGEGGPEMVAADTDRFAVWGQAFGSWGNTDSDGNAAAFDRSTGGVLAGADTLVGGWRVGVLGGYSHSSFDADDRNSSGSSDNYHLGLYGGTNWGAIAFRTGAAYSWSSISTKRSVAFDGFTDGFSADYDAGTAQMFGELAYKADSGQFKLEPFANLAYVSVHTDGFSETGGAAALTSAGSTTDATFTTLGLRASTDFAPGGMNATARGMLGWRHAFGDTTPLSTLAFASGDAFTIAGVPIARDAAVIEAGLDFNMTANATLGLSYSGQFGGCAVDNGAKVDLNVKF
>NZ_CP033367.1|WP_155256440.1|1035875_1036052_+|hypothetical-protein
MSEHPITMIARGMHPLQTSHESARNTATPWESFVAFLPSKRISVLLMAQRPDKIATTA
>NZ_CP033367.1|WP_027032071.1|1036199_1036649_+|Rrf2-family-transcriptional-regulator
MLTKKGKYGLKALVHLAQLPAGQLAFVGDIATGNTIPKKFLDAILGELRNAGFVQSRKGKDGGYRLARPADEIKVGHVVRVLDGPLAPIPCASRTQYQRCEDCNEATCQVRHLMLEVRQAIAEVLDQRSLAEMRDIGLDDLPVTVKVQA
>NZ_CP033367.1|WP_027032070.1|1036674_1038018_+|FAD-dependent-oxidoreductase
MSGRANSIIIVGGGASGVVLAAHLLKSSNPDLRVTLIERRPHFGQGVAYSTLLSAHVLNVSAAGMSAYADDSSNFWRWLQGHGLVSPEQTPQTPFYAPRSIYARYLGELLDELEAQEQPTGRLRLIHEESRSITPTPSGVEVALANGTSVVAHLAILATGHDEQPAQGHAIRMGSEADTELVPDRRVMVLGTGLSMVDAFLALEQRGHTGEIVAVSRRGLLPSPHRKGNPIKLDVADIPLGTQLSYFVGWFRDLIKENQKAGVDWRDVVDGLRPFNQKIWQNWPASAKRRFVEHTKAWWDIHRHRMPPEVYARVTEAVKTGRIRLVAGRVVDIARGGDFTVQVQSRHTQRLETFDVARIYDCSGIVRDISTSSNSVVRSLVDRGLARPDPLRIGLDVSANCEIIAGDGTVSAKILAVGPLTRGTFFEIDAIPDIRVQCARLSKRLLG
>NZ_CP033367.1|WP_027032069.1|1038344_1038545_-|hypothetical-protein
MRRTTKALPFVPTEIHVSTVEDEKGSLGILSIQTTEGILDLALDLTTLDAIANAVKEIRSKLVPES
>NZ_CP033367.1|WP_027032068.1|1038850_1039621_-|type-1-glutamine-amidotransferase-domain-containing-protein
MSVRDANPVDALRPKRLAIVIANPAVSTTTGWPVGFWWSELTHPWFAFTERGYAVEIFSPEGGRCEADALSDPRDASGYSETDLISLGFLSSPKLAALVETTRPVAEIDVDSFDAIVVAGGQAPMFSYDRAETLQRIFVAFHEAGKVAAALCHGTALLRYARRADGWLLVAGKTVTGFANAEEDFADKATWEIGALQPGSHLMPWRIEDELKASGANYVQAGLWRGFAIRDGNLITGQQNFSGAETARLVCEALGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP033367_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP033367_2

1094865-1094970

Orphan

Consensus_repeat	Method
CGGCACGACCAATGTGACGCTGGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP033367_2

>merge|NZ_CP033367|2|1094865-1094970|CRISPRCasFinder
CGGCACGACCAATGTGACGCTGGGCTCGACGGCCAACACAGCCGGTATCAATTTCAGCGGCACCAATGCCGACGTCAGCTTCGGCACGACCAATGTGACGATGGGC

>NZ_CP033367|2|2|1094865-1094970|CRISPRCasFinder
CGGCACGACCAATGTGACGCTGGGC	TCGACGGCCAACACAGCCGGTATCAATTTCAGCGGCACCAATGCCGACGTCAGCTT
CGGCACGACCAATGTGACGATGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP033367.1\|WP_027032021.1\|1085327_1087115_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224983
NZ_CP033367.1\|WP_027032011.1\|1106996_1107782_+\|SapC-family-protein	unknown	unknown	gnl\|CDD\|377801
NZ_CP033367.1\|WP_027032020.1\|1087231_1088167_-\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
NZ_CP033367.1\|WP_027032016.1\|1103348_1103870_+\|phage-tail-protein	unknown	unknown	gnl\|CDD\|227020
NZ_CP033367.1\|WP_027032015.1\|1103880_1104408_+\|phage-tail-protein	unknown	unknown	gnl\|CDD\|227020
NZ_CP033367.1\|WP_027032013.1\|1105773_1106301_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP033367.1\|WP_027032024.1\|1082785_1083271_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027032009.1\|1109030_1109528_+\|prolyl-tRNA-synthetase-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|226283
NZ_CP033367.1\|WP_027032012.1\|1106358_1106631_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027032026.1\|1080485_1080743_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027032017.1\|1102830_1103337_+\|phage-tail-protein	unknown	unknown	gnl\|CDD\|227020
NZ_CP033367.1\|WP_027032022.1\|1083882_1085118_+\|amidohydrolase/deacetylase-family-metallohydrolase	unknown	unknown	gnl\|CDD\|226473
NZ_CP033367.1\|WP_027032008.1\|1109614_1110619_+\|thioredoxin	unknown	unknown	gnl\|CDD\|225660
NZ_CP033367.1\|WP_027032018.1\|1089768_1090335_-\|invasion-associated-locus-B-family-protein	unknown	unknown	gnl\|CDD\|227647
NZ_CP033367.1\|WP_027032014.1\|1104429_1105746_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027032023.1\|1083491_1083854_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|223329
NZ_CP033367.1\|WP_027032010.1\|1107909_1108641_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379276
NZ_CP033367.1\|WP_027032019.1\|1088357_1089599_-\|aminopeptidase-P-family-protein	unknown	unknown	gnl\|CDD\|223085
NZ_CP033367.1\|WP_027032025.1\|1081000_1081636_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224931
NZ_CP033367.1\|WP_032925696.1\|1081712_1082789_+\|peptidase-C39-family-protein	unknown	unknown	gnl\|CDD\|378725

Protein	Function_ID	Function_description	E-value
NZ_CP033367.1\|WP_027032021.1\|1085327_1087115_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224983	COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism].	5.11892e-112
NZ_CP033367.1\|WP_027032011.1\|1106996_1107782_+\|SapC-family-protein	gnl\|CDD\|377801	pfam07277, SapC, SapC. This family contains a number of bacterial SapC proteins approximately 250 residues long. In Campylobacter fetus, SapC forms part of a paracrystalline surface layer (S-layer) that confers serum resistance.	2.41539e-82
NZ_CP033367.1\|WP_027032020.1\|1087231_1088167_-\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	5.62622e-73
NZ_CP033367.1\|WP_027032016.1\|1103348_1103870_+\|phage-tail-protein	gnl\|CDD\|227020	COG4675, MdpB, Microcystin-dependent protein [Function unknown].	2.45135e-60
NZ_CP033367.1\|WP_027032013.1\|1105773_1106301_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.60967e-11
NZ_CP033367.1\|WP_027032015.1\|1103880_1104408_+\|phage-tail-protein	gnl\|CDD\|227020	COG4675, MdpB, Microcystin-dependent protein [Function unknown].	8.90089e-64
NZ_CP033367.1\|WP_027032009.1\|1109030_1109528_+\|prolyl-tRNA-synthetase-associated-domain-containing-protein	gnl\|CDD\|226283	COG3760, COG3760, Uncharacterized conserved protein [Function unknown].	1.44382e-91
NZ_CP033367.1\|WP_027032017.1\|1102830_1103337_+\|phage-tail-protein	gnl\|CDD\|227020	COG4675, MdpB, Microcystin-dependent protein [Function unknown].	3.73559e-64
NZ_CP033367.1\|WP_027032022.1\|1083882_1085118_+\|amidohydrolase/deacetylase-family-metallohydrolase	gnl\|CDD\|226473	COG3964, COG3964, Predicted amidohydrolase [General function prediction only].	0
NZ_CP033367.1\|WP_027032008.1\|1109614_1110619_+\|thioredoxin	gnl\|CDD\|225660	COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones].	2.20029e-114
NZ_CP033367.1\|WP_027032018.1\|1089768_1090335_-\|invasion-associated-locus-B-family-protein	gnl\|CDD\|227647	COG5342, COG5342, Invasion protein B, involved in pathogenesis [General function prediction only].	2.29261e-46
NZ_CP033367.1\|WP_027032023.1\|1083491_1083854_+\|RidA-family-protein	gnl\|CDD\|223329	COG0251, TdcF, Putative translation initiation inhibitor, yjgF family [Translation, ribosomal structure and biogenesis].	4.2575e-42
NZ_CP033367.1\|WP_027032010.1\|1107909_1108641_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379276	pfam13578, Methyltransf_24, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.98022e-08
NZ_CP033367.1\|WP_027032019.1\|1088357_1089599_-\|aminopeptidase-P-family-protein	gnl\|CDD\|223085	COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid transport and metabolism].	2.18344e-63
NZ_CP033367.1\|WP_027032025.1\|1081000_1081636_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	gnl\|CDD\|224931	COG2020, STE14, Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones].	1.54397e-25
NZ_CP033367.1\|WP_032925696.1\|1081712_1082789_+\|peptidase-C39-family-protein	gnl\|CDD\|378725	pfam11814, DUF3335, Peptidase_C39 like family.	1.80038e-99

>NZ_CP033367.1|WP_027032018.1|1089768_1090335_-|invasion-associated-locus-B-family-protein
MASILVRSNRIGLTAGFGVLWLILAVAGPVLAEDAAKPAQAKEAQPKPADANPWAVNCSSGSANSELQCQVSQNLTEAKTGQRVLTVTVRRDSGNGSLAMLLALPHGLFLPSGASYQVDQGQKVVIAIQTSDQNGAYAATPLSPELVKAMKSGTNLNIGMESVTRKPVTIPVSLAGFTAAIAKLETIK
>NZ_CP033367.1|WP_027032019.1|1088357_1089599_-|aminopeptidase-P-family-protein
MTGFVDRERAAHVMEQAGIEALVLSAPEAFHYATGAWIGPAGLFRRAGAGFVVIPARQDLPIGVVVADFNVAQLRIAAPEAVVRSHPIWIESVPLATGTHGLLDERIEAGLAALGRAPDFSRPATFDLAGSVRQLQALLAEFGLERATLGIDLDFIPAADFAAIQALLPDCPVVDGSSVLDRLRSIKSQREIDLLQQGIFLSEAGLERLQVDAMAGMRQADLVALYRKGVAEAAAGLSHPVVTAEYVTLGARAKGADARAEAGDPLKCDMVCTVGGYASDMSRNFTFGAPSADQAELHAIAERAFDDGLAVLIPGNTLAHVHRITTESLARQGLSSYRRGHFGHSVGQSVFSEQWPFIAADSDVVIEAGMVLAFEIPLYIDGLASFNLEDQFLITADGPLPMNRLPRRLERIG
>NZ_CP033367.1|WP_027032020.1|1087231_1088167_-|MurR/RpiR-family-transcriptional-regulator
MTEADSREGSAGDAEGRDLRRIPDIISLVKDSYAELRPAERRVADVVLDDVKYAVDASNAAIAERAGVSEPTVTRFCRAIGCEGVRDFKLKLAQSLVVGALYLAKSPTVSNDNGMPFWNAVFGEARRALQEAERQIDPGELQKAAELIAKARQVTVFGLGGSSSALAQETQYRLFRYGITVSAQCDPYLMRMTASTLKPGDLVIAISATGRTREVIEAVELAKHYRANAIAVTAPDTDLARACDVRLTVAVSEYPDTLKPTASRYAFLAAIDLLAVASAYKLDGSARETVRRIKYNAQIHRTGKEMEPLGD
>NZ_CP033367.1|WP_027032021.1|1085327_1087115_-|NAD(P)/FAD-dependent-oxidoreductase
MLEIAPTKQAAVWLDSLAQALEAGDIQAASNLFVDDCYWRDLLTFTWNVTTMEGRDTIAGMLTSTLATTKPTAWRLTGEATADEGTVEAWFTFETAVASGQGSLRLRDGRCRTLFTAMTDLKGFEERKGAERPLGVRHKADPERETWSEARARETRELGASEQPYCLVIGGGQGGIMLGARLRQLGVPTIVIEKNARPGDSWRNRYRTLVLHDPVWYDHLPYIPFPENWPVFTPKDKMGDWLEMYTRVMELNYWVATKCLSASYDETAKEWTVVVDRVGRQITLKPKHIVFATGAYGPPRKIDLAGADQFKGELLHSSQYSSGDKFRGKKVAVIGAASSGHDVCVDLWESGADVTMIQRSPTTVVKSSTLMEVGFEIFSESALARGITTEKADMIVASTPFALVPKGQRALYEVIKARDAAFYDRLRASGFAIDFGDDETGLLMKAYRTGSGYYIDVGASDLIIDGKIGIRSGVAIKSLTAKGILFEDGTELEADAIIACTGYQSMNEKVAALVSREVADKVGPCWGLGSGVKGDPGPWQGELRNMWKPTAQEALWFHGGNLALSRFYSKYVALQIKARMEGIATPVYGKPSNAG
>NZ_CP033367.1|WP_027032022.1|1083882_1085118_+|amidohydrolase/deacetylase-family-metallohydrolase
MQFDLLLKGGRLIDPASGIDAPRDVAIANGRVAAVEADLPAERANQVVDTTGCIVAPGLVDLHSHVYWGGTSLGVDADRLAAKSGTTTFIDAGSAGAGNFLGFRRHVMERSKVRILAYVNISFAGIFGFSQTVSVGECSDLNLCEPREVVAAAREHADVVVGVKVRSGKHAGGTSGIAPVDLALEAADQAGLPLMAHIDEPPPGRSEVLPRLRKGDILTHCFRPFPNAPVFASGAVRPDMRLARERGVIFDLGHGMGSFDFEVARAMLAEGLMPDVISSDVHLYCVDGPAFDILVCMSKLMALGMPLVEVLRAATQAPAQAIARPDLGTLAVGTVGDVAVLRQRSGRFTFVDAVGASLVADQRLVSEGIVVGGTWWPNEAVNDVSETEHFEAHANHTHVEVAARHFGHRHD
>NZ_CP033367.1|WP_027032023.1|1083491_1083854_+|RidA-family-protein
MPKQTFGTSHVPLSPAVRAGDFVYISGQVPVSDGIVVKGGITEQTEQVLANVKAALALAGCTLDDVVKTTVWLEDARDFGAFNAVYARHFPKNPPARTTVESRLMIDIKIEVEAVAYKPV
>NZ_CP033367.1|WP_027032024.1|1082785_1083271_-|hypothetical-protein
MTFDKNPFPSGDADRHALWEMLVRRDIDAFIGQDWSVVENDFIAESFFGMHAHFLPNADAWRLQFPRLEIYRDEWLRQAKETAATEFAEPLREAIFRVTNLRDIDVDGDRAVLHKKFDGSIAKADGSVDRLKWQTLYFCRKVEGSWKIAGFVGYMPYPLGA
>NZ_CP033367.1|WP_032925696.1|1081712_1082789_+|peptidase-C39-family-protein
MPASLLTSRASLTVFTSEDAAVWASLTAAVPAEIGDRLAALRRIAGVAGVAQYSDGRPEAIVVGQRRPAAAMMRIALFWSATSFVATDGPRLLETLEKEAHGQDVLCLRADEATVLGIGGQWERRDGFLQRWIGIEPSRRQELIPPSWPQTAGFTCGPSALAMAMAGLDPALLPDRALEVELWREATTIIGPSGPGGCDPYGLALAAHRRGLRVEVFISSAEPIFLDRAASEERRGLMSFVQTGFKRDVEAASVPIEPRAFAVEEIAQALDGGLLALVLIDQAPMMGYTCPHWVLVHSHGGGIYFLNDPWIEPDRLEQKTDVVDLPIMAAELDRMAWYGNPAYRAAVLVGPGSTTRKR
>NZ_CP033367.1|WP_027032025.1|1081000_1081636_+|isoprenylcysteine-carboxylmethyltransferase-family-protein
MTYASLKPVSHAFVQRKRLIFVRVAAVLAVLLLFLTKPALSEGSNGHEMLEFFGFCLVLACVAGRLWSILYVGGKKNEELVSSGPFSMSQNPLYFFSTVGAVGIGLLYGSVLAALALGLASFLIFRVTARKEAAYLLGKFGPAYLAYTKRTPRFWPNPLIYSDGDQMEFSTRALKRTFFDGLYFLAIFPAIELVEYFREAGLLFPAFVTIY
>NZ_CP033367.1|WP_027032026.1|1080485_1080743_-|hypothetical-protein
MRRFAPALAAVTLAASASIPSVHAATVPCEQTLKSLRAAEATATLSAADKTKVSELETKGIERCNADDDKRADDFFAQAMKVMGK
>NZ_CP033367.1|WP_027032017.1|1102830_1103337_+|phage-tail-protein
MGTPYIGELKVISWNFAPKGWALCNGQLLPINQNQPLFSLLGTMYGGDGRVNFALPDLRSRVPVYSGGPIGAVVGGRGGEEFHTLTQGEMPTHNHMINASQTQGDKNTASGNVLAREVGVLYAAYANPTTLNPGSISSVGGSNPHENRQPFLTLNIVIALQGIFPSRN
>NZ_CP033367.1|WP_027032016.1|1103348_1103870_+|phage-tail-protein
MSSPYVGEIRMFGGNFAPAGWAFCDGSSLPISENDTLFNLIGTTYGGDGQETFGLPNLSGRIPIHAGQGPGMSQNYVLGESAGAESVTLTTNQIAAHGHALMASSNTASDPNPAGNVLATSPTIEAYVIDVAGPSLAGNSLTTAGGSTPHDNFMPYLCVNFIISLFGIFPSPT
>NZ_CP033367.1|WP_027032015.1|1103880_1104408_+|phage-tail-protein
MADPFVAEIRIFGFNFAPTGWATCDGQLMPISQNTALFSLLGTTYGGDGKSTFALPDLAGSAPMHPGSSAGGSDHFLGETGGSTTVNLINSEMPIHNHNILASTENGTLKAPSPTEFLGRSKAGTIYQSNTASNLALMNFQAVSPAGSSLPHNNLQPYLAVTFCIALQGVFPPRG
>NZ_CP033367.1|WP_027032014.1|1104429_1105746_+|hypothetical-protein
MAKKAATKSEAPSKKVAPTIAKSTTRARSRRSSVPPVYQNKPAGSSFFELSRLMVVGIDSAAGRLIQKAQDAPNGSWPAAWSAIAPGAWIIMTAGLTKDGRVAVVAQPSGTINLSFITEDPNQVGPVDKWNAPVGIGAPPGATSYQKLTMANDADGRIEVFLTDNQGRIWWIYQNPDQIVQVKKTITPPGTTTPIVVTVDELVPPIKPWSDWQQLTGQLVAVTAIRQADGRIGLFGINSGLHLYRCQQANPQALKVADWTGWVQIDTTQTGGFTEMAPVVGPLGATNLFALTQNGQVLHTRQQPAGTDTWTQWATTGYSRVPKYTLAAGIQGDGDIVLVSSDQQRVHEFNAQWDANTQNWSGWRDFGVSLYATRLTLNYNADGRLALFSMMIMPDNTFGLWTINQMAIDSSEWEYAWTSLTDGNLKQIVVVRDLTPPV
>NZ_CP033367.1|WP_027032013.1|1105773_1106301_+|GNAT-family-N-acetyltransferase
MDHRPPVWARSNKVGLGFRPSTEADLPFLSRLYASTRLEELAVTDWSEAQKAVFLDMQFQAQHAHYRKHYPDADWLVVEHAGQDIGRLYIERWPSQHRIIDIAFLPNHRRKGYGTALLRDLIDEAWLAGKSPSIHVEKNNPARGLYVRLGFVVVEDKGVYDLMACAPKVGGAAGS
>NZ_CP033367.1|WP_027032012.1|1106358_1106631_-|hypothetical-protein
MTAADFEQAIGQAFTIETGGGQIALELSAVNRIASSPRPDGGFSLMFRGPCDIALPQATYRLTGNGGTHDIFIVPVAADAAGRLYEAVFN
>NZ_CP033367.1|WP_027032011.1|1106996_1107782_+|SapC-family-protein
MADIKARTEAPPSAAMPLFYSKPEALNPARHGSLGLTARSDFSFARAAHAIPVVASEMPAAMRSYPIVFIGDGKAPVIITGVRQNENLFVDADGRWTAPHYVPAYVRRYPFILAEDPTTAGRLTLCADRASERVVDQAVAPLRDDKVAPFFIGNEPTEATKQALAYCNQFQIDFRATREMVEKIDAHGLFAPRQSKVTLEGGEVLNLTDFQVIDEPAFNNLSDAAFLDLRKSGALGLLYCHLASTNSWTSLVHQASLRKAG
>NZ_CP033367.1|WP_027032010.1|1107909_1108641_+|class-I-SAM-dependent-methyltransferase
MPSLKQLIKKPVHALSSRFATSRLERVVREIEDAKMEELSHSTFLETKIRQIGLRHDRRALYGDDVDDMNFHAPGLWQIPRQLAQAMALLAGQRIVSFLEVGTCDGFTFSFMAACLSRLNPGLKATTIDIASRLPTCARIVFKTPVEFLAGKTSDAFAGHVFDLVLIDGDHSYEWITRDYRNVGQQARLCMFHDINDRFCGDDTVPKFWRELKTEESGRADFHEFLYHSNADRVMGIGIRIKR
>NZ_CP033367.1|WP_027032009.1|1109030_1109528_+|prolyl-tRNA-synthetase-associated-domain-containing-protein
MPKTEADLFAFLAELGIAVSTIRHPPLYTVADSQALRGEIAGGHTKNLFLKDKKDNFFLVTVGEDAVVDLKQIHQLIGAAGRVSFGKPEMLLELLGVTPGAVTVFGVINDRENRVKLVLDKDLMEHAVINGHPLTNEATTSIARDDLIKFVEATGHDAAILKVSA
>NZ_CP033367.1|WP_027032008.1|1109614_1110619_+|thioredoxin
MSDNKPFGGSFGSSGGQYATTVQYGGTAPAPAKVTLGDAPAAVTGDVIKDTTTAAFAADVIQESRRQPVLVDFWAPWCGPCKQLTPQLEKAVKAAGGKVKLVKMNIDDHPSIAGQLGIQSIPAVIAFKDGQPVDGFMGAIPESQINEFITKVGGKGNGAPPVADALAAAAEAREAGDMQTAADIFDAILAQAPETIEAIAGLGDLLFEAGDTEGAEALLATAPEAKKDAPLLAALRAKMALAAQAAALGNPAEFERRLAENPKDHQARFDLAMIQNARGDRTAAADNLLAIIKADRAWNEDGARTQLLQLFEAWGMTDEATLAARRKLSALLFP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP033367_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP033367_4

3350741-3350836

Orphan

Consensus_repeat	Method
GGCGGCGTTGCCGCCGGTGCTGGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP033367_4

>merge|NZ_CP033367|4|3350741-3350836|CRISPRCasFinder
GGTGGCATTGGCGCCCGTGCTGGTGCCGGCGAAATTGACGGTACCGTTGGCGGTGGCATTGATCAGGGCATTGCCGGCGCTGGTGCCAGTGCCGTT

>NZ_CP033367|4|4|3350741-3350836|CRISPRCasFinder
GGTGGCATTGGCGCCCGTGCTGGT	GCCGGCGAAATTGACGGTACCGTTGGCGGTGGCATTGATCAGGGCATT
GCCGGCGCTGGTGCCAGTGCCGTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP033367.1\|WP_027029975.1\|3356164_3357298_-\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP033367.1\|WP_027029989.1\|3334989_3335682_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP033367.1\|WP_171878145.1\|3336300_3336837_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027029972.1\|3359278_3359728_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027029977.1\|3354015_3354831_-\|p-hydroxycinnamoyl-CoA-hydratase/lyase	unknown	unknown	gnl\|CDD\|236383
NZ_CP033367.1\|WP_027029974.1\|3357423_3358323_-\|transcriptional-regulator-GcvA	unknown	unknown	gnl\|CDD\|182990
NZ_CP033367.1\|WP_027029988.1\|3335858_3336185_+\|DUF1330-domain-containing-protein	unknown	unknown	gnl\|CDD\|227757
NZ_CP033367.1\|WP_027029984.1\|3338872_3339532_+\|DUF3313-domain-containing-protein	unknown	unknown	gnl\|CDD\|378712
NZ_CP033367.1\|WP_032926336.1\|3360529_3362374_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|227334
NZ_CP033367.1\|WP_080680773.1\|3342011_3342212_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_155256339.1\|3338459_3338870_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_155256335.1\|3359761_3360421_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027029979.1\|3351741_3352461_+\|3-keto-5-aminohexanoate-cleavage-protein	unknown	unknown	gnl\|CDD\|225785
NZ_CP033367.1\|WP_027029982.1\|3339903_3341997_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|182070
NZ_CP033367.1\|WP_080680771.1\|3352465_3353986_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|181644
NZ_CP033367.1\|WP_051429610.1\|3337672_3338278_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380063
NZ_CP033367.1\|WP_027029983.1\|3339592_3339802_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027029986.1\|3336907_3337357_-\|ester-cyclase	unknown	unknown	gnl\|CDD\|377824
NZ_CP033367.1\|WP_155256337.1\|3355003_3355432_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP033367.1\|WP_027029973.1\|3358450_3359155_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187602

Protein	Function_ID	Function_description	E-value
NZ_CP033367.1\|WP_027029975.1\|3356164_3357298_-\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	3.51274e-45
NZ_CP033367.1\|WP_027029989.1\|3334989_3335682_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.07121e-34
NZ_CP033367.1\|WP_032926336.1\|3360529_3362374_-\|EAL-domain-containing-protein	gnl\|CDD\|227334	COG5001, COG5001, Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms].	1.15718e-118
NZ_CP033367.1\|WP_027029977.1\|3354015_3354831_-\|p-hydroxycinnamoyl-CoA-hydratase/lyase	gnl\|CDD\|236383	PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydratase/lyase; Validated.	0
NZ_CP033367.1\|WP_027029974.1\|3357423_3358323_-\|transcriptional-regulator-GcvA	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	7.09346e-95
NZ_CP033367.1\|WP_027029988.1\|3335858_3336185_+\|DUF1330-domain-containing-protein	gnl\|CDD\|227757	COG5470, COG5470, Uncharacterized conserved protein [Function unknown].	8.00152e-38
NZ_CP033367.1\|WP_027029984.1\|3338872_3339532_+\|DUF3313-domain-containing-protein	gnl\|CDD\|378712	pfam11769, DUF3313, Protein of unknown function (DUF3313). This a bacterial family of proteins which are annotated as putative lipoproteins.	7.32393e-47
NZ_CP033367.1\|WP_027029979.1\|3351741_3352461_+\|3-keto-5-aminohexanoate-cleavage-protein	gnl\|CDD\|225785	COG3246, COG3246, Uncharacterized conserved protein [Function unknown].	2.8472e-60
NZ_CP033367.1\|WP_027029982.1\|3339903_3341997_+\|EAL-domain-containing-protein	gnl\|CDD\|182070	PRK09776, PRK09776, putative diguanylate cyclase; Provisional.	1.70517e-116
NZ_CP033367.1\|WP_080680771.1\|3352465_3353986_-\|AMP-binding-protein	gnl\|CDD\|181644	PRK09088, PRK09088, acyl-CoA synthetase; Validated.	0
NZ_CP033367.1\|WP_051429610.1\|3337672_3338278_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|380063	pfam17937, TetR_C_28, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in CgmR (C. glutamicum multidrug-responsive transcriptional repressor), previously called CGL2612 protein. CgmR (CGL2612) from Corynebacterium glutamicum is a multidrug-resistance-related transcription factor belonging to the TetR family. It regulates expression of the immediately upstream gene cgmA (cgl2611) by binding to the operator cgmO in the cgmA promoter. The cgmA gene encodes a permease belonging to the major facilitator superfamily, a protein family composed of bacterial multidrug exporters, and the pair of CgmR and CgmA confers multidrug resistance on C. glutamicum.	1.28412e-13
NZ_CP033367.1\|WP_027029986.1\|3336907_3337357_-\|ester-cyclase	gnl\|CDD\|377824	pfam07366, SnoaL, SnoaL-like polyketide cyclase. This family includes SnoaL a polyketide cyclase involved in nogalamycin biosynthesis. This family was formerly known as DUF1486. The proteins in this family adopt a distorted alpha-beta barrel fold. Structural data together with site-directed mutagenesis experiments have shown that SnoaL has a different mechanism to that of the classical aldolase for catalyzing intramolecular aldol condensation.	1.13754e-33
NZ_CP033367.1\|WP_155256337.1\|3355003_3355432_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	9.3854e-14
NZ_CP033367.1\|WP_027029973.1\|3358450_3359155_+\|SDR-family-oxidoreductase	gnl\|CDD\|187602	cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR. This subgroup resembles the SDR family, but does not have a perfect match to the NAD-binding motif or the catalytic tetrad characteristic of the SDRs. It includes the SDRs, Q9HYA2 from Pseudomonas aeruginosa PAO1 and APE0912 from Aeropyrum pernix K1. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	3.30957e-94

>NZ_CP033367.1|WP_080680773.1|3342011_3342212_-|hypothetical-protein
MEGPLTSDFSAARIHLERAYHHLRGNDEASRSACEVLDQLIETVVEAQHRRPEAGVLEFPRSAARQ
>NZ_CP033367.1|WP_027029982.1|3339903_3341997_+|EAL-domain-containing-protein
MARQGKKSRNEEFWALALERAHLGVWDWDIANGSCFYSPTWWRMLGYEEGELADTADLWLQLTHPDDRERALASGDAHIAGLTPSIETEIRLKHKQGHWVWVLDRGGVVERDALGKPVRLMGVQTDISKQKAAEAALEQVNVRFRLALAASGTGIWHYDMATNKSYWDARTRDIFGLVADTDEVTGDLWHSFLHPDDKEATERAHQPSPGSDAVTASQYRIIKRDGEIRHVESLVRFVAAAGTAGQVLGTVRDITEDKLREQELAFAARHDALTGLWNRSAFDRLLADHIATGVPLAVFYVDLDYFKALNDFAGHAAGDLALKSVAAGIGRCLPPSAHAARLGGDEFALLVPHCDAAQAERLASAILAAVRGADLGLAATSRRLAASIGIAMVHDHTTTVADALACADDACYAAKAAGRDRFAVFSAEANSGGLNAARLAADTVDAMEDGRLKLFGQEIHRLGRPWDESRHVEVLARLVGRGGRLIPPGEFIPAAERFGIAARLDRWIIRTALSLHGAAMKSGAITLGFNLSAQTLSDPALWDFVDSIIEETGAPHSGIGFEITETAAVTNFDAAETFVRKARERRCRVSLDDFGAGMSSFEYLRRFPVDAIKIDGSFIEHITESRFDREIVLAITSIGRSLGCDVVGEKIERQDTLGMLSDMGVAFGQGFLLHRPEPLEQVVTRATIMAGAVRKAS
>NZ_CP033367.1|WP_027029983.1|3339592_3339802_+|hypothetical-protein
MEAISIAWFFSWQLWLTALSLIEGHPMHRVIFRTIILLGALALLGCERNSPFAKPEQPAKSSAESMWSP
>NZ_CP033367.1|WP_027029984.1|3338872_3339532_+|DUF3313-domain-containing-protein
MNRILRNSLTMAGLCLALQGCVSADPIAYSGLSSSAELAPNPRDATGRVPYAYSTAVDWRQYSSVIVDPVVIYRGADGQFGKMPASDKAAIASYMQARFTERLKSRFTLAGKAGPNTLRVRLTLTGAKANTPVLGTLSRFDIAGGVYNTVQTARDREGSLTGSVLYAVEIFDAGTNRLLKAFVTKQYPSPINIKASMEPLAAAQAGVDKGADALLAQLK
>NZ_CP033367.1|WP_155256339.1|3338459_3338870_+|hypothetical-protein
MAVADETRHGTRRPISRRLLFRQLVASVSTPLVATGLALCLVDLMTALLAVLLFGRVHTVVPGSEALLADRPQTLLLVLAAILALLPLLHLASKVFAHVARRSRRHAWLGTARVMLCAPASLCPVTVITLLLATGH
>NZ_CP033367.1|WP_051429610.1|3337672_3338278_+|TetR-family-transcriptional-regulator
MDNVSRSERSRNAIIQAALAIIARDGPGRLTLDAIAREGGLSKGGVMHQFRTKEAVLKTLLENQVEFFENFSRDFLAEAGTGTKEPQLSAQIAVQRKVVAEPHSVAFGLLGALAENPALLSGLRETDASKVEAIRSEAADPDLATLRLFAAKGLALTTMIGICSLSEEDLERLFDRLLDNTQWPATGDRSASSRVVNKKTD
>NZ_CP033367.1|WP_027029986.1|3336907_3337357_-|ester-cyclase
MTKQEDNKAVVVRWFTDFWGETCDLSVVDDIAAPDMLLRYSLHEPRSGRDDIKTFMTDFRAAFPDLNFWATADLIAEGDYVVGQWEGGGTHTGPAFSDFLAGSLPAATGRTMRFTGTTVLKVIDGRIVEEIGLDDGVAALTQLGLIKAT
>NZ_CP033367.1|WP_171878145.1|3336300_3336837_+|hypothetical-protein
MDMKSNLRNRLVMAGAMLAVCTSFAWAHQEAPEAASGPNPLADKVRAANSRFLDVKAATAEGYAPIPCASGITGGAMGIHYVNGQYLKDDKIDIARPEAVMYEPMADGTLKLVAVEYITSKGPASLDGQLFNFNSAPNRYGLGEFYELHVWAWKGNPTGTFADVNPKVSCEHAMAPSQ
>NZ_CP033367.1|WP_027029988.1|3335858_3336185_+|DUF1330-domain-containing-protein
MTVYVIADIKMKEPNWVPAYAASVHDIVHKHGGRYLARSGNVKTLEGKPLDTTLIALMAFPSETAARAFTNDPEYAPFVSARQGGSDSRFQLIDNTDLAGTIPYLPKG
>NZ_CP033367.1|WP_027029989.1|3334989_3335682_-|helix-turn-helix-transcriptional-regulator
MTQHGYKQFCPLSMAAEVLCTRWTMVLMRELVAGSTRFNDLRRGVPKMSPTLLSQRLKELELAGIVERKEIQGEKGIFDYRLTEAGRDLRPVVEAMGFWGQKWVESRLSLKNLDPSLLMWDMRRNLNPSPLPEGRTVIQFLYQELPASKRSWWLIVEKHGEVDLCWYDPGFDVDLYVATDLHTMTAIWMGLLTVEKAGAKVSLTGDQAIGKQMQTWLGLSPFAVEPKRAA
>NZ_CP033367.1|WP_027029979.1|3351741_3352461_+|3-keto-5-aminohexanoate-cleavage-protein
MIVQACINGARPRDFHPRLPLTAQAMASDAAACVAAGAAELHIHPRGADGRESLAAVDGTVLAVRQVCPGTLVGVSTGAWIESDVARTRAAITGWRELPDYASVNLSEADAAAVMELLRQRGVGIEAGLATIADAERFVALADHDRVLRILIEIDIQDLSTALDEAHGIEAVLERAGGRRPILLHGVDATVWPFVELAQQKRWSTRVGLEDGKTLADGTVAKDNAEIVAAAVAIFRSAG
>NZ_CP033367.1|WP_080680771.1|3352465_3353986_-|AMP-binding-protein
MRMPDWTTPDPVALHAGAQPDRVACVDLASGRRWTYRAFDEAIQRAVGVLESGHGVEPGQPIATLARNSADLLILQQAAMRLGAIFVPLNWRLAAAEQQAILEDCDPVLLLHDAALDLALTRRCIPVEVASFAKAVEAQAPAPRRPLPAGDAPSIILYTSGTSGRPKGVIVTECNAFATAVNFGVLGRVGNASIFLCDAPMFHVIGLITNLRPPLLQGGTVLISPGFDAGATNRRLADPALGVTHYFCVPQMARMLREHPDFAPARWTSLTAIFTGGAPNPAMDIRWWLAQGVRMVDGFGMTEAGTVLGMPVEADRIAGKAGSAGLPAPMIGLRIVDEDGRDVAAGEPGEIWLSGPSVTSGYWNRPEETERAFTADGWFRTGDIARQDGEGFVTLVDRRKDMFISGGENVYPAEIETALLDHPDITEAAVIGIADERWGEVGRAFVVVKPGCVVDPADLASHCCARIARYKVPKEFLLTDALPRTASGKIQKHILRTWTAPAGGQD
>NZ_CP033367.1|WP_027029977.1|3354015_3354831_-|p-hydroxycinnamoyl-CoA-hydratase/lyase
MTEETVAFDVENGIAWVRFNRPDKRNCMNPALNRRMMEVLDELEFRDDVGVLVLSGEGSAWSAGMDLKEYFRETEAKGLGAIRKAQSEAYGWWRRLRWYGKPTIAMVNGWCFGGGYGPLFACDLAFAADEAQFALSEINWGILPGGGATKVVVDLLSMRDAMYHALTGELIDGRKAAAWKLVNESLPLAELNARVTEVANILLKKNPIALKATKDAIRRVAEMTYDNAEDYLVRAQEAANFHDNSGRKEGIRQFIDEKSYKPGLGAYDKAR
>NZ_CP033367.1|WP_155256337.1|3355003_3355432_+|MarR-family-transcriptional-regulator
MTEDALDAQIGYNLRRASAFALNDFAVELADAALRPVTYGMLALIDEKPGIRAAELCRLLGMKSANMAPLLAELEERGLVERDDHAEDKRVRVLTLTQAAREAMPSWRRQVRRHEDRFLQRLTKKERATLLRLLRLIWTDED
>NZ_CP033367.1|WP_027029975.1|3356164_3357298_-|FAD-binding-oxidoreductase
MQSNPSPKIIVIGGGIAGLSLAAALRDWADVTVIEREPHLGYHASGRSAALFTETYGNRLVRALTLASRQQIVEGGFVAHRRGALHVGWRGDDAAKDRLAGELQALVPSVRRLSAAELHALVPVIAAEATCGGVYEPDAVDIDTGKMLAASASALKASGGMIRASEEVRAIARTENGFRVTTSAGAHQADIVVNAAGAWVDVVAGMAGLSGLGFQPKRRTAFLFDPPAGTDIAGWPLVVDLHEQFYFKPDAGRLIGSLADETDSEPCDAYPEDIDVAIAVDRIEQATSMRIGRPSTPWAGLRTFAPDRTPVAGFDPRLPGFFWLGGQGGYGFQVSLTLARLSAALMRGEPQPGDVTALGVTAAALAPDRFLALAATP
>NZ_CP033367.1|WP_027029974.1|3357423_3358323_-|transcriptional-regulator-GcvA
MPEAFLSLPPLNALRAFEASARHLNFRIAAEELNVTQGAVAQHIRGLEAHLGTKLFERLSRGLALTDEGRAYVPNIRRAFDLISEATLLLRPEPARLTISVTPSFATKWLIPRLQDFVAHNPLVDLRVLASESLSSFQADGVDIAVRQGRPPFGAGLMVDLLFPQQIIAICSPALLPVGTTEIAAAEIQHHVLLHDAHNLWPEFMEKAVGLKMTTELKRMRFNQTSLAIDAAIAGQGIALASRFLVAADLAAGRLVQPVSGEIRGTQDFYVVMPRKQRHPEPTQAVRQWLLNAGERASV
>NZ_CP033367.1|WP_027029973.1|3358450_3359155_+|SDR-family-oxidoreductase
MSVEKVAVVVAGGSGMGAAAAKRLAADGFKVAILSSSGKGEALAKELGGLGVTGSNQSNEDLQRLVDLTLEKWGRIDVLVNSGGHGPRAPILDITDEQWHTGMDVYLLNVVRPVRIVAPQMVKQKGGAIINISTAWVAEPNAMFPTSAVFRAGLAAYTKIFANTYAADNVRMNNVLPGWIDSLPATEERRDNVPMQRYGTSEEVAATIAFLASEGAGYITGQNIRVDGGVIRAL
>NZ_CP033367.1|WP_027029972.1|3359278_3359728_+|hypothetical-protein
MSDTFLRLVPTDAHWHPDEAAATAAVKIARGLFPLTEHVAVEYEEGVTFFDAGANTESIHCSFCGSDLEDWWGEAMDQAAGSRFENLSVTTPCCHKATSLNDLRYVWPAAFGVCALTVVNPGVASLASEQLRTIEQAMGSPLKVIWQHL
>NZ_CP033367.1|WP_155256335.1|3359761_3360421_+|hypothetical-protein
MTSFLSEVERTFPSLLRMPEELQMALQWMEENGFVRNHSIRFASLYPATVEQRQGISRTHFTVVDPDLMRAWLGNDDASATGRVAPFIVTGGEGSQAGIWMDDNGVQRFVHLGSGSGSTLSCVLADNAVDFLRLLAIGYEEICWPEVFTLTPEDAYTNEHRGDEHAIPYRAPVEFRHWVESTFHVTVPRTASEIVTCVANMDAAFSDDPFWQWARKAAG
>NZ_CP033367.1|WP_032926336.1|3360529_3362374_-|EAL-domain-containing-protein
MPIIGTKELITCDNTDFIHTGNDADRSGFILSVPVFGQDGSLRGSVSAIMLTSALRKLLPSTDYVIANSGYGFESDQHKMSTALAADSRAFTAADPNLIYSEVIPLSLNDPRSAWRLWAGFPNSRFDANMDAQSVREFELAGYAAVAVVTLLALACWYAIGRAMMMQANAAETLELRVEERTAEIQHLATHDILTGLPNRGLLADTMDEALRSLRDGEKLAVHCVDLDRFKPVNDTLGHPVGDELLGAVAKRLKQHAGETAMVARIGGDEFVILQLLLDGNDEAGVLASRVIHALSDEFSIQGHKINIGGSIGIAVFPDDGQRSETLIRNADLALYKAKMEGRGTCRSFEPGMDARLQERRLLESELALGVTREQFVLHYQPLHDAKTSKLTGFEALVRWNHPRLGLLQPSEFIQLAEETSVIDALGEWILRRACADAAKWPLHVKVAVNLSPAQFKQQGLSLQVASALAASGLLPSRLELEITESVLLANNENTVRTLHSLRDLGISIAMDDFGTGYSSLSYLRSFPFNRIKIDRSFVSLMCESSESRAIVKAVAELGTTLGMTTTAEGVETEDQYRLVRENGCTDVQGWLFGRPMPVSELHTLFEQPEALTA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP033367_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP033367_3

3350486-3350636

Orphan

Consensus_repeat	Method
GGCGGCGTTGCCGCCGGTGCTGGT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP033367_3

>merge|NZ_CP033367|3|3350486-3350636|CRISPRCasFinder
GGCGGCGTTGCCGCCGGTGCTGGTTCCCGTGAAGTTCGCGGCGCCCCCGAGAGCGACGGAAACGGCGGCGTTGCCGCCAGTGCTGGTCCCCGTGAAATTCGCGACGCCGCCGAGATTGACCGATATGCCGGCATTGTCGGCGCTGCTCGAT

>NZ_CP033367|3|3|3350486-3350636|CRISPRCasFinder
GGCGGCGTTGCCGCCGGTGCTGGT	TCCCGTGAAGTTCGCGGCGCCCCCGAGAGCGACGGAAAC
GGCGGCGTTGCCGCCAGTGCTGGT	CCCCGTGAAATTCGCGACGCCGCCGAGATTGACCGATAT
GCCGGCATTGTCGGCGCTGCTCGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP033367.1\|WP_027029975.1\|3356164_3357298_-\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP033367.1\|WP_027029989.1\|3334989_3335682_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP033367.1\|WP_171878145.1\|3336300_3336837_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027029972.1\|3359278_3359728_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027029977.1\|3354015_3354831_-\|p-hydroxycinnamoyl-CoA-hydratase/lyase	unknown	unknown	gnl\|CDD\|236383
NZ_CP033367.1\|WP_027029974.1\|3357423_3358323_-\|transcriptional-regulator-GcvA	unknown	unknown	gnl\|CDD\|182990
NZ_CP033367.1\|WP_027029988.1\|3335858_3336185_+\|DUF1330-domain-containing-protein	unknown	unknown	gnl\|CDD\|227757
NZ_CP033367.1\|WP_027029984.1\|3338872_3339532_+\|DUF3313-domain-containing-protein	unknown	unknown	gnl\|CDD\|378712
NZ_CP033367.1\|WP_032926336.1\|3360529_3362374_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|227334
NZ_CP033367.1\|WP_080680773.1\|3342011_3342212_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_155256339.1\|3338459_3338870_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_155256335.1\|3359761_3360421_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027029979.1\|3351741_3352461_+\|3-keto-5-aminohexanoate-cleavage-protein	unknown	unknown	gnl\|CDD\|225785
NZ_CP033367.1\|WP_027029982.1\|3339903_3341997_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|182070
NZ_CP033367.1\|WP_080680771.1\|3352465_3353986_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|181644
NZ_CP033367.1\|WP_051429610.1\|3337672_3338278_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380063
NZ_CP033367.1\|WP_027029983.1\|3339592_3339802_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027029986.1\|3336907_3337357_-\|ester-cyclase	unknown	unknown	gnl\|CDD\|377824
NZ_CP033367.1\|WP_155256337.1\|3355003_3355432_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP033367.1\|WP_027029973.1\|3358450_3359155_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187602

Protein	Function_ID	Function_description	E-value
NZ_CP033367.1\|WP_027029975.1\|3356164_3357298_-\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	3.51274e-45
NZ_CP033367.1\|WP_027029989.1\|3334989_3335682_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.07121e-34
NZ_CP033367.1\|WP_032926336.1\|3360529_3362374_-\|EAL-domain-containing-protein	gnl\|CDD\|227334	COG5001, COG5001, Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms].	1.15718e-118
NZ_CP033367.1\|WP_027029977.1\|3354015_3354831_-\|p-hydroxycinnamoyl-CoA-hydratase/lyase	gnl\|CDD\|236383	PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydratase/lyase; Validated.	0
NZ_CP033367.1\|WP_027029974.1\|3357423_3358323_-\|transcriptional-regulator-GcvA	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	7.09346e-95
NZ_CP033367.1\|WP_027029988.1\|3335858_3336185_+\|DUF1330-domain-containing-protein	gnl\|CDD\|227757	COG5470, COG5470, Uncharacterized conserved protein [Function unknown].	8.00152e-38
NZ_CP033367.1\|WP_027029984.1\|3338872_3339532_+\|DUF3313-domain-containing-protein	gnl\|CDD\|378712	pfam11769, DUF3313, Protein of unknown function (DUF3313). This a bacterial family of proteins which are annotated as putative lipoproteins.	7.32393e-47
NZ_CP033367.1\|WP_027029979.1\|3351741_3352461_+\|3-keto-5-aminohexanoate-cleavage-protein	gnl\|CDD\|225785	COG3246, COG3246, Uncharacterized conserved protein [Function unknown].	2.8472e-60
NZ_CP033367.1\|WP_027029982.1\|3339903_3341997_+\|EAL-domain-containing-protein	gnl\|CDD\|182070	PRK09776, PRK09776, putative diguanylate cyclase; Provisional.	1.70517e-116
NZ_CP033367.1\|WP_080680771.1\|3352465_3353986_-\|AMP-binding-protein	gnl\|CDD\|181644	PRK09088, PRK09088, acyl-CoA synthetase; Validated.	0
NZ_CP033367.1\|WP_051429610.1\|3337672_3338278_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|380063	pfam17937, TetR_C_28, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in CgmR (C. glutamicum multidrug-responsive transcriptional repressor), previously called CGL2612 protein. CgmR (CGL2612) from Corynebacterium glutamicum is a multidrug-resistance-related transcription factor belonging to the TetR family. It regulates expression of the immediately upstream gene cgmA (cgl2611) by binding to the operator cgmO in the cgmA promoter. The cgmA gene encodes a permease belonging to the major facilitator superfamily, a protein family composed of bacterial multidrug exporters, and the pair of CgmR and CgmA confers multidrug resistance on C. glutamicum.	1.28412e-13
NZ_CP033367.1\|WP_027029986.1\|3336907_3337357_-\|ester-cyclase	gnl\|CDD\|377824	pfam07366, SnoaL, SnoaL-like polyketide cyclase. This family includes SnoaL a polyketide cyclase involved in nogalamycin biosynthesis. This family was formerly known as DUF1486. The proteins in this family adopt a distorted alpha-beta barrel fold. Structural data together with site-directed mutagenesis experiments have shown that SnoaL has a different mechanism to that of the classical aldolase for catalyzing intramolecular aldol condensation.	1.13754e-33
NZ_CP033367.1\|WP_155256337.1\|3355003_3355432_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	9.3854e-14
NZ_CP033367.1\|WP_027029973.1\|3358450_3359155_+\|SDR-family-oxidoreductase	gnl\|CDD\|187602	cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR. This subgroup resembles the SDR family, but does not have a perfect match to the NAD-binding motif or the catalytic tetrad characteristic of the SDRs. It includes the SDRs, Q9HYA2 from Pseudomonas aeruginosa PAO1 and APE0912 from Aeropyrum pernix K1. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	3.30957e-94

>NZ_CP033367.1|WP_080680773.1|3342011_3342212_-|hypothetical-protein
MEGPLTSDFSAARIHLERAYHHLRGNDEASRSACEVLDQLIETVVEAQHRRPEAGVLEFPRSAARQ
>NZ_CP033367.1|WP_027029982.1|3339903_3341997_+|EAL-domain-containing-protein
MARQGKKSRNEEFWALALERAHLGVWDWDIANGSCFYSPTWWRMLGYEEGELADTADLWLQLTHPDDRERALASGDAHIAGLTPSIETEIRLKHKQGHWVWVLDRGGVVERDALGKPVRLMGVQTDISKQKAAEAALEQVNVRFRLALAASGTGIWHYDMATNKSYWDARTRDIFGLVADTDEVTGDLWHSFLHPDDKEATERAHQPSPGSDAVTASQYRIIKRDGEIRHVESLVRFVAAAGTAGQVLGTVRDITEDKLREQELAFAARHDALTGLWNRSAFDRLLADHIATGVPLAVFYVDLDYFKALNDFAGHAAGDLALKSVAAGIGRCLPPSAHAARLGGDEFALLVPHCDAAQAERLASAILAAVRGADLGLAATSRRLAASIGIAMVHDHTTTVADALACADDACYAAKAAGRDRFAVFSAEANSGGLNAARLAADTVDAMEDGRLKLFGQEIHRLGRPWDESRHVEVLARLVGRGGRLIPPGEFIPAAERFGIAARLDRWIIRTALSLHGAAMKSGAITLGFNLSAQTLSDPALWDFVDSIIEETGAPHSGIGFEITETAAVTNFDAAETFVRKARERRCRVSLDDFGAGMSSFEYLRRFPVDAIKIDGSFIEHITESRFDREIVLAITSIGRSLGCDVVGEKIERQDTLGMLSDMGVAFGQGFLLHRPEPLEQVVTRATIMAGAVRKAS
>NZ_CP033367.1|WP_027029983.1|3339592_3339802_+|hypothetical-protein
MEAISIAWFFSWQLWLTALSLIEGHPMHRVIFRTIILLGALALLGCERNSPFAKPEQPAKSSAESMWSP
>NZ_CP033367.1|WP_027029984.1|3338872_3339532_+|DUF3313-domain-containing-protein
MNRILRNSLTMAGLCLALQGCVSADPIAYSGLSSSAELAPNPRDATGRVPYAYSTAVDWRQYSSVIVDPVVIYRGADGQFGKMPASDKAAIASYMQARFTERLKSRFTLAGKAGPNTLRVRLTLTGAKANTPVLGTLSRFDIAGGVYNTVQTARDREGSLTGSVLYAVEIFDAGTNRLLKAFVTKQYPSPINIKASMEPLAAAQAGVDKGADALLAQLK
>NZ_CP033367.1|WP_155256339.1|3338459_3338870_+|hypothetical-protein
MAVADETRHGTRRPISRRLLFRQLVASVSTPLVATGLALCLVDLMTALLAVLLFGRVHTVVPGSEALLADRPQTLLLVLAAILALLPLLHLASKVFAHVARRSRRHAWLGTARVMLCAPASLCPVTVITLLLATGH
>NZ_CP033367.1|WP_051429610.1|3337672_3338278_+|TetR-family-transcriptional-regulator
MDNVSRSERSRNAIIQAALAIIARDGPGRLTLDAIAREGGLSKGGVMHQFRTKEAVLKTLLENQVEFFENFSRDFLAEAGTGTKEPQLSAQIAVQRKVVAEPHSVAFGLLGALAENPALLSGLRETDASKVEAIRSEAADPDLATLRLFAAKGLALTTMIGICSLSEEDLERLFDRLLDNTQWPATGDRSASSRVVNKKTD
>NZ_CP033367.1|WP_027029986.1|3336907_3337357_-|ester-cyclase
MTKQEDNKAVVVRWFTDFWGETCDLSVVDDIAAPDMLLRYSLHEPRSGRDDIKTFMTDFRAAFPDLNFWATADLIAEGDYVVGQWEGGGTHTGPAFSDFLAGSLPAATGRTMRFTGTTVLKVIDGRIVEEIGLDDGVAALTQLGLIKAT
>NZ_CP033367.1|WP_171878145.1|3336300_3336837_+|hypothetical-protein
MDMKSNLRNRLVMAGAMLAVCTSFAWAHQEAPEAASGPNPLADKVRAANSRFLDVKAATAEGYAPIPCASGITGGAMGIHYVNGQYLKDDKIDIARPEAVMYEPMADGTLKLVAVEYITSKGPASLDGQLFNFNSAPNRYGLGEFYELHVWAWKGNPTGTFADVNPKVSCEHAMAPSQ
>NZ_CP033367.1|WP_027029988.1|3335858_3336185_+|DUF1330-domain-containing-protein
MTVYVIADIKMKEPNWVPAYAASVHDIVHKHGGRYLARSGNVKTLEGKPLDTTLIALMAFPSETAARAFTNDPEYAPFVSARQGGSDSRFQLIDNTDLAGTIPYLPKG
>NZ_CP033367.1|WP_027029989.1|3334989_3335682_-|helix-turn-helix-transcriptional-regulator
MTQHGYKQFCPLSMAAEVLCTRWTMVLMRELVAGSTRFNDLRRGVPKMSPTLLSQRLKELELAGIVERKEIQGEKGIFDYRLTEAGRDLRPVVEAMGFWGQKWVESRLSLKNLDPSLLMWDMRRNLNPSPLPEGRTVIQFLYQELPASKRSWWLIVEKHGEVDLCWYDPGFDVDLYVATDLHTMTAIWMGLLTVEKAGAKVSLTGDQAIGKQMQTWLGLSPFAVEPKRAA
>NZ_CP033367.1|WP_027029979.1|3351741_3352461_+|3-keto-5-aminohexanoate-cleavage-protein
MIVQACINGARPRDFHPRLPLTAQAMASDAAACVAAGAAELHIHPRGADGRESLAAVDGTVLAVRQVCPGTLVGVSTGAWIESDVARTRAAITGWRELPDYASVNLSEADAAAVMELLRQRGVGIEAGLATIADAERFVALADHDRVLRILIEIDIQDLSTALDEAHGIEAVLERAGGRRPILLHGVDATVWPFVELAQQKRWSTRVGLEDGKTLADGTVAKDNAEIVAAAVAIFRSAG
>NZ_CP033367.1|WP_080680771.1|3352465_3353986_-|AMP-binding-protein
MRMPDWTTPDPVALHAGAQPDRVACVDLASGRRWTYRAFDEAIQRAVGVLESGHGVEPGQPIATLARNSADLLILQQAAMRLGAIFVPLNWRLAAAEQQAILEDCDPVLLLHDAALDLALTRRCIPVEVASFAKAVEAQAPAPRRPLPAGDAPSIILYTSGTSGRPKGVIVTECNAFATAVNFGVLGRVGNASIFLCDAPMFHVIGLITNLRPPLLQGGTVLISPGFDAGATNRRLADPALGVTHYFCVPQMARMLREHPDFAPARWTSLTAIFTGGAPNPAMDIRWWLAQGVRMVDGFGMTEAGTVLGMPVEADRIAGKAGSAGLPAPMIGLRIVDEDGRDVAAGEPGEIWLSGPSVTSGYWNRPEETERAFTADGWFRTGDIARQDGEGFVTLVDRRKDMFISGGENVYPAEIETALLDHPDITEAAVIGIADERWGEVGRAFVVVKPGCVVDPADLASHCCARIARYKVPKEFLLTDALPRTASGKIQKHILRTWTAPAGGQD
>NZ_CP033367.1|WP_027029977.1|3354015_3354831_-|p-hydroxycinnamoyl-CoA-hydratase/lyase
MTEETVAFDVENGIAWVRFNRPDKRNCMNPALNRRMMEVLDELEFRDDVGVLVLSGEGSAWSAGMDLKEYFRETEAKGLGAIRKAQSEAYGWWRRLRWYGKPTIAMVNGWCFGGGYGPLFACDLAFAADEAQFALSEINWGILPGGGATKVVVDLLSMRDAMYHALTGELIDGRKAAAWKLVNESLPLAELNARVTEVANILLKKNPIALKATKDAIRRVAEMTYDNAEDYLVRAQEAANFHDNSGRKEGIRQFIDEKSYKPGLGAYDKAR
>NZ_CP033367.1|WP_155256337.1|3355003_3355432_+|MarR-family-transcriptional-regulator
MTEDALDAQIGYNLRRASAFALNDFAVELADAALRPVTYGMLALIDEKPGIRAAELCRLLGMKSANMAPLLAELEERGLVERDDHAEDKRVRVLTLTQAAREAMPSWRRQVRRHEDRFLQRLTKKERATLLRLLRLIWTDED
>NZ_CP033367.1|WP_027029975.1|3356164_3357298_-|FAD-binding-oxidoreductase
MQSNPSPKIIVIGGGIAGLSLAAALRDWADVTVIEREPHLGYHASGRSAALFTETYGNRLVRALTLASRQQIVEGGFVAHRRGALHVGWRGDDAAKDRLAGELQALVPSVRRLSAAELHALVPVIAAEATCGGVYEPDAVDIDTGKMLAASASALKASGGMIRASEEVRAIARTENGFRVTTSAGAHQADIVVNAAGAWVDVVAGMAGLSGLGFQPKRRTAFLFDPPAGTDIAGWPLVVDLHEQFYFKPDAGRLIGSLADETDSEPCDAYPEDIDVAIAVDRIEQATSMRIGRPSTPWAGLRTFAPDRTPVAGFDPRLPGFFWLGGQGGYGFQVSLTLARLSAALMRGEPQPGDVTALGVTAAALAPDRFLALAATP
>NZ_CP033367.1|WP_027029974.1|3357423_3358323_-|transcriptional-regulator-GcvA
MPEAFLSLPPLNALRAFEASARHLNFRIAAEELNVTQGAVAQHIRGLEAHLGTKLFERLSRGLALTDEGRAYVPNIRRAFDLISEATLLLRPEPARLTISVTPSFATKWLIPRLQDFVAHNPLVDLRVLASESLSSFQADGVDIAVRQGRPPFGAGLMVDLLFPQQIIAICSPALLPVGTTEIAAAEIQHHVLLHDAHNLWPEFMEKAVGLKMTTELKRMRFNQTSLAIDAAIAGQGIALASRFLVAADLAAGRLVQPVSGEIRGTQDFYVVMPRKQRHPEPTQAVRQWLLNAGERASV
>NZ_CP033367.1|WP_027029973.1|3358450_3359155_+|SDR-family-oxidoreductase
MSVEKVAVVVAGGSGMGAAAAKRLAADGFKVAILSSSGKGEALAKELGGLGVTGSNQSNEDLQRLVDLTLEKWGRIDVLVNSGGHGPRAPILDITDEQWHTGMDVYLLNVVRPVRIVAPQMVKQKGGAIINISTAWVAEPNAMFPTSAVFRAGLAAYTKIFANTYAADNVRMNNVLPGWIDSLPATEERRDNVPMQRYGTSEEVAATIAFLASEGAGYITGQNIRVDGGVIRAL
>NZ_CP033367.1|WP_027029972.1|3359278_3359728_+|hypothetical-protein
MSDTFLRLVPTDAHWHPDEAAATAAVKIARGLFPLTEHVAVEYEEGVTFFDAGANTESIHCSFCGSDLEDWWGEAMDQAAGSRFENLSVTTPCCHKATSLNDLRYVWPAAFGVCALTVVNPGVASLASEQLRTIEQAMGSPLKVIWQHL
>NZ_CP033367.1|WP_155256335.1|3359761_3360421_+|hypothetical-protein
MTSFLSEVERTFPSLLRMPEELQMALQWMEENGFVRNHSIRFASLYPATVEQRQGISRTHFTVVDPDLMRAWLGNDDASATGRVAPFIVTGGEGSQAGIWMDDNGVQRFVHLGSGSGSTLSCVLADNAVDFLRLLAIGYEEICWPEVFTLTPEDAYTNEHRGDEHAIPYRAPVEFRHWVESTFHVTVPRTASEIVTCVANMDAAFSDDPFWQWARKAAG
>NZ_CP033367.1|WP_032926336.1|3360529_3362374_-|EAL-domain-containing-protein
MPIIGTKELITCDNTDFIHTGNDADRSGFILSVPVFGQDGSLRGSVSAIMLTSALRKLLPSTDYVIANSGYGFESDQHKMSTALAADSRAFTAADPNLIYSEVIPLSLNDPRSAWRLWAGFPNSRFDANMDAQSVREFELAGYAAVAVVTLLALACWYAIGRAMMMQANAAETLELRVEERTAEIQHLATHDILTGLPNRGLLADTMDEALRSLRDGEKLAVHCVDLDRFKPVNDTLGHPVGDELLGAVAKRLKQHAGETAMVARIGGDEFVILQLLLDGNDEAGVLASRVIHALSDEFSIQGHKINIGGSIGIAVFPDDGQRSETLIRNADLALYKAKMEGRGTCRSFEPGMDARLQERRLLESELALGVTREQFVLHYQPLHDAKTSKLTGFEALVRWNHPRLGLLQPSEFIQLAEETSVIDALGEWILRRACADAAKWPLHVKVAVNLSPAQFKQQGLSLQVASALAASGLLPSRLELEITESVLLANNENTVRTLHSLRDLGISIAMDDFGTGYSSLSYLRSFPFNRIKIDRSFVSLMCESSESRAIVKAVAELGTTLGMTTTAEGVETEDQYRLVRENGCTDVQGWLFGRPMPVSELHTLFEQPEALTA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP033367_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP033367_5

3608374-3608465

Orphan

Consensus_repeat	Method
GTGTCGCCACGATGTCATGGCAGCGCTACC	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP033367_5

>merge|NZ_CP033367|5|3608374-3608465|CRISPRCasFinder
GTGTCGCCACGATGTCATGGCAGCGCTACCGCCGCGAAAATCGTCTTCGATTTTCGCGTCAAGTGTCGCCACGATGTCATGGCAGCGCTACC

>NZ_CP033367|5|5|3608374-3608465|CRISPRCasFinder
GTGTCGCCACGATGTCATGGCAGCGCTACC	GCCGCGAAAATCGTCTTCGATTTTCGCGTCAA
GTGTCGCCACGATGTCATGGCAGCGCTACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP033367.1\|WP_155256309.1\|3617630_3618173_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027029736.1\|3612481_3613279_-\|glycoside-hydrolase-family-25-protein	unknown	unknown	gnl\|CDD\|119375
NZ_CP033367.1\|WP_027029737.1\|3611060_3612239_-\|lytic-murein-transglycosylase	unknown	unknown	gnl\|CDD\|225501
NZ_CP033367.1\|WP_027029744.1\|3604511_3605021_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027029731.1\|3616300_3617599_-\|DUF3419-family-protein	unknown	unknown	gnl\|CDD\|227670
NZ_CP033367.1\|WP_027029747.1\|3601724_3602342_+\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
NZ_CP033367.1\|WP_027029738.1\|3609643_3610864_+\|alanine-racemase	unknown	unknown	gnl\|CDD\|143482
NZ_CP033367.1\|WP_032925425.1\|3605337_3605859_-\|tRNA-(N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase-TrmO	unknown	unknown	gnl\|CDD\|224634
NZ_CP033367.1\|WP_027029745.1\|3603390_3604353_-\|D-amino-acid-aminotransferase	unknown	unknown	gnl\|CDD\|238799
NZ_CP033367.1\|WP_027029748.1\|3601077_3601707_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP033367.1\|WP_027029743.1\|3605026_3605341_-\|DUF2293-domain-containing-protein	unknown	unknown	gnl\|CDD\|227873
NZ_CP033367.1\|WP_027029740.1\|3607087_3608005_+\|methylenetetrahydrofolate-reductase-[NAD(P)H]	unknown	unknown	gnl\|CDD\|273212
NZ_CP033367.1\|WP_027029735.1\|3613522_3614902_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP033367.1\|WP_027029739.1\|3608514_3609432_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP033367.1\|WP_027029746.1\|3602417_3603257_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181334
NZ_CP033367.1\|WP_027029741.1\|3606071_3607088_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|316372
NZ_CP033367.1\|WP_027029733.1\|3615236_3615533_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|282822
NZ_CP033367.1\|WP_027029732.1\|3615644_3616304_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP033367.1\|WP_027029749.1\|3600538_3600958_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027029734.1\|3614917_3615226_-\|HigA-family-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|225635

Protein	Function_ID	Function_description	E-value
NZ_CP033367.1\|WP_027029736.1\|3612481_3613279_-\|glycoside-hydrolase-family-25-protein	gnl\|CDD\|119375	cd06413, GH25_muramidase_1, Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.	1.93809e-110
NZ_CP033367.1\|WP_027029737.1\|3611060_3612239_-\|lytic-murein-transglycosylase	gnl\|CDD\|225501	COG2951, MltB, Membrane-bound lytic murein transglycosylase B [Cell envelope biogenesis, outer membrane].	1.20782e-120
NZ_CP033367.1\|WP_027029731.1\|3616300_3617599_-\|DUF3419-family-protein	gnl\|CDD\|227670	COG5379, BtaA, S-adenosylmethionine:diacylglycerol 3-amino-3-carboxypropyl transferase [Lipid metabolism].	0
NZ_CP033367.1\|WP_027029747.1\|3601724_3602342_+\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	5.307e-08
NZ_CP033367.1\|WP_027029738.1\|3609643_3610864_+\|alanine-racemase	gnl\|CDD\|143482	cd00622, PLPDE_III_ODC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase. This subfamily is composed mainly of eukaryotic ornithine decarboxylases (ODC, EC 4.1.1.17) and ODC-like enzymes from prokaryotes represented by Vibrio vulnificus LysineOrnithine decarboxylase. These are fold type III PLP-dependent enzymes that differ from most bacterial ODCs which are fold type I PLP-dependent enzymes. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. Members of this subfamily contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity. Also members of this subfamily are proteins with homology to ODC but do not possess any catalytic activity, the Antizyme inhibitor (AZI) and ODC-paralogue (ODC-p). AZI binds to the regulatory protein Antizyme with a higher affinity than ODC and prevents ODC degradation. ODC-p is a novel ODC-like protein, present only in mammals, that is specifically exressed in the brain and testes. ODC-p may function as a tissue-specific antizyme inhibitory protein.	7.74521e-96
NZ_CP033367.1\|WP_032925425.1\|3605337_3605859_-\|tRNA-(N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase-TrmO	gnl\|CDD\|224634	COG1720, COG1720, Uncharacterized conserved protein [Function unknown].	7.8787e-49
NZ_CP033367.1\|WP_027029733.1\|3615236_3615533_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|282822	pfam05015, HigB-like_toxin, RelE-like toxin of type II toxin-antitoxin system HigB. This family carries several different examples of type II bacterial toxins of toxin-antitoxin systems including many HigB-like ones. The fold is referred to as the RelE/YoeB/Txe/Yeeu fold suggesting all examples of these are present in this family. Several plasmids with proteic killer gene-systems have been reported. All of them encode a stable toxin and an unstable antidote. Upon loss of the plasmid, the less stable inhibitor is inactivated more rapidly than the toxin, allowing the toxin to be activated. The activation of these systems results in cell filamentation and cessation of viable cell production. It has been verified that both the stable killer and the unstable inhibitor of the systems are short polypeptides. This family corresponds to the toxin.	1.08936e-42
NZ_CP033367.1\|WP_027029748.1\|3601077_3601707_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.7427e-08
NZ_CP033367.1\|WP_027029743.1\|3605026_3605341_-\|DUF2293-domain-containing-protein	gnl\|CDD\|227873	COG5586, COG5586, Uncharacterized conserved protein [Function unknown].	5.97375e-41
NZ_CP033367.1\|WP_027029740.1\|3607087_3608005_+\|methylenetetrahydrofolate-reductase-[NAD(P)H]	gnl\|CDD\|273212	TIGR00676, 510-methylenetetrahydrofolate_reductase., 5,10-methylenetetrahydrofolate reductase, prokaryotic form. The enzyme activities methylenetetrahydrofolate reductase (EC 1.5.1.20) and 5,10-methylenetetrahydrofolate reductase (FADH) (EC 1.7.99.5) differ in that 1.5.1.20 (assigned in many eukaryotes) is defined to use NADP+ as an acceptor, while 1.7.99.5 (assigned in many bacteria) is flexible with respect to the acceptor; both convert 5-methyltetrahydrofolate to 5,10-methylenetetrahydrofolate. From a larger set of proteins assigned as 1.5.1.20 and 1.7.99.5, this model describes the subset of proteins found in bacteria, and currently designated 1.7.99.5. This protein is an FAD-containing flavoprotein. [Amino acid biosynthesis, Aspartate family].	6.08271e-142
NZ_CP033367.1\|WP_027029735.1\|3613522_3614902_+\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	2.86382e-36
NZ_CP033367.1\|WP_027029739.1\|3608514_3609432_-\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	2.06046e-15
NZ_CP033367.1\|WP_027029746.1\|3602417_3603257_-\|SDR-family-oxidoreductase	gnl\|CDD\|181334	PRK08263, PRK08263, short chain dehydrogenase; Provisional.	2.26425e-167
NZ_CP033367.1\|WP_027029741.1\|3606071_3607088_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	gnl\|CDD\|316372	pfam13847, Methyltransf_31, Methyltransferase domain. This family appears to have methyltransferase activity.	1.89838e-24
NZ_CP033367.1\|WP_027029732.1\|3615644_3616304_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	2.03466e-19
NZ_CP033367.1\|WP_027029745.1\|3603390_3604353_-\|D-amino-acid-aminotransferase	gnl\|CDD\|238799	cd01558, D-AAT_like, D-Alanine aminotransferase (D-AAT_like): D-amino acid aminotransferase catalyzes transamination between D-amino acids and their respective alpha-keto acids. It plays a major role in the synthesis of bacterial cell wall components like D-alanine and D-glutamate in addition to other D-amino acids. The enzyme like other members of this superfamily requires PLP as a cofactor. Members of this subgroup are found in all three forms of life.	1.4134e-111
NZ_CP033367.1\|WP_027029734.1\|3614917_3615226_-\|HigA-family-addiction-module-antidote-protein	gnl\|CDD\|225635	COG3093, VapI, Plasmid maintenance system antidote protein [General function prediction only].	2.03279e-42

>NZ_CP033367.1|WP_027029740.1|3607087_3608005_+|methylenetetrahydrofolate-reductase-[NAD(P)H]
MNQFRFSRRPDIGDKVKVSFEFFPPKNDEMEARLWDTVTRLEPLKPKFVSVTYGAGGSTRERTARTINRILKETSLTPAAHMTCVDAARHQVDAVIKEFADMGVKRFVALRGDPAAGVGTAYRPHADGYANGAELVGALKEAGDFDISVSAYPEKHPESPDFATDIDMLKRKVDNGATRAITQFFFDNDLYERYVERARRAGIYIPIVPGILPVHNFTQVANFSARCGALVPAWLAERFDGLQNDPQTHALVASAVAAEQVLDLVERGVGDFHFYTMNRADLVFAVCHMIGIRSHETEVAGSAAA
>NZ_CP033367.1|WP_027029741.1|3606071_3607088_+|metalloregulator-ArsR/SmtB-family-transcription-factor
MHVSLDTMVDTLKAAAESSRLRILALLSRGDLTVSDLTEILGQSQPRVSRHLKLLLEAGLIGRYQEGSWAFFRLSDADSARDFVMGLVSSIRGADPQVERDLERLASVKRKRQDRATEYFSVNAASWDHIRSLHVPDRAVEAAMLKLVGKRPFQSMLDLGTGTGRLLEIFSPLYRRGVGIDMSREMLTVARANLDKAGISNAQVRQGDIFSPPVERDAFDLVTIHQVLHYLDDPARAIHEAARLLRPAGRLVIVDFAPHTLEFLRDEHAHMRLGFSDRQIGEWFTEAGLDLEDAQEFEPRGGNEARLTVKLWLGRDRRLLIADPANEQTKVNSIGEIA
>NZ_CP033367.1|WP_032925425.1|3605337_3605859_-|tRNA-(N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase-TrmO
MFEAREGEQRLEQDPATMPADGSIVFIGRIASPWVTRESCPKNMRAARETGQPAVLTIDPPYRSGLQGLERASHVIILSWLHHAPRNLIVQKPRHAAEAKGVFGLRSPARPNPVGLHVARLVGLDIATGRIDLDAIDVLDGTPVIDIKPYFASTDAFAEATIEGRDEPNRVLP
>NZ_CP033367.1|WP_027029743.1|3605026_3605341_-|DUF2293-domain-containing-protein
MTAPTGRRRAIAKALTALLPLAPYADMEKIRTDAGSLHMKTLPPTIAVWLAAIAHIRHMHTDYEKLLAEGYDRDSARFFVIEQTNIVLTRWRATRLLDADEEEE
>NZ_CP033367.1|WP_027029744.1|3604511_3605021_+|hypothetical-protein
MGRLGIVIAVLSIFAAASEASAQCAKEGDELCQNGQTYRCEKTGSELTPIFQNVPCVVNVPAPSLIGTWVGSGHQSPAGDAGADWSIAMTIGDGSASIDYPSLGCGGSLSQTSRDDTSAQFHESITYGQDKCIDGGDITVRFFKGNLSWTWVGQAEGQPYNAIAVLTRQ
>NZ_CP033367.1|WP_027029745.1|3603390_3604353_-|D-amino-acid-aminotransferase
MDQTTATRASKPLPAVSDRHVDPHSYPDGIAFLDGQYLPMSQAKVSVLDWGFLHSDATYDTVHVWNGRFFRLDLHLDRFFGGLEKLRMTIPFDRDEVTEILHNCTALSGHRAAYVEMLCTRGASPTFSRDPRHAINRFMAFAVPFGSVANAEQLQRGLHVAVSDKMRIPPASIDPAIKNYHWLDLVRGLYDAYDRGAETALILDFNGNVAEGPGFNVFCVKDGKLSTPAIGVLPGITRRTVFDLSGEEGLVAKAADVSVAALKAADEVFITSTAGGIMPVTEIDGAAIAEGKVGPITSRLMALYWQKHDHPAWSSQVNYP
>NZ_CP033367.1|WP_027029746.1|3602417_3603257_-|SDR-family-oxidoreductase
MTSKVWFITGSSKGFGRVWAEAALARGDRVAATARDAGTLADLVEKYGDNIAAIKLDVNDKKAVDSAVAEAHKRFGRLDVVINNAGYGHFGAIEEVSEQEARDQIETNVFGALWVTQAALPIMRAQRSGHIIQISSIGGVNAFASLGLYHASKWALEAFSQSLSIEVAEFGIHVTLVEPGGFSTDWSGASAKVSKPIEAYAPARAKMAERRANSVAGDPEATGPAMLAIVDAAEPPLRVFFGDGGLPMIRQEYANRLATWDKWDHVSIMAQGAKKNRKD
>NZ_CP033367.1|WP_027029747.1|3601724_3602342_+|MOSC-domain-containing-protein
MLDLFPEAEKPVEIIPAKKLSARAAALYVAPADHFQTRPVEELRLGFDGISGDFHAGPTRRSGGREPWYPRGTEMRNERQLSIVAEDELAIVAERMGLAEIKPEWIGANLVVEGLPKLSMLPAGTLLFFKGGVTLKVDAQNGPCRLAGRSTAENAGMADIEAGALLFPKVAKRLRGLVAWVEKPGTIRAGEEISARVPEQWIYQA
>NZ_CP033367.1|WP_027029748.1|3601077_3601707_+|TetR/AcrR-family-transcriptional-regulator
MNNLEKARGGRPRAFDPDRALDAAMHLFWEHGYEATSLAMLREAMGLTPPQIYNAFTDKETLFRKALTRYHATEIGFALDALSAPVSTREAIRRLLLGAAEAYSRPGKPGGCLFVSGALAASPQAQAIADELKAYRKASEAAIAERLAKGRTAGDLPENLSVEGLAKYLAGVMNGMSIQARDGASVEELRILAQIALAALPGEGQKRRA
>NZ_CP033367.1|WP_027029749.1|3600538_3600958_-|hypothetical-protein
MPITVTAPEGVLTEVGEREILPRLSAALIEASGATGNSFFTAIVGGTVHVLPPRHIYAGGANRPVVMVELKLPNIGLGSVEARNAFITNAAGIVAELCVPGHKPENTWINIVNAPDGGWGIGDRQYTGDALIAAATAAH
>NZ_CP033367.1|WP_027029739.1|3608514_3609432_-|DMT-family-transporter
MAVTATSTPRGPMTLTDWGQLLLLGAIWGGSFFFARIAVAELHPLVLVLFRVGIAAIALQIYLGLRGPSFRLALPHAGLFFLLAFTNNVVPFSLIFAGQTELGAGVASVLNATTPFWTLILANALTSDEKLSWNKLAGIGLGVAGTAVMIGPGLLAGLGGPVWAKFALIGASLSYAVALMIARRFKGVPSPVLATGQMTASTIIMIPIVLFVHGPAGLFSASPPVWAAVLALALLSTAFAYVLYFNLVASAGVTNASLVTLIVPASALLLGFLFLGERLELFEIGGVVLIALGLLTIDGRVLGKR
>NZ_CP033367.1|WP_027029738.1|3609643_3610864_+|alanine-racemase
MQRFENAREAALALRPDDPVYCFRPQVLKADARQFMGMFPGKTAYAVKTNGEPIVLKALVEAGVTAFDVASPGEFAAVRAVSPDAEMLYMHPVKAQSDIKLALEKYGIRVISLDHEDEITKVTRVVRALDIDPGTISVFVRVQTKGHAAYELSKKFGAGPAYAVELAERLNRTGYKVGLCFHVGSQIEDPDTYERALASADWVRNRLTFDIAGLDVGGGFPAEYGNDPNRKQVEMPSLGQIMSRLSGDLKEYQFDQMPLVAEPGRVIVARCLSLIVRVLLRKGKRLYINDGIWASLSDSWTGKITLPARFIPDPAIRTRNGDENKIVPFKVCGATCDSVDILSRPFWLPETVDTGDWIEIGHIGAYSLSLRTRFNGFYPDTFVEVTTPFDEGDAPQGFASLETMAD
>NZ_CP033367.1|WP_027029737.1|3611060_3612239_-|lytic-murein-transglycosylase
MRLRSQALAALFLCATALPAMAQECGGDFETWKQGVAVEAKAAGVGAVGLDALEDARIDERALARDRAQGVFTQTFVEFSNRMISAYRLKQGAANMKKYADVFARADQQFGVQAPVITAFWALETDFGAVQGDFHTLSALVTLSHDCRRPQLFRQQLVPLLELIDHGVLPADVQGAWAGEIGQTQILPSDYLASGVDGDGDGKIDLRKSVPDVIMTTANKVLSRGWKRDEPWIQEVRVPDQMPWDQTGRTNKLPLTQWAQWGVTNPDGSPLVDKGLTAGLALPMGRKGPAFLTYENFDVYLEWNQSFTYALTAANLAARLAGAPPLDPRNPEPGLNNDQMKALQTKLEARGYDVGTVDGILGTNTREAIRKEQMRLGLPVDGWPTPELLGKL
>NZ_CP033367.1|WP_027029736.1|3612481_3613279_-|glycoside-hydrolase-family-25-protein
MRRLAALFMLTLLGACSTVDDLSLSPSASSSRTVAVRAPRFADSKPHEWDSGAPWNYAVHGTDVSKYQTSVDWPTARASGISFAFIKATEGGDRFDEYFNEHWARTKANGIPRAAYHFFYFCTPAAQQARWFIQNVPVDRSAMPPVLDMEWNPQSPTCRLRPDPATVRAEMTTFLEIVERHYGKKPIIYTSVDFFDDNELSTFRGYPYWLRSVAGHPREKYGSHPFTFWQYTGTGIVPGMTGKSDINVFNGSEAAWNKWLRQNTR
>NZ_CP033367.1|WP_027029735.1|3613522_3614902_+|serine-hydrolase
MRIVVKIIKWLLGLIVLAVAALFAWLYIAPPELIRVGSGYSAKIVCSNVFIAGRDPNEVLAVDVQAPGHPLLRLMRVSVDKNRGTVSAGLLGFLGKSVAVAREGLGCASVPDGDVGKARRTTIPAEASVAAKGDLWPEGDRVDASQNPEITKVLGDAAMAGTGMRAIVVVKNGRVVAERYGDGFSAKTPLLGWSMTKTVNAAIIGTLVKDGKMAVDNKGLFAPWKADGRAAISLTDMMAMSSGLEFNEDYGDVADVTRMLYLEPDMAGFAESKPLAAEVGKVFSYSSGTAVMLSRLWQDAIGDKVKALTWPRSALFEPLGMHSAVLETDEQGTFVGGSYLYATAHDWARFGQFLLQGGVWNGNQVLPAGFVDWMREPAPASKVYGKGQLWIEGPGDEDSPGAGVAAGLPKDAYWMEGHDGQTVTIIPSEQLVIVRLGLTPAKFGYRPQAMVGALVKALH
>NZ_CP033367.1|WP_027029734.1|3614917_3615226_-|HigA-family-addiction-module-antidote-protein
MLMTTRKPATVGEILTEEFMQPLGLTQAALAGAMGVQRKHVNELCNDRRNVTAATALILARVFGNSPDFWLNVQRRSDLWTVMNSPDERARVDRAKPLPTAA
>NZ_CP033367.1|WP_027029733.1|3615236_3615533_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MIVDFRDGWLRAYFVDNTRSRNIPSDLESRLFRKLQMIDDAAIDQDLRAPPSNHFEKLRGNLEGFHSIRVNKQWRLVFRWDGGRGEASDIYLDDHSYK
>NZ_CP033367.1|WP_027029732.1|3615644_3616304_-|class-I-SAM-dependent-methyltransferase
MSTTELPASHAELMDGVYRWQRHIYDLTRKYYLLGRDRLIEGLEIPAGGTVLELGCGTGRNIILAARRYPDAHFFGLDISAEMLETAAKAIDREGLSDRVTLARGDATDFDAGALYGIERFDRVFVSYSLSMIPGWEKTVSAALAALSPSGSLHIVDFGQQEGLPNWFRTMLRGWLRKFHVTPRESLREVLESESRRTGATFRFRTLYRGYAWLAVIKI
>NZ_CP033367.1|WP_027029731.1|3616300_3617599_-|DUF3419-family-protein
MTLGYPLATKQMGNHFVMTDVSSDLVFRRGKEVGKAVYQNRALSKAGISERLFALLFSGLVYPQIWEDPDVDMEAMQLGQGHRVVTIASGGCNILAYLTRSPAQIDAVDLNAAHIALNRMKLEAVRRLPSQGDLFRFFGAADTSHNSEAYDRFIAPHLDPVSRHYWEHRSWRGRRRIGVFDRNFYQTGLLGLFIAMGHRSAKFFGVNPARMMEAKNIGEQRRFFNEELAPVFDKKLLKWATSRKASLFGLGIPPAQYDSLITSGDGTMASVLKARLEKLACDFPLENNYFAWQAFARRYPEPGEAALPAYLEKQNYDTIRGNIDRVAIHHANLIEFLAGKDAGAVDRFILLDAQDWMTDEQLNALWSEITRTASAGARVIFRTAAEPSLLPGRVSTSLLDQWDYQNEASREFSARDRSAIYGGFHLYVKRAA
>NZ_CP033367.1|WP_155256309.1|3617630_3618173_-|hypothetical-protein
MSYWRTHQDSRNCAILADWGNDYGSQDLLGMEGARDIDQSKLRFRFDKQRPLPIGDFAPTAKPGVLFARREIFDLFGSIILQSRHKFYTAKTDKYDLEIYVPMEEVDGFDFLRSNYEKYQFDGGDISRIFDLKLKEGFSTDLDLFRLRDPFVARFDIIFSDKFKDTYESNKLTGLRFAAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP033367_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP033367_6

4816127-4816212

Orphan

Consensus_repeat	Method
CCGTGGGACACTTTTGCGGAACCTGCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP033367_6

>merge|NZ_CP033367|6|4816127-4816212|CRISPRCasFinder
CCGTGGGACACTTTTGCGGAACCTGCTTCCTTCCAACTGTCGCAGGTTCTGTCGCAAGGCCGTGGGACACTTTTGCGGAACCTGCT

>NZ_CP033367|6|6|4816127-4816212|CRISPRCasFinder
CCGTGGGACACTTTTGCGGAACCTGCT	TCCTTCCAACTGTCGCAGGTTCTGTCGCAAGG
CCGTGGGACACTTTTGCGGAACCTGCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP033367.1\|WP_027028671.1\|4818025_4819198_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027028677.1\|4813588_4814407_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|225312
NZ_CP033367.1\|WP_027028665.1\|4822512_4822764_-\|DUF1127-domain-containing-protein	unknown	unknown	gnl\|CDD\|227744
NZ_CP033367.1\|WP_027028682.1\|4810097_4810352_-\|DUF2171-domain-containing-protein	unknown	unknown	gnl\|CDD\|226320
NZ_CP033367.1\|WP_027028670.1\|4819482_4820034_+\|RNA-2'-phosphotransferase	unknown	unknown	gnl\|CDD\|179136
NZ_CP033367.1\|WP_027028666.1\|4821840_4822482_+\|Pr6Pr-family-membrane-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027028681.1\|4810485_4811223_+\|DUF2259-domain-containing-protein	unknown	unknown	gnl\|CDD\|370780
NZ_CP033367.1\|WP_027028672.1\|4817659_4817902_+\|phosphoribosylformylglycinamidine-synthase-subunit-PurS	unknown	unknown	gnl\|CDD\|235659
NZ_CP033367.1\|WP_027028675.1\|4815222_4815996_-\|HpcH/HpaI-aldolase/citrate-lyase-family-protein	unknown	unknown	gnl\|CDD\|226356
NZ_CP033367.1\|WP_027028678.1\|4813237_4813585_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027028679.1\|4811901_4813209_+\|adenylosuccinate-lyase	unknown	unknown	gnl\|CDD\|181000
NZ_CP033367.1\|WP_027028676.1\|4814650_4815205_+\|serine-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|226075
NZ_CP033367.1\|WP_032925327.1\|4811279_4811744_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027028674.1\|4816222_4816543_-\|DUF1476-domain-containing-protein	unknown	unknown	gnl\|CDD\|311347
NZ_CP033367.1\|WP_027028673.1\|4816820_4817615_+\|phosphoribosylaminoimidazolesuccinocarboxamide-synthase	unknown	unknown	gnl\|CDD\|181800
NZ_CP033367.1\|WP_027028684.1\|4807992_4809063_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380565
NZ_CP033367.1\|WP_027028683.1\|4809062_4810085_+\|P1-family-peptidase	unknown	unknown	gnl\|CDD\|225732
NZ_CP033367.1\|WP_027028669.1\|4820030_4820699_+\|phosphoribosylformylglycinamidine-synthase-subunit-PurQ	unknown	unknown	gnl\|CDD\|235140
NZ_CP033367.1\|WP_027028667.1\|4821430_4821838_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027028668.1\|4820768_4821434_+\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|223698

Protein	Function_ID	Function_description	E-value
NZ_CP033367.1\|WP_027028677.1\|4813588_4814407_-\|VOC-family-protein	gnl\|CDD\|225312	COG2514, COG2514, Predicted ring-cleavage extradiol dioxygenase [General function prediction only].	3.43921e-125
NZ_CP033367.1\|WP_027028665.1\|4822512_4822764_-\|DUF1127-domain-containing-protein	gnl\|CDD\|227744	COG5457, COG5457, Uncharacterized conserved small protein [Function unknown].	1.18892e-11
NZ_CP033367.1\|WP_027028682.1\|4810097_4810352_-\|DUF2171-domain-containing-protein	gnl\|CDD\|226320	COG3798, COG3798, Uncharacterized protein conserved in bacteria [Function unknown].	6.86093e-29
NZ_CP033367.1\|WP_027028670.1\|4819482_4820034_+\|RNA-2'-phosphotransferase	gnl\|CDD\|179136	PRK00819, PRK00819, RNA 2'-phosphotransferase; Reviewed.	2.02055e-89
NZ_CP033367.1\|WP_027028675.1\|4815222_4815996_-\|HpcH/HpaI-aldolase/citrate-lyase-family-protein	gnl\|CDD\|226356	COG3836, HpcH, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [Carbohydrate transport and metabolism].	1.12134e-106
NZ_CP033367.1\|WP_027028681.1\|4810485_4811223_+\|DUF2259-domain-containing-protein	gnl\|CDD\|370780	pfam10016, DUF2259, Predicted secreted protein (DUF2259). Members of this family of hypothetical bacterial proteins have no known function.	1.91071e-86
NZ_CP033367.1\|WP_027028672.1\|4817659_4817902_+\|phosphoribosylformylglycinamidine-synthase-subunit-PurS	gnl\|CDD\|235659	PRK05974, PRK05974, phosphoribosylformylglycinamidine synthase subunit PurS; Reviewed.	4.55218e-40
NZ_CP033367.1\|WP_027028683.1\|4809062_4810085_+\|P1-family-peptidase	gnl\|CDD\|225732	COG3191, DmpA, L-aminopeptidase/D-esterase [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	1.90877e-106
NZ_CP033367.1\|WP_027028679.1\|4811901_4813209_+\|adenylosuccinate-lyase	gnl\|CDD\|181000	PRK07492, PRK07492, adenylosuccinate lyase; Provisional.	0
NZ_CP033367.1\|WP_027028676.1\|4814650_4815205_+\|serine-hydrolase-family-protein	gnl\|CDD\|226075	COG3545, COG3545, Predicted esterase of the alpha/beta hydrolase fold [General function prediction only].	8.40053e-96
NZ_CP033367.1\|WP_027028674.1\|4816222_4816543_-\|DUF1476-domain-containing-protein	gnl\|CDD\|311347	pfam07345, DUF1476, Domain of unknown function (DUF1476). This family consists of several hypothetical bacterial proteins of around 100 residues in length. Members of this family are found in Bradyrhizobium, Rhizobium, Brucella and Caulobacter species. The function of this family is unknown.	1.45428e-47
NZ_CP033367.1\|WP_027028673.1\|4816820_4817615_+\|phosphoribosylaminoimidazolesuccinocarboxamide-synthase	gnl\|CDD\|181800	PRK09362, PRK09362, phosphoribosylaminoimidazole-succinocarboxamide synthase; Reviewed.	2.48984e-157
NZ_CP033367.1\|WP_027028684.1\|4807992_4809063_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380565	cd06342, PBP1_ABC_LIVBP-like, type 1 periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine). This subgroup includes the type 1 periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine). This subgroup also includes a leucine-specific binding protein (or LivK), which is very similar in sequence and structure to leucine-isoleucine-valine binding protein (LIVBP). ABC-type active transport systems are transmembrane proteins that function in the transport of diverse sets of substrates across extra- and intracellular membranes, including carbohydrates, amino acids, inorganic ions, dipeptides and oligopeptides, metabolic products, lipids and sterols, and heme, to name a few.	6.73551e-59
NZ_CP033367.1\|WP_027028669.1\|4820030_4820699_+\|phosphoribosylformylglycinamidine-synthase-subunit-PurQ	gnl\|CDD\|235140	PRK03619, PRK03619, phosphoribosylformylglycinamidine synthase subunit PurQ.	4.30101e-145
NZ_CP033367.1\|WP_027028668.1\|4820768_4821434_+\|glutathione-S-transferase-family-protein	gnl\|CDD\|223698	COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	1.73921e-36

>NZ_CP033367.1|WP_027028675.1|4815222_4815996_-|HpcH/HpaI-aldolase/citrate-lyase-family-protein
MSLKSRLAADETLITAWSGVPDALTVEILAKQGFDAVTLDMQHGGHHEDSVLRGLVPVLAANKPALVRIPVGRFDMASRALDFGAEAVIAPMVNSVADAKLFAAAMKYPPLGERSWGPTYAFPRHGKGDYAEWLRDTNQRTMAFAMVETRAALDALDGILDTPGIDGIFLGPSDFSIAWSNGTTVNSTLESMMETIASVAERTRKAGKHAAIYVVEPAIAGRVVAMGYRLLATGSEHAVISLGAKTLLKGIKDSIGA
>NZ_CP033367.1|WP_027028676.1|4814650_4815205_+|serine-hydrolase-family-protein
MKVKDADILIVPGYTNSGPEHWQTRWQSKLSTARRVEQAEWSKPVREDWTASVAKAVNEAERPVVIVAHSLGVAAAVQAVPRFVRPVAGAFFVAPPDVANPKIKPKHLMTFGPYPREPLPFPSIVIASRNDPFCAFDVAEDIAGAWGSLFIDAGETGHLNADSGFGPWPEGSMTFAKFLTDLKA
>NZ_CP033367.1|WP_027028677.1|4813588_4814407_-|VOC-family-protein
MSELPFAATTPVSVARVGLKARDAESLAAYYRRVVGLQELSRADGAITLGAGSRPLLVIEADPSAKPDDPRSAGLFHTAFLLPSRADLGRWINHAISAKIAIEGASDHLVSEALYLTDPEGNGIEIYADRRPQDWKWNGDKVAMATERMNIPAVVGSVPAGDAGWQGAPENSIVGHVHLRVGRPEEAETWWNKEFGFDTVAKYGGQAVFLSSGGYHHHIGANAWQSPGAGRRDPSRSGLAWVEMRSDNVASESSREDPWGTVIRTVPGKAGS
>NZ_CP033367.1|WP_027028678.1|4813237_4813585_+|hypothetical-protein
MGVIVIGEGIEDFGTASWFARWVIRYCIGEVGERPYLVNFKNQYDWGYNCIYVDQLASADLAEFAGLLHKFVLDFELDAPSYDREKFLAHAQHLSALVDTYVEKRKALGSTGAAE
>NZ_CP033367.1|WP_027028679.1|4811901_4813209_+|adenylosuccinate-lyase
MIPRYSRPEMVAIWSPETRFRIWFEIEAHACDALAELGVIPKAAAKTIWEKGSAAKFDVDKIDEIERVTKHDVIAFLTHLAEFVGPDARFIHQGMTSSDVLDTCFAVQLTRASDILLGDIDGLLAALKRRAFEHKDTVTIGRSHGIHAEPTTFGIKLAQAYAEFSRCRERLVHAREDIATCAISGAVGTFANIEPYVEEHVAAKLGLKPEPVSTQVIPRDRHAMFFATLGVIASSMERLATEIRHLQRTEVLEAEEYFSPGQKGSSAMPHKRNPVLTENLTGLARMVRSMALPAMEDVALWHERDISHSSVERMIGPDATVTLDFALSRLTGVIDKLVVYPENMLKNMNKFRGLVHSQRVMLALTQAGLSREDSYRLVQRNAMRVWEQGADFLEELLADKEVTAALPEAEIREKFDLGYHTKHVDTIFRRVFGEA
>NZ_CP033367.1|WP_032925327.1|4811279_4811744_+|hypothetical-protein
MPTLREALLGAVLWAATMGASALVNLLLDNWVTPDKIRTVSLLFAGGGALAIPVGLFAARLVSLGRGWEVAFAATLVGLAAATIGLTAGLYALQYRSYYAEWHAPAFTLEWGFQLVFTMAVAFYQFVVLGIRLYFPLGFVALFAASLWFARRQR
>NZ_CP033367.1|WP_027028681.1|4810485_4811223_+|DUF2259-domain-containing-protein
MRMLFLFAVSLAASLAAQFAASIGARAGDVAELEILGFTKDGGVFAFEEYGVQDGSGFPYANRYYIDTRNDSFLQGTPIRVRLDDENAKLDAARLQARQKGEAIVSQAELSANRGITAGFNPVTELSADPHRIVVNPRPIFSPVDQPLEFRLDEIGMNNTEGCESQGEINGFRLLRIEAQDGGATKLLHEDKSIPKSRGCPNGYRIGAVQTFSMDSLSAYAVLIAVRLYGFEGPDYRWIAVTGRL
>NZ_CP033367.1|WP_027028682.1|4810097_4810352_-|DUF2171-domain-containing-protein
MTDTSKIREHMEVVGADGVHVGTVDKVDGERIKLTKADSGEGAHKGHHHYIPLALVAEVDGKKVWLSANSDVAVTFEEEKSDPV
>NZ_CP033367.1|WP_027028683.1|4809062_4810085_+|P1-family-peptidase
MFRTGPRNLITDVAGLRVGNASDARLKSGVTSVLCDQPAVAGVQILGGAPGTRETDLLEPHNSVEAVHAVVLSGGSAFGLDAASGVQAALRERGIGLEVGGFRVPIVPTAILFDLRNGGDKDWGRYPPYRDLGYEAVQDAGLDFQLGTIGAGTGALTSGLVGGLGSASTLLDSGVTIGALAAVNPTGSVTVGRTRHFWAAPFEIGDEFGGLGYPSPMPDDAKRILLKYRDKRVAAKTETGGNTTIAVIATDAVLTKAAAKRLAISAHDGFVRAIWPTHTPADGDLVFALATGTSGIELTADAAIDLYAAAGATMARAISRGVFAATPADNDLFPVWSSRR
>NZ_CP033367.1|WP_027028684.1|4807992_4809063_+|ABC-transporter-substrate-binding-protein
MRPGTRTITALFWLFAAGGAHAETLLVGVAAPLSGPSAILGKQIELGTGLAAQANGIELKTVDDACTADGGAAAARDFAAAKVNVVVGFLCTDAIEAAMPILKDANIPVITVGVRTESLTDRRAKTGWPVYRLGPRGDDERNAVAASLTRLWQNELFAIIDDGTIYGREMAETFRAAAEQAALKPVFVDTFRPQLDNQIGLVGRLKKAGATHVFAGGDGDDIAIMGRDAAQLQAGIVFAGGENLRTPPGDVPYALGTLMIAPPEWADIADPKVLESFSAQKIAPDGYTLPAYAAIEIAKAAALSESSGKPLTEALTGQDFSTAIGPVRFDAKGDLSQSPYRVFRFDGTRFVPAESN
>NZ_CP033367.1|WP_027028674.1|4816222_4816543_-|DUF1476-domain-containing-protein
MSSMKDREEGFERKFAFDEELRFKASARRNKALGLWAAEKLGKSGADADAYAKEVVVSDIEEAGDHDVFRKIRRDFDAAGVEQSDHQIRRTMDELMAQAIEQIKNT
>NZ_CP033367.1|WP_027028673.1|4816820_4817615_+|phosphoribosylaminoimidazolesuccinocarboxamide-synthase
MKNRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVIDGKGVLNNRISEYIFNHLNRMGIPTHFIRRLNMREQLIKEVEIIPLEVVVRNVAAGSLSKRLGIEEGTVLPRSIIEFYYKADALDDPMVSEEHITAFGWASPQEIDDVMALAIRVNDFLSGLFMGVGIQLVDFKIECGRLFEGDMMRIVVADEISPDSCRLWDVATQDKLDKDRFRRDMGGLVEAYQEVARRLGIMNENEPPRPTGPVLVASTDGVKGKPH
>NZ_CP033367.1|WP_027028672.1|4817659_4817902_+|phosphoribosylformylglycinamidine-synthase-subunit-PurS
MIKARITVTLKNGVLDPQGKAIEHALSGLGFGGVGAVRQGKVFDVELAESDKAKAEADLKAMCDKLLANTVIENYSVTLG
>NZ_CP033367.1|WP_027028671.1|4818025_4819198_-|hypothetical-protein
MDSNKIKERENVRRSMWVSATIIASLCAFAFMLMWDVNPSTGTLFSTWLSLDTDLGACAVSFTRLLLATAIISVGLGVISAGLVVSDLIDVFSYKRDFRVYRRLFLAGAVLTVLLLVPLISKNGGWYAGGRHGMSRIDLANACVASHYTTFYRLYWQLLIVVILGWASMMVLTILRRAIIDGRDPGELSDDPRVRKIQLQALKWSQRRMAVGRFVFRLMATILAAALFFMGAWSIKPAVVRFIHTFTWERQEANVVETGMQCVLEIKVRRSWVEQSRTDCSPEVEPVPSTPAPGAGAWRITKIPTAKLAYRAPDGGQYSFDVEGDFYVNFPTSVGARIEVLRNPASFEGIDKIFDGGDVKRMFYKLLMIIAGAVAIYYLWVRKPQNLRAI
>NZ_CP033367.1|WP_027028670.1|4819482_4820034_+|RNA-2'-phosphotransferase
MPNDTQVSKFMSLVLRHAPQEAGLSLDENGWADFDALCAVIRTKFGASAADVLRIVEENPKKRFAVDGNRIRAVQGHSVDVDLGLPPSVPPDLLYHGTKEEFLPSILREGLTSQSRQHVHLSKDVETALIVARRRAGKSAILQIDSASMTKDGVSFFLSDNGVWLTNHVSPRYLTQMLERELP
>NZ_CP033367.1|WP_027028669.1|4820030_4820699_+|phosphoribosylformylglycinamidine-synthase-subunit-PurQ
MKSAVVLLPGLNRDRDMIAALTKISGKPPVTVWQTDTEIPDVDLIAIPGGFSFGDYLRCGAIAARMPVMRAVAEKAAKGVTVIGVCNGFQILVEAGLLPGALMRNTSLKFVCRQVKLEITNANTMFTRRYQPGQIIRTPVAHHDGNYFADADTLARLEGEGQVVFRYAEGTNPNGSINDIAGIINEQGNVLGLMPHPENLIEAAHGGSDGRGLFESALGIAA
>NZ_CP033367.1|WP_027028668.1|4820768_4821434_+|glutathione-S-transferase-family-protein
MKLYSRPLSPYSSIVRALAYIKDVPLKIIAPPPGFPIPEEFRAISPMNRIPVLITGSGETIVESVVIAEYLEERFPEPALLPPDSKDRALVRMFARITDLDVLTPTMKLFELHFVQKRNNAEIDAQFARLHHGLAAIEARMAQGPFALGDDISFADAWLTPTRFIFNNFRAMTGHHDLLAAYPKFDAYEQIASQHPALSRVWGEMTDGQKIFLSELEMGAA
>NZ_CP033367.1|WP_027028667.1|4821430_4821838_+|hypothetical-protein
MIKVKTIALVAATGFALASCQSTPKSTPVPSGKSASLLAMEQVAISAHKCWIASKDPAFKQYQMANELNSFSGTPRFLLVPAKQYGGKPLLVVQAQGNSNRVDAFGPLMNDPIGARISSDIARWQAGNPACAATA
>NZ_CP033367.1|WP_027028666.1|4821840_4822482_+|Pr6Pr-family-membrane-protein
MGRFLQVAGLVIGLAGLVLQFCITIPASMEAGRSLLGSIVFYFSFFTILTNISAVLIYTSLLSSSFYAWLPAFAGPRMRGGVAVSITLVFIVYATVLARLWQPQGLFLLCDVLLHYVTPVLFVLWWLVAGADGRTRLRDVSWWVLYPIAYLVYALARAPFAGEVPYPFLDVAKNGATSVALAALSITALFLVICVVAVFIDRGIGHRGAKRVR
>NZ_CP033367.1|WP_027028665.1|4822512_4822764_-|DUF1127-domain-containing-protein
MDTIATISHSRAALPSQTRRPSGRPGFVSRLVWVVISLAKWIDHLLDRRRSRLALLEMTDDQLKDIGLSRCDAHREGVRPFWE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP033367_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP033367_7

4865501-4865589

Orphan

Consensus_repeat	Method
CGCAAAACCGGATTCCACTTTTGCTAATCGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP033367_7

>merge|NZ_CP033367|7|4865501-4865589|CRISPRCasFinder
CGCAAAACCGGATTCCACTTTTGCTAATCGCGGGCTCTTGGTTGGCGCGCGATCCAGCGCAAAACCGGATTCCACTTTTGCTGATCGCG

>NZ_CP033367|7|7|4865501-4865589|CRISPRCasFinder
CGCAAAACCGGATTCCACTTTTGCTAATCGCG	GGCTCTTGGTTGGCGCGCGATCCAG
CGCAAAACCGGATTCCACTTTTGCTGATCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP033367.1\|WP_027028627.1\|4862539_4864189_-\|glycosyltransferase-family-39-protein	unknown	unknown	gnl\|CDD\|224720
NZ_CP033367.1\|WP_027028626.1\|4864228_4864564_-\|lipid-A-disaccharide-synthase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|226461
NZ_CP033367.1\|WP_027028625.1\|4864556_4865291_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133022
NZ_CP033367.1\|WP_027028617.1\|4876928_4878371_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_CP033367.1\|WP_080680698.1\|4860049_4861030_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176163
NZ_CP033367.1\|WP_032925322.1\|4872941_4874084_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|227940
NZ_CP033367.1\|WP_027028619.1\|4874080_4875076_-\|sterol-desaturase-family-protein	unknown	unknown	gnl\|CDD\|225546
NZ_CP033367.1\|WP_027028621.1\|4872452_4872920_+\|peroxiredoxin	unknown	unknown	gnl\|CDD\|224146
NZ_CP033367.1\|WP_051429556.1\|4867025_4868768_-\|restriction-endonuclease	unknown	unknown	gnl\|CDD\|377369
NZ_CP033367.1\|WP_027028628.1\|4861693_4862509_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239483
NZ_CP033367.1\|WP_023669128.1\|4858243_4858918_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225496
NZ_CP033367.1\|WP_027028630.1\|4859078_4859933_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|180446
NZ_CP033367.1\|WP_027028629.1\|4861022_4861673_+\|FMN-binding-negative-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225366
NZ_CP033367.1\|WP_027028632.1\|4855122_4856640_-\|Fe-S-cluster-assembly-protein-SufB	unknown	unknown	gnl\|CDD\|236990
NZ_CP033367.1\|WP_027028622.1\|4868976_4872357_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372485
NZ_CP033367.1\|WP_027028624.1\|4865658_4866912_+\|tyrosine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235645
NZ_CP033367.1\|WP_027028618.1\|4875381_4876686_+\|M23-family-metallopeptidase	unknown	unknown	gnl\|CDD\|366703
NZ_CP033367.1\|WP_027028615.1\|4879110_4879548_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|366361
NZ_CP033367.1\|WP_027028616.1\|4878367_4879108_+\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NZ_CP033367.1\|WP_032925323.1\|4856825_4858004_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|224029

Protein	Function_ID	Function_description	E-value
NZ_CP033367.1\|WP_027028627.1\|4862539_4864189_-\|glycosyltransferase-family-39-protein	gnl\|CDD\|224720	COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane].	1.11036e-74
NZ_CP033367.1\|WP_027028626.1\|4864228_4864564_-\|lipid-A-disaccharide-synthase-N-terminal-domain-containing-protein	gnl\|CDD\|226461	COG3952, COG3952, Predicted membrane protein [Function unknown].	4.8167e-47
NZ_CP033367.1\|WP_027028625.1\|4864556_4865291_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133022	cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.	6.16326e-47
NZ_CP033367.1\|WP_027028617.1\|4876928_4878371_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	1.0731e-104
NZ_CP033367.1\|WP_080680698.1\|4860049_4861030_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176163	cd08474, PBP2_CrgA_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 5. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.6986e-107
NZ_CP033367.1\|WP_032925322.1\|4872941_4874084_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|227940	COG5653, COG5653, Protein involved in cellulose biosynthesis (CelD) [Cell envelope biogenesis, outer membrane].	1.01302e-117
NZ_CP033367.1\|WP_027028619.1\|4874080_4875076_-\|sterol-desaturase-family-protein	gnl\|CDD\|225546	COG3000, ERG3, Sterol desaturase [Lipid metabolism].	1.52727e-44
NZ_CP033367.1\|WP_027028621.1\|4872452_4872920_+\|peroxiredoxin	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	1.25581e-78
NZ_CP033367.1\|WP_051429556.1\|4867025_4868768_-\|restriction-endonuclease	gnl\|CDD\|377369	pfam04471, Mrr_cat, Restriction endonuclease. Prokaryotic family found in type II restriction enzymes containing the hallmark (D/E)-(D/E)XK active site. Presence of catalytic residues implicates this region in the enzymatic cleavage of DNA.	4.9045e-37
NZ_CP033367.1\|WP_027028628.1\|4861693_4862509_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239483	cd03389, PAP2_lipid_A_1_phosphatase, PAP2_like proteins, Lipid A 1-phosphatase subfamily. Lipid A 1-phosphatase, or LpxE from Francisella novicida selectively dephosphorylates lipid A at the 1-position. Lipid A is the membrane-anchor component of lipopolysaccharides (LPS), the major constituents of the outer membrane in many gram-negative bacteria.	1.58175e-62
NZ_CP033367.1\|WP_023669128.1\|4858243_4858918_+\|alpha/beta-hydrolase	gnl\|CDD\|225496	COG2945, COG2945, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	2.33755e-120
NZ_CP033367.1\|WP_027028630.1\|4859078_4859933_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|180446	PRK06180, PRK06180, short chain dehydrogenase; Provisional.	1.74525e-100
NZ_CP033367.1\|WP_027028629.1\|4861022_4861673_+\|FMN-binding-negative-transcriptional-regulator	gnl\|CDD\|225366	COG2808, PaiB, Transcriptional regulator [Transcription].	2.0485e-102
NZ_CP033367.1\|WP_027028632.1\|4855122_4856640_-\|Fe-S-cluster-assembly-protein-SufB	gnl\|CDD\|236990	PRK11814, PRK11814, cysteine desulfurase activator complex subunit SufB; Provisional.	0
NZ_CP033367.1\|WP_027028622.1\|4868976_4872357_-\|hypothetical-protein	gnl\|CDD\|372485	pfam13116, DUF3971, Protein of unknown function. Some members of this family are related to the AsmA family proteins.	0.00111792
NZ_CP033367.1\|WP_027028624.1\|4865658_4866912_+\|tyrosine--tRNA-ligase	gnl\|CDD\|235645	PRK05912, PRK05912, tyrosyl-tRNA synthetase; Validated.	0
NZ_CP033367.1\|WP_027028618.1\|4875381_4876686_+\|M23-family-metallopeptidase	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	3.50818e-44
NZ_CP033367.1\|WP_027028615.1\|4879110_4879548_+\|VOC-family-protein	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	7.30907e-14
NZ_CP033367.1\|WP_027028616.1\|4878367_4879108_+\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	5.75915e-60
NZ_CP033367.1\|WP_032925323.1\|4856825_4858004_-\|cysteine-desulfurase	gnl\|CDD\|224029	COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism].	2.54047e-147

>NZ_CP033367.1|WP_027028625.1|4864556_4865291_-|glycosyltransferase-family-2-protein
MPDALISIVIPCRNEAANLPLLIDEIEAAMTGRDFELIIVNDGSTDETATVLAEQTALRPFPVRELRHQKSAGQSLSVRSGAWAARGSIVATIDGDGQNDPQYIPVLVDALRQAGPDFGAAQGQRLKRRDSKVKQLASRFANWLRNAILHDETRDTGCGLKAVHTDILRKLPFFDGTHRFVPALVIQEGYRVVHCDVVDRSRRHGKSNYGIFDRGLQGALDLGGVWWLRRRRRRMPKVEEISRG
>NZ_CP033367.1|WP_027028626.1|4864228_4864564_-|lipid-A-disaccharide-synthase-N-terminal-domain-containing-protein
MVNVLQELGTWLHQVFVKQFDAWILLGFIAQFFFTMRFVVQWLASEKAKRSVVPVAFWFFSLFGGGLLLIYAIVRQDPVFIAGQAMGMFIYVRNLWLIANERKAAAMTKVD
>NZ_CP033367.1|WP_027028627.1|4862539_4864189_-|glycosyltransferase-family-39-protein
MALNRNYILLFLFSLVMTVSGLASLPPIDRDESRFVQATKQMAESGDYVDIRFQDASRYQKPVGIYWLQSAAVKLSGQGAEAPIWVYRTISALGIAIAVLAIAWTGTNLFGANAGIAAGLVMAAIFATAFEGRDAKTDAMLLACCVAAQGALAQIYLASRRNGPVAGHLWWIFWIAQGAAILIKGPIAPLLSALTIAVLFAFERDGRWLSKLRIGRGLLLVVIIALPWLAAITWKSHGAFLQQAVGKDMLGKVASGEESHGLPPGFYMLTYSLFMWPFGLIAVGAGLQALNRMRDDVRLRFCLAWYIPFWLVFELIPTKLPHYVLPAYPGMALLIGWMLTLQPEDANAPLKRWQQWLWWSTAFGLVVVSLGLAAVCIGAPIYITHTFSWWSIPAAAAALGTGYFAFSRQLQVPLPRIGATAACAGITYALLFGVIAPSLKPIWLSPAIKAAVLANKPCDTTVLASSQYQEPSLVFLVGTKTVLTNIGGVAEHLLADPACALGLAPVGDEQKLNGMLSVRGKSVKRLAEIDGLNYSSGDKMSLGLYRVAP
>NZ_CP033367.1|WP_027028628.1|4861693_4862509_-|phosphatase-PAP2-family-protein
MLVKSRPSVSSGVLGVGGRSLDNFRDTMQIVRRRFAVRPARYPNIAWPVWVAVWLLLTAAAFVRLDTPAGVLHGQWSGARIAEFLTQFALGGWYLIPSALLLVAANLIDWRSLSRRSLMLVYNWTCLAFLVLSSVGLSGLLVNVLKYAIGRARPLYFQDFGVLALHPFAFDARFAGFPSGHATTMGAVFGVLLLLFPRRWYIALVVTACFASTRVFVGAHYPSDTVAGFGLGCAFALACGLVFARLGFIFRPTPSGLPVRKASFRLIAPAG
>NZ_CP033367.1|WP_027028629.1|4861022_4861673_+|FMN-binding-negative-transcriptional-regulator
MYEPPHFKETRADVLHGLIRAYPLGMLISNGPDGPEANAIPFLLDAAVSANGRLRAHMAKANPQWKLIAENPSSPVLVVFQGTDAYVTPSWYETKRETGKVVPTWNYAIVQVRGTAKVIDDQDWLAQQIADLTASQEGPRAAPWAVTDAPAPFIQSQIKGIIGLEIEISEIHGKWKVSQNRPVADRAGVAQGLESETANSSDMVRLVRSYGGLDGN
>NZ_CP033367.1|WP_080680698.1|4860049_4861030_+|LysR-family-transcriptional-regulator
MARVEPNDLSVFLTIARHRSIRKAADEMGVTPSALSHALRGLEEDLGVRLFNRTTRSVAPTEAGERLHARIAPAFRDIDDALEDLNSFRDMPTGTLRINASRASAEIILLPIVTRFLAAYPGVNVDIVANNAFVDMVSQGFDAGVRFGEVIAQDMIAVPLGPPQRTAYVASPDFFRRYLKPTTPDELKGLPCIRFRFESGRYYAWEFERDNVELSVEVNGRLTLGEQDLAVQAALDGAGIAFAFEAQVKDFIEQGRLERVLEDWCPHYPGFYLYYPSRRQLPAALRAFVDFARGSISRGNDEIGAPMVRSSGNQHSTTANQEIDDV
>NZ_CP033367.1|WP_027028630.1|4859078_4859933_-|SDR-family-NAD(P)-dependent-oxidoreductase
MKVWFITGASRGFGALVAERALANGDAVVATARDSQKIVERFGDRSNLLPVTLDVTDETQARAAADAAVRKFGRIDVLLNNAGYGLLGAVEEASAEEIEALYRTNVFGLLAVTRAVLPHMRRERAGHIINISSVGGISSFSGWGVYGSTKFAVEGLSEALSMELAPLRIHVTVVEPGFFRTDFLDASSLVTSTNRIADYHETSGAMRQTAIDANHNQPGNPDKLAKVIVDIGNLAEPPFRLPLGSDTVTRSERRITDAQAMLKQWRDVAVSTDFEPMGAAAWAG
>NZ_CP033367.1|WP_023669128.1|4858243_4858918_+|alpha/beta-hydrolase
MPEVIFTGPAGRLEGRYQPSKEKSAPIAIVLHPHPQFGGTMNNKIVYDLFYMFQKRDFTTLRFNFRGIGRSQGEFDHGTGELSDAAAALDWVQSLHPDSKSCWVAGYSFGSWIGMQLLMRRPEIEGFISIAPQPNTYDFSFLAPCPSSGLIIHGDADKVAPPKDVQGLVDKLHTQKGITITQKTLPGANHFFANDADLLLEECADYLDRRLAGELSDPRPKRLR
>NZ_CP033367.1|WP_032925323.1|4856825_4858004_-|cysteine-desulfurase
MAAKRAYLDYNASAPLLAAAREAMVAALDVTANPSSVHAEGRAARRLIETARREVAALVNARPEHVVFTSGATEAASTLLSPDWQMGRGSVRMSRLYVSEADHPCLLNGGRFPAAQVTRIGVDTNGIADLAALAAALGAHDKADGLPLVAIHAANNETGVLQPIARIAEIVKAAGGILVVDAVQAAGRVSIDLSAGYADYLILSSHKIGGPKGVGAIVAAADLMMPKPLVNGGGQEKGHRGGTENLAAIAGFGAAAREALNGLQTMDAVRHGRDEIDATLKMMMPEVEIFGTGAPRLANTTFFAIPGIKAETAQIAFDLAGVALSAGSACSSGKVGPSHVLKAMGYGDSLGALRVSIGPATGAEDIELFRTALAGIAARQAARAKADREEAA
>NZ_CP033367.1|WP_027028632.1|4855122_4856640_-|Fe-S-cluster-assembly-protein-SufB
MPAVQDTIDRVRKIDVDQYKYGFETEIAVDKAPKGLSEDIIRFISAKKDEPSWMLEWRLEAYRRWLTLEEPTWARVHYPKIDFQDIYFYAAPKSTPGPSSLSDVDPELLKVYEKLGIPLREQEILAGVQKTDASDLEEPSDNVYKSGRVAVDAVFDSVSVVTTFKKELAQAGVIFCSISEAIREHPELVKKYLGSVVPTSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRMNEKNTGQFERTLIIAEEGAYVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDAEGKGGIYNFVTKRGDCRGDRSKISWTQVETGSAITWKYPSCILRGDDSQGEFYSIAVSNGYQQVDSGTKMIHLGKNTSSRIISKGIAAGFSQNTYRGQVSAHRKATNARNFTNCDSLLIGDQCGAHTVPYMEAKNSTAQFEHEATTSKISEDQKFYVMQRGIPEEQAIALIVNGFVKDVIQQLPMEFAVEAQKLIGISLEGSVG
>NZ_CP033367.1|WP_027028624.1|4865658_4866912_+|tyrosine--tRNA-ligase
MPAFKSDFLRTMSERGFIHQISDETGLDQLFAKETVTAYVGYDATATSLHIGNLISATMLYWLQETGHRPIALMGGGTSMIGDPSFRDDQRSLLTPEAIATNIEGIKRIFGRILRFGDGPSDAVMVNNADWLMKLNYVEFLRDVGRHFSVNRMLTFDSVKLRLDREQSLSFLEFNYMILQGYDFVELARRQNCRLQMGGSDQWGNIINGVDLGHRMGTPQLYALTTPLLTTSSGAKMGKSAKGAVWLNGDLFSPYDFWQYWRNTEDADVERFLKIFTRLPLDEIARLAALGGSEINEAKKVLATETTAIVHGRDAANQAEETARKTFEEGVTAESLPTVEIDGAALDAGVGILSLLVTAGLASSNGEARRHIQGGAVRINDQLVSDDRRMVTLQDLSPENVVKLSLGRKKHVLVRPA
>NZ_CP033367.1|WP_051429556.1|4867025_4868768_-|restriction-endonuclease
MVQEANVTWRSKYRSAIESGELTAKFSADGSRILRWYIDFRHKLLHVHKELSAPELFMLQHKIDALMEQWDERADQQHQKLKVFASKSQAEKDTLDATIRLERLHQILNHTLTVNDRVDWNALKDHSTYDGATKFQRAIPQRVKRPEPHLTPPEISFFDKLFGKAKHRQADAQARFEQEKSDWLITEQKESRKLNQSIAQWTAEKAEFEAAGERQMREFLDRQAATNQRVDVLAANVAEGDPQAVIEHAMLVLDASKYDDLFEKSYAIEYASNSKTLMLEYQLPSPDKMPTVKSVRFIAATGELKDAHISEKEQKANYDSVCYQICLRTIHELLEADEYDNLQRVLFNGISTFIDRTTGLDTTSCIMSILVNREDFLKIDLSRVDPKACFKNLKGVSASSLAALAPIPPVMVLNKEDRRFIDPRMIADTLDTAMNLASMDWEDFEHLVRELFEREFASRGGEVKVTQSSSDGGVDAVAFDPDPITGGKIVIQAKRYTRTVGVSAVRDLYGTMQHEGASRGLLITTADYGPDAHKFAAGKPITLLTGANLLHLLEKHGYSAKIDLREARKELNLRDYATRQ
>NZ_CP033367.1|WP_027028622.1|4868976_4872357_-|hypothetical-protein
MDQEQPQHEKIRFRRDEITDLGAFPSACRVPPLGQASIGRGFRILSRVFAGIVALLLLAAMAVYLIGLSGIGADRLRIEAEAAIEKLAGVDVHVAVGPARITLDSSSFVALQVSDVSLKTSDGKPMADAGRVRFGVRLVPLLWGEVRLTSARISDAHIVVAAMPSGGDWTAALRNEDGLVDPEKLSEAVFGNIHRALDAVREDSLRRIDLDNVEFVLPETGAIKLVTIANATVVQSGPGGMAFSSEADVDGRKVTVAASAARDVAAHRVTALNASIDLAAADETTADGGKLGAFALKLTGSEGSGTNGSRLTAVLSSTGSVLDLGARGLLPADVDVDATLVDGSNKIQVDRLLLKTGRSSFNFGGSIGPKPATGAAGEEPSYRYDLTSDGSTLAPSESPEPALTFLARIAGVYQPTSHKLVAEEIALRSDSSGEVMGTAAVEFVEGKAPGINVALNVHNMQVSHVKQLWPWFSARNARLWVLANLFGGRVVDANLQFHVVPDRLGNGVPLSADEVFGTFKIEGSRFDTAGRIPPIRDAVGMVAFHANDVDISLSSGTVFMPSGRTVAASNGTLTIKAANHPPVIGALDIDVDGDAAAVAELASYEPINAMRHVGFLPEDLSGSVTGHVRADIPLQSGVDTSKLDWLVSLDYTGLSLAKQFEGQSVTNADGSITVDPQKAVISAKASLNGIPAELDLVEPLADDGPARSRKVELVLDDKIRAAAMPGLTPLLGGTVKVAIDKSGDGNQNVSADLTNARLDIPWAGWTKGAGVPANVTFVMTKAGDTTTLSDFDLEGKTFSVGGSIVLVNGALSSAKFSKVTLNRGDDVSVSVKRSGKGYAVDISGNALDARSLVKQFTSDVDTATKTTGTDNISVSADVEQLTGFHDEQLSNLKLDYSAAGSRVNGLKVSATASSGAAITISNTTGDGRRSLNVQSADAGAILRFLNVYEHMEGGAITLALSGTSDGPMKGKVDTSNFFIVNEPKLASIVSTTPTGDSRSLNQAVKGNLDTSRVKFERGYAEIDKGSGYLKLANGVLRGPRIGTTFQGILYDQNNNMDMTGTFMPVYGLNRIFGELPIVGALLGNGRDRGLIGVTYRLRGNANKPVLDVNPLSVIAPGIFRSIFEYR
>NZ_CP033367.1|WP_027028621.1|4872452_4872920_+|peroxiredoxin
MADLDVGDPAPQFDLPRDGGESISLAASAGKPVVLYFYPQDDTTSCTQEAISFSQLKPEFEKAGAVVIGLSPDNAKKHDKFKSKYNLTIDLAADEERKVIEAYHLWVEKSMYGRKYMGVERATFLIGGDGRIARIWRKVRVKGHAEEVLEAVRAL
>NZ_CP033367.1|WP_032925322.1|4872941_4874084_-|GNAT-family-N-acetyltransferase
MNAPFVLAIPRTRTFEVVTSAARLAEIAPAWSALWQRAGGLVFQHPDWITAWWRTTPHQERRTLRIGLAWNGDRLDGVIALATFKRSGIRMLEWAAKDHSDYGDALVAPDSDPQAISRLWQHVFDQGGFDLIYLNRLLPDAGVHALLDPAARHGKALRPNHRSEISYRVAGPWQRGEEWFETLSKKGRQNYRRGRKFLEEGGALRFRLLDADEPREPVLARVAVLKRLWLVRHGRVSDLFDKGSPVLAALVSVLAELGLLRIFVLELDGAIIAVSINFEQHGTMMAFVTTYDPEYERASPGMVLMMDYIQWSLDRGLAKVDFLCGGEDFKRRFATQSVTLSSVMGARGLRGHLAAMADRANHVSKSWRARRQPKAETPDE
>NZ_CP033367.1|WP_027028619.1|4874080_4875076_-|sterol-desaturase-family-protein
MLGDLVGKILDKISGTSLLATGLLLLTALVSALVAYWRTVEQKNWKEFFEFVIPREVITHPSAKADLMFWVTKKALMPFLMLPAGIVFVTAVGYATNWLFSTLFQFQPPLIEAPAGPVTVLIFTITMLLAYDISYYLYHVAQHRYPVLWELHKVHHSAEVMVGITKDRVHPLDELMNRAWDGVVVGVCFGIWSLISLNLVELTVFGVNVYVMRNILMMDFVRHTHFKISFGPLNHVVLCPHWHQLHHSVDPLHYDKNFGLLFSFWDRLFGTLCVPKPDEDFKFGLVDRDVRDYQSLAGLYVMPLKRMWGHIARRIRPGKPRTSRPSEGTRP
>NZ_CP033367.1|WP_027028618.1|4875381_4876686_+|M23-family-metallopeptidase
MNATGQSAIFGRRKEPHTVIIARGNEIRHFTIRPWLAAFIGSAFAAIAIGYLLATSYLVLRDDLIGATTARQARMQQAYEDRISALRAQVDRITSRQLLDQQLMETKVSELIERQSQLSQRHGRLGPLLERAENEVGTAPTEDPAATAKPDKHADVTGSINQPAQNYAVASLSADLGAADTRPFSLWSTRSDPLPNDSAADRADKLFVSINQSLKSIENEQLTRINTLADNAYKSADAITQALQAAGLPVDSDFGKNESDVGGPLIPLDSSMIFDSKVKELDEALDTLDHLKKEARQLPLANPAPGHSVTSPFGVRTDPILGTAALHSGMDFRAPIGMDAKITAPGIVIKAGWNGGYGRMVEVDHGNGFSTRYGHLSEIDVTVGEKLDAGAIIGKTGSSGRSTGPHLHYEVRHNGEAIDPLRFLTVGKKVAQFL
>NZ_CP033367.1|WP_027028617.1|4876928_4878371_+|FAD-binding-oxidoreductase
MTIHRISSDVLTALEHLLGQGGVVADAADMAKYLVDWSGDHHGGALAVLKPASVAEVQAAVRLCGTLGQAMIPQGGNTGLVAGAIDIGTAAHGAVIISLERLNRIRVVDADNFTLQADAGCILQHVKDAAEDQDCLFPLALGAQGSCQIGGNAASNAGGVNVLRYGMVRDLIVGLEVVLPDGELWNGFSGLRKDNRGYDLKQLFIGAEGTLGIITGVEVKLFPKPGKVETAYLGLRSFEAAIALFRQARRGCSDLISAFEIIGAECMDLARLVDPNTVVPVTAPVHVLIELSSGAVVDLRTLLVDFLANAMENELVADAVLAESGAQARAFWAIREGLVEGQAKRGYHVRTDLSVRISDIPTLIARARDFVARDHPGWLSAAYGHAGDGNIHFSVLPPLGLAEPDARTRGAAITTGLYDITNALGGSISAEHGIGRTRSRVYWAGMSPVHRRLVGTLKDALDPNRLMNPGCLFPATETLS
>NZ_CP033367.1|WP_027028616.1|4878367_4879108_+|FadR-family-transcriptional-regulator
MKQRLAAIGTVEALPHRVAAFLSREIESGDLNPGSLLPTEQQLSEKFGVSRNVVREAIAQLRADGMVEARQGIGSFVLAPEQRASIRIDRETLKEGQNMERLFELRCILEAESAALAAERRDQEHLDAIKAALDRMSGEERWEDGSIDADLLFHREIARATGNSYIHTFISFVCEQIRRSIYYARQTNPLHDLVEVNVGEHVRIYEALVAGNPAEAEAAMRAHIIGAADRVGVKLPLRTQRTEEGK
>NZ_CP033367.1|WP_027028615.1|4879110_4879548_+|VOC-family-protein
MSLGTAYRISDVCLLVEDIGRTVEFYVNKLGFRLRRRAEGFADFHSEGVTLAAWEIDHIGQHAGVSKLRSPRHAHKVCVAVQLDAPGDIDRLHAELTAKGVPFYGPPENYVWNARCAYFTDPDDTLWELYAWLDGGPGDYHDEQP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP033367_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP033367_8

6456388-6456483

Orphan

Consensus_repeat	Method
GACGAGGCCACCTCCCCGGCTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP033367_8

>merge|NZ_CP033367|8|6456388-6456483|CRISPRCasFinder
GACGAGGCCACCTCCCCGGCTGCCGTGGCCGAAACGAGCGCGGCCGAGACTTCGGCCGACACCCCGAACCACGACGAGGCCACCTCCCCGGCTGCC

>NZ_CP033367|8|8|6456388-6456483|CRISPRCasFinder
GACGAGGCCACCTCCCCGGCTGCC	GTGGCCGAAACGAGCGCGGCCGAGACTTCGGCCGACACCCCGAACCAC
GACGAGGCCACCTCCCCGGCTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP033367.1\|WP_027033537.1\|6466817_6467915_-\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_CP033367.1\|WP_027033534.1\|6471035_6472325_+\|isocitrate-lyase	unknown	unknown	gnl\|CDD\|237893
NZ_CP033367.1\|WP_027033547.1\|6450683_6451127_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|284894
NZ_CP033367.1\|WP_027033551.1\|6447472_6447982_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
NZ_CP033367.1\|WP_027033536.1\|6468241_6469213_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP033367.1\|WP_027033544.1\|6454593_6455052_-\|phasin	unknown	unknown	gnl\|CDD\|227777
NZ_CP033367.1\|WP_027033545.1\|6453130_6454021_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP033367.1\|WP_027033550.1\|6448125_6449193_-\|alkene-reductase	unknown	unknown	gnl\|CDD\|239243
NZ_CP033367.1\|WP_027033548.1\|6449744_6450608_-\|NmrA/HSCARG-family-protein	unknown	unknown	gnl\|CDD\|187561
NZ_CP033367.1\|WP_051429775.1\|6451417_6452335_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP033367.1\|WP_027033549.1\|6449233_6449707_-\|DUF1857-family-protein	unknown	unknown	gnl\|CDD\|176872
NZ_CP033367.1\|WP_027033542.1\|6459701_6461663_-\|acetoacetate--CoA-ligase	unknown	unknown	gnl\|CDD\|235134
NZ_CP033367.1\|WP_027033541.1\|6461858_6463709_+\|AsmA-family-protein	unknown	unknown	gnl\|CDD\|225529
NZ_CP033367.1\|WP_027033535.1\|6469349_6470798_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|226322
NZ_CP033367.1\|WP_027033546.1\|6452341_6453010_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187555
NZ_CP033367.1\|WP_027033540.1\|6463801_6464620_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182574
NZ_CP033367.1\|WP_006202762.1\|6472383_6472626_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033367.1\|WP_027033539.1\|6464616_6465585_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182646
NZ_CP033367.1\|WP_167334895.1\|6447246_6447399_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369906
NZ_CP033367.1\|WP_027033538.1\|6465594_6466734_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361

Protein	Function_ID	Function_description	E-value
NZ_CP033367.1\|WP_027033537.1\|6466817_6467915_-\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
NZ_CP033367.1\|WP_027033534.1\|6471035_6472325_+\|isocitrate-lyase	gnl\|CDD\|237893	PRK15063, PRK15063, isocitrate lyase; Provisional.	0
NZ_CP033367.1\|WP_027033547.1\|6450683_6451127_-\|hypothetical-protein	gnl\|CDD\|284894	pfam07568, HisKA_2, Histidine kinase. This is the dimerization and phosphoacceptor domain of a sub-family of histidine kinases. It shares sequence similarity with pfam00512 and pfam07536. It is usually found adjacent to a C-terminal ATPase domain (pfam02518). This domain is found in a wide range of Bacteria and also several Archaea.	3.11709e-16
NZ_CP033367.1\|WP_027033551.1\|6447472_6447982_-\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	8.393e-14
NZ_CP033367.1\|WP_027033536.1\|6468241_6469213_-\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.27734e-13
NZ_CP033367.1\|WP_027033544.1\|6454593_6455052_-\|phasin	gnl\|CDD\|227777	COG5490, COG5490, Uncharacterized conserved protein [Function unknown].	2.02547e-38
NZ_CP033367.1\|WP_027033545.1\|6453130_6454021_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.58702e-43
NZ_CP033367.1\|WP_027033550.1\|6448125_6449193_-\|alkene-reductase	gnl\|CDD\|239243	cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.	1.59763e-168
NZ_CP033367.1\|WP_027033548.1\|6449744_6450608_-\|NmrA/HSCARG-family-protein	gnl\|CDD\|187561	cd05251, NmrA_like_SDR_a, NmrA (a transcriptional regulator) and HSCARG (an NADPH sensor) like proteins, atypical (a) SDRs. NmrA and HSCARG like proteins. NmrA is a negative transcriptional regulator of various fungi, involved in the post-translational modulation of the GATA-type transcription factor AreA. NmrA lacks the canonical GXXGXXG NAD-binding motif and has altered residues at the catalytic triad, including a Met instead of the critical Tyr residue. NmrA may bind nucleotides but appears to lack any dehydrogenase activity. HSCARG has been identified as a putative NADP-sensing molecule, and redistributes and restructures in response to NADPH/NADP ratios. Like NmrA, it lacks most of the active site residues of the SDR family, but has an NAD(P)-binding motif similar to the extended SDR family, GXXGXXG. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Atypical SDRs are distinct from classical SDRs. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.90439e-58
NZ_CP033367.1\|WP_051429775.1\|6451417_6452335_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.87893e-63
NZ_CP033367.1\|WP_027033549.1\|6449233_6449707_-\|DUF1857-family-protein	gnl\|CDD\|176872	cd08863, SRPBCC_DUF1857, DUF1857, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily. Uncharacterized family of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	8.25149e-40
NZ_CP033367.1\|WP_027033542.1\|6459701_6461663_-\|acetoacetate--CoA-ligase	gnl\|CDD\|235134	PRK03584, PRK03584, acetoacetate--CoA ligase.	0
NZ_CP033367.1\|WP_027033541.1\|6461858_6463709_+\|AsmA-family-protein	gnl\|CDD\|225529	COG2982, AsmA, Uncharacterized protein involved in outer membrane biogenesis [Cell envelope biogenesis, outer membrane].	7.18117e-127
NZ_CP033367.1\|WP_027033535.1\|6469349_6470798_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|226322	COG3800, COG3800, Predicted transcriptional regulator [General function prediction only].	5.70387e-177
NZ_CP033367.1\|WP_027033546.1\|6452341_6453010_-\|SDR-family-oxidoreductase	gnl\|CDD\|187555	cd05244, BVR-B_like_SDR_a, biliverdin IX beta reductase (BVR-B, aka flavin reductase)-like proteins; atypical (a) SDRs. Human BVR-B catalyzes pyridine nucleotide-dependent production of bilirubin-IX beta during fetal development; in the adult BVR-B has flavin and ferric reductase activities. Human BVR-B catalyzes the reduction of FMN, FAD, and riboflavin. Recognition of flavin occurs mostly by hydrophobic interactions, accounting for the broad substrate specificity. Atypical SDRs are distinct from classical SDRs. BVR-B does not share the key catalytic triad, or conserved tyrosine typical of SDRs. The glycine-rich NADP-binding motif of BVR-B is GXXGXXG, which is similar but not identical to the pattern seen in extended SDRs. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.51523e-69
NZ_CP033367.1\|WP_027033540.1\|6463801_6464620_-\|ABC-transporter-permease-subunit	gnl\|CDD\|182574	PRK10592, PRK10592, putrescine transporter subunit: membrane component of ABC superfamily; Provisional.	2.38285e-100
NZ_CP033367.1\|WP_027033539.1\|6464616_6465585_-\|ABC-transporter-permease-subunit	gnl\|CDD\|182646	PRK10683, PRK10683, putrescine transporter subunit: membrane component of ABC superfamily; Provisional.	3.0404e-123
NZ_CP033367.1\|WP_167334895.1\|6447246_6447399_+\|hypothetical-protein	gnl\|CDD\|369906	pfam08501, Shikimate_dh_N, Shikimate dehydrogenase substrate binding domain. This domain is the substrate binding domain of shikimate dehydrogenase.	1.05238e-05
NZ_CP033367.1\|WP_027033538.1\|6465594_6466734_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	1.47245e-175

>NZ_CP033367.1|WP_027033544.1|6454593_6455052_-|phasin
MSRTKTAETIENVEFPSFDASKATDQMRAFAEKGVEQSKEAYAKLKTGAEETQKALESTYETAKTVSSDLSLKTIAALRTNAEAGFSHLEALIGAKSLSEVVELQTSFLRKRIESTVEQAKDFQAVASKAAEDVTKPIKTAFEKAVKDIKAA
>NZ_CP033367.1|WP_027033545.1|6453130_6454021_+|LysR-family-transcriptional-regulator
MDLLALADFVLVARHGGFGRAARAATRPKATLSRRVAELEAGLGLRLVERGARALKLTEEGRALYERAGHLLTELDETAATIASGGQRPRGKLRISAPLLFSQTAMGKIAAGFALKYPEVRLEVSTDDRAVDMIEEGFDLVIRVNPNPDETLVGRAFLHDRLVVAASPGLARPTANMTVPAVVRSAGDRLTWQVMTATGPTSIMIEPVLALTSLVMVRDAVRAGVGAGRLPLSLVSHDLADGTLVEWGEVDGPDIVLWTLYPSKRLLSARVSAFLNYLKEAFPMGTPDELAAYIGK
>NZ_CP033367.1|WP_027033546.1|6452341_6453010_-|SDR-family-oxidoreductase
MTKSTNDNPHAAQTKILVLGATGPTGRLIVSQALARGYEVTALVRSPEKAADMKGVRLVVGDARDEKTLRQAVTGQDAVISALGTPASPFKQVTLLSTATRALVKAMKTEHFSRLITITGMGAGDSAGHGGFLFDKVIFPLLLRNVYADKNRQEAVIRESDLDWTIIRPSVLNKKAGRGNVRTLTDLSAFHGGTISREDVAKFVLDQVDSDAWRHRSPLITW
>NZ_CP033367.1|WP_051429775.1|6451417_6452335_+|LysR-family-transcriptional-regulator
MIDVDDMRAFQTVARLLSFSGAGRVLSVRKSAISRSIQRLEALLGVRLFERTTREVVLTEAGRALLGHFSEIVTRVDEVLDMATSLASHPRGRLRLTAGIGFGMEVLTEILPVFSLAFSDVDVSLELTSRTVDLVAEQTDVAFRMGPMLDSNLVATRLGAIACLLCAAPSYLERRGWPRSIDDLRSHDLLLIPRGDGLPRRLSLCDKDGVEHQVEATARLTANDPKAIDRMVLNGAGIAATARYVAAPEIEAGNLVRVLPDWSVPAVDVSLVMPAGKERSPAARAFVDFMRKRVAGNRRWFDDGA
>NZ_CP033367.1|WP_027033547.1|6450683_6451127_-|hypothetical-protein
MSAYTAAGRIAELAVVLEAKILLLLQLDHRVKNDLTLITALLRFQARTVENPAISAKLETMLERVDAVATVHRRTSQSHDMRRFDVSAFAGDLVIDVIGISGRTDVTPVAIFPANSCHPGSRIRCTRRCRLIAPTKASIVPPVRRCV
>NZ_CP033367.1|WP_027033548.1|6449744_6450608_-|NmrA/HSCARG-family-protein
MTILVTGATGNVGRNVVEQLVNRGADVRVLVRDPSKANFPAGVEVAQGDLLDVDALRSAFSGVSTLFLLNGVVADEYTQALVALAVAREVGIERIVYLSVIHSDVYVNVPHFAGKFGVERMIEQMGLNATILRPAYFMDNDITIKDVITGYGIYPMPIGSKGLAMIDARDVGEIAAIELIRREQSSTPLPLNRINLVGPDTLTGADAAAIWTDVLGRPIAYPGNDTAGFEQNLRQFMPSWMALDMRLMAERFLTDGMVPDAGDVDRLTTLLGRPLRSYRDYAAQIAA
>NZ_CP033367.1|WP_027033549.1|6449233_6449707_-|DUF1857-family-protein
MIYSTATVPVNPAGETKLTREQVWKGLELKARDARLFLPPGVCTRCDVVEESATHFVREATIAGADLREIITLEPQSKITFFQAIGPREGAIINELFEDDAGELQLKFYCYTGLRGKEPNGPEEQAEQTQFDSEKGYKSALLSTLTRTRELLAAGRL
>NZ_CP033367.1|WP_027033550.1|6448125_6449193_-|alkene-reductase
MTYVWSTFKLGNLQLPHRLAMAPMTRSRAKPDGTPGDLAPEYYAQRATMGLLITEGTQPSEDGQGYLATPGIYNDNHVAGWRKVADAVHETGGRLFIQLMHVGRRSHPENTPHHRQPVAPSAIASGENMFTVKGMLPVPEPRELTTAEVRQTIADFANAAKRAIEAGADGVEVHGANGYLVHQFLAPNANKRTDEFGGSLENRARFAIEVVQAIVGAVGAEKTAIRLSPGLPTGGIAEGNENDDLYRYLAAEFHKIGVAYLHILHIGNEALLADIREAFGGVLIVNRPGRPREQVGADVAAGVADMEALGAMALANPDLVTRLKEGAPLNEPRPALFYAGGGAEGYIDYPALYPA
>NZ_CP033367.1|WP_027033551.1|6447472_6447982_-|SRPBCC-family-protein
MTIHVETSRAAQLKVAVTREVFVANAIQEVFDFVAAEDVLPKILTGYGMVPGVASTSDVSGPWDRPGSHRIVQLTDGSTAHEGVTHYDRPFYFAYRVSDPSFALKHLMGEARGQFWFEPANGGTRVKWTYTFLAKNWLTKLPLTLFVKSQWRGYMDVCLANVVKHFAPA
>NZ_CP033367.1|WP_167334895.1|6447246_6447399_+|hypothetical-protein
MTDRLRHRRSARRTIRQIVEKGGNIVGIGITVPHKIAVIPHLDRVTQVAK
>NZ_CP033367.1|WP_027033542.1|6459701_6461663_-|acetoacetate--CoA-ligase
MAAEVPLWTPTQDQIDASPLTAFLKEAETKAGATFASYADLHRWSVEDREAFWSLVWDFCGIVGDKGGERLLADGDKMPGASFFPDATLNFAENLLEKTGSGDAIVFRGEDKIERRLSWNELRQLTSRFQQLFLSLKVKKGDRIAAMMPNMPETVAAMLATASIGAVWSSCSPDFGEQGVLDRFGQIEPVIFIAPDGYWYNGKAIEVADKITAVAAKLDTVRKVLIVDYLGSSRDVADIIDKAVALEEALSPFAAKPVGFERLPFSHPLYILFSSGTTGIPKCIVHSAGGTLIQHVKEHRLHAGLSEGDRFFYFTTCGWMMWNWLASGLASGATLLLYDGSPFYPDGNVLFDFADAEKMTFFGTSAKFIDSVRKAGLKPIRSHDLSTIRSISSTGSPLSPEDFRFVYEGIKKDVHLASVSGGTDIVSCFVLGVPTQAVWTGEIQGPGLGLAVDVWDDDGRPIRQEKGELVCTRAFPSMPIGFWNDPDGKKYQAAYFERFDNVWCHGDFAEWTDHGGMIIHGRSDATLNPGGVRIGTAEIYNQVEQMPEILEALCIGQDFDNDVRVVLFVRLAAGVQLDEDLEKRIRAKIRTGASPRHVPARIVAVADIPRTKSGKITELAVRDVVHGRAIKNKEALANPEALELFRNLPQLAE
>NZ_CP033367.1|WP_027033541.1|6461858_6463709_+|AsmA-family-protein
MPSSLIRRGVWAIGAAVIVIALVVAALPLIASTRIVRDRIAWEMSAWSGFRVAIDGSPRIEVWPKFRAILTDVTLSKWTDADAPPVVEAERVEIDLSAMAALQGDVAFSTARLVRPTIRVQRTVDGLFLPTAPTGGRIARSIDTARGVVSADPAKPDLDKLPADAFGTVEFRDGRMVASVDGKDVEILSSLNGQANWAAMNSNATLSATGIWRGESVALDAASPKPLVLFAGGMAPLTLSFKAAPATFSLDGMASMAENGYFDGQVKFAAPSLRRVLEWSQAGIAPSAAIGSVSISSKVTASAGRIKFENTALALDNNPGMGALDLSLGEAQPVISGTLAFDTLDLRSFLSAFTPLAPASGTGPEIEASFADRINLDLRLSAAHATAGPIQLADVAATAQVKDGLSVFDISDASAFGGNIQTSLRFDRKPEGTQVEIRLLASDVDGGAFGTAAGMTRLVPVGTGTVSVILKGPGRTWDSIFENADGSVSATFGPGALSKFNLPAFLKHSEQGGFFALDDVSDGTLPIDGAELKATISRGVARLDKAEANSAKTKIWLSGIASYAGRGLALSGGVIQPDQAAAQKTGQQGPNQSSFFVGGTWSTPFISPISRGVSGE
>NZ_CP033367.1|WP_027033540.1|6463801_6464620_-|ABC-transporter-permease-subunit
MNATWSRFNVTSIVLGFAFLYLPIVLLIVFSFNESKLVTVWGGFSTKWYVSLFHNQGLMDATWVTARVGVISATVATVLGTLAALTLTRYTRFRGRVLFSGMVFAPLVMPEVITGLSLLLLFVAVGLDRGFLTVTLAHITLTMCFVAVVVQSRLVSFDRSLEEAAMDLGATPVKTFFQITLPVILPAIVSGWMLAFTLSLDDLVIASFTSGPGATTLPMKIYSQVRLGVTPEINAACTILIAVVAVGVIIASIANKRREVQRQLDEQVAQRG
>NZ_CP033367.1|WP_027033539.1|6464616_6465585_-|ABC-transporter-permease-subunit
MSNIAVTDTAMPSTAAKPFLTRLGAGFVNRLVIIVPYVWLLFFFLIPFVIVFKISLSQTAIAMPPYTPVLDFRDGVSGFFAGFRNLNFDNYVWLTQDALYFKAYVTSVIIAAISTLLTLIVGYPIAYGMSRAPATIRPTLLMLVILPFWTSFLIRVYAWIGILKPEGLLNQLLLSLHIINQPLVILNTYTAIFIGIVYSYLPFMVLPLYSSLEKMDYSLIEAAKDLGCPPTSAFWKITFPLSVPGVIAGCLLVFIPAVGEFVIPDLLGGSSTLMIGKTLWNEFFANRDWPVSSAVAVILLLLLTVPIMLFQQAQAKAQEQDK
>NZ_CP033367.1|WP_027033538.1|6465594_6466734_-|ABC-transporter-ATP-binding-protein
MKSLGSIRRDFAPWNDPNAKPYIQFDNVTKKFGDFTAVNNLSLTIFEREFFALLGASGCGKSTLLRMLAGFEEPTAGRILLDGQDLRGIPPYRRPVNMMFQSYALFPHMTVEKNIAFGLKQEGMPGPDIEKRVAEMLKLVKLEQFAKRKPHQLSGGQRQRVALARSVAKRPKVLLLDEPLGALDKKLREETQFELMDLQQNLGLTFVVVTHDQEEAMTMADRIAIIDKGEVMQVATPAEVYEAPTSRFVAHFVGNVNMFEGKVAERAANTTRITGATGAQIVVENSAATAAGSDIVFAIRPEKIKVSSKKPADAVNALEGEVYDVAYLGDMTVYHIRLDDGQIIRASALNAARVTEDPLTWNDRAWVSFRPDAGVVLAR
>NZ_CP033367.1|WP_027033537.1|6466817_6467915_-|polyamine-ABC-transporter-substrate-binding-protein
MIRKALWLSATSVFLTLFTPAGHAEDRVVNVFNWSDYIDPTIIDDFTKKTGIKVVYDTFDSNEILETKLLAGGSGYDVVVPSGNFLARQIQAGVFQKLDKSKLPNLANMWDTVSQRTAKYDPGNEYSINYMWGTVGIGYNIKKVQAALGTDKIDSWDVFFNPESLAKLKDCGVYVLDSPADIIPAALKYVGLDPNSTSPDDIAKAEEAMMKVRPFIRKFHSSEYINALANGDICLAVGWSGDVFQARNRAVEAKQGVEIGYSVPKEGAQMWFDQMAIPADAPHVAEAHEFLNYMMTPEVIAKSSNAVLYANGNKASQQFVDKALLSDPAVYPDDATLQKLYTVSPYDPKTQRVVTRTWTKIVTGQ
>NZ_CP033367.1|WP_027033536.1|6468241_6469213_-|DMT-family-transporter
MTDAASSPVLVASPGHVTLTASPREERVGMLLVFLSALMWSFGGTIARFITLGDSWTVIFWRSIWAAAFLLSFMVWRDGWRGMLKSFRDMGLPGLAVGFCFAIASTAFVVALAYTTVANILLMQAGVPLLAALFSWALFRERVGAVTWVAIAAVIAGVAIMVSESLDGAVSPIGDGLALLIAFMFSIATVITRRFASVRMTPATCLGTILAAGFAASQASTFTVSASDMGFLFAFGVVNLGIGLAFFATGARLIPAAIAALLGTFEPILGPIWVWLIHSEVPSGRTIVGGAVVVTALLVHIGLEFKRQARPQRAGVTGVPSPN
>NZ_CP033367.1|WP_027033535.1|6469349_6470798_-|XRE-family-transcriptional-regulator
MADQKIFAGPRIRRIRNAKGLTQTAMAEGLGISPSYLNLIERNQRPLTVQLILKLASVYKVDPHELQGEARGSVAALKEVFTDPLLVGELPGDQELIELAEAAPNASAAVIKLFRAYREQAERLSDLNELLAREGRATALSGARLPIDEVHETFERRPNHFTALEEEAEAFTAVLDPGDDLFGALKAWLRREYGIVVKVLPVATMPNWRRRYDRHSQRLFLSERLSPFDQLREVAMEACLIRMTVAVAGEIQALRLTTDEARRLARFELGRYAAHALMMPYQAFHAAAIRARYDIDVLRSRFGVSFEQAANRLTMLQRQGAPGVPFFMLEVDNAGNRFRRAGSQGFPHSRFGGGCPKLPVHAAFSQPGQIFVEAVEMPDGAEFLCVARTLEGPQGAFSERPRRTALLLGCDIGFRDDIVYGAALPGVAAAGKSGPGIVAATPVGPACRLCERVGCLSRAEPPVTRPLGLDEMVTGLSAFDFQ
>NZ_CP033367.1|WP_027033534.1|6471035_6472325_+|isocitrate-lyase
MTDFYNLVPSAPEGRFDGIERPYSPEDVKRLRGSVQIRQSLAEMGANRLWKLIHEEDFVNALGAMSGNQAMQQVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAAPELVKRINRTLQRADQIETSEGNGLSVETWFAPIVADAEAGFGGPLNAFEIMKAFIEAGAAGVHYEDQLASEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMATPTLVVARTDAEAAKLLTSDIDERDQPFVDYDAGRTVEGFYQVRNGIEPCIARAVAYAPYADLIWCETSKPDLAQAKKFAEGVRRHHPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNYGMFELARGYKARQMAAYSELQEAEFAAEANGYTATKHQREVGTGYFDAVSMAITGGKSSTTAMHESTEHAQFKPAAE
>NZ_CP033367.1|WP_006202762.1|6472383_6472626_+|hypothetical-protein
MASISRVKERAEEQSTTMSVDQQATIRMLANDLHRLNQSVMKAVEAGVSVELVRSARHHGGDGNWGDLLIPVIVTQQSHG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP051681	Cohnella sp. MFER-1 plasmid unnamed1	3651-3682	7	0.781
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	758931-758962	7	0.781
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP013929	Alteromonas mediterranea strain UM8 plasmid pAMEDUM8_300, complete sequence	187177-187208	8	0.75
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	CP013931	Alteromonas mediterranea strain U10 plasmid pAMED10_300, complete sequence	191938-191969	8	0.75
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NC_019394	Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence	187204-187235	8	0.75
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	126926-126957	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	177692-177723	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	197310-197341	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	454338-454369	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	239094-239125	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	334553-334584	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	235814-235845	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	792125-792156	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1173504-1173535	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	135219-135250	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	208379-208410	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	177866-177897	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	73260-73291	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	177873-177904	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	175440-175471	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	179010-179041	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	197826-197857	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	239162-239193	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	175054-175085	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	197826-197857	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	197826-197857	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	175054-175085	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	197826-197857	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	175054-175085	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	175054-175085	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	197826-197857	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	144980-145011	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	175054-175085	9	0.719
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	175054-175085	9	0.719
NZ_CP033367_3	3.2\|3350573\|39\|NZ_CP033367\|CRISPRCasFinder	3350573-3350611	39	NZ_CP009123	Sphingopyxis fribergensis strain Kp5.2 plasmid pSfKp5.2, complete sequence	69948-69986	11	0.718
NZ_CP033367_3	3.2\|3350573\|39\|NZ_CP033367\|CRISPRCasFinder	3350573-3350611	39	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	1922480-1922518	11	0.718
NZ_CP033367_5	5.1\|3608404\|32\|NZ_CP033367\|CRISPRCasFinder	3608404-3608435	32	CP047389	Agrobacterium sp. CGMCC 11546 plasmid pA	10530-10561	11	0.656

1. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP051681 (Cohnella sp. MFER-1 plasmid unnamed1) position: , mismatch: 7, identity: 0.781

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ttcgcgataatcgtcttcgattttcgcaagga	Protospacer
 .***** *******************.  .*

2. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
gcggcgaaaatcggcttcgatttcgtcggcca	Protospacer
** ********** *********.  ** * *

3. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP013929 (Alteromonas mediterranea strain UM8 plasmid pAMEDUM8_300, complete sequence) position: , mismatch: 8, identity: 0.75

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
tacacgaaaatcgtgttcgatttttgcgcaat	Protospacer
  *.********** *********.***. *

4. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to CP013931 (Alteromonas mediterranea strain U10 plasmid pAMED10_300, complete sequence) position: , mismatch: 8, identity: 0.75

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
tacacgaaaatcgtgttcgatttttgcgcaat	Protospacer
  *.********** *********.***. *

5. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NC_019394 (Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence) position: , mismatch: 8, identity: 0.75

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
tacacgaaaatcgtgttcgatttttgcgcaat	Protospacer
  *.********** *********.***. *

6. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

7. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

8. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

9. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

10. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

11. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

12. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

13. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

14. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

15. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

16. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

17. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

18. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

19. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

20. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

21. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

22. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

23. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

24. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

25. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

26. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

27. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

28. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

29. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

30. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

31. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

32. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

33. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

34. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
ctctcgaagatcgtcttcgatcttcgccagca	Protospacer
 .* ****.************.*****    *

35. spacer 3.2|3350573|39|NZ_CP033367|CRISPRCasFinder matches to NZ_CP009123 (Sphingopyxis fribergensis strain Kp5.2 plasmid pSfKp5.2, complete sequence) position: , mismatch: 11, identity: 0.718

ccccgtgaaattcgcgacgccgccgagattgaccgatat	CRISPR spacer
gaacgtgaaattcgcgacgccgcctacattgagaaaggc	Protospacer
   ********************* * *****  .* ..

36. spacer 3.2|3350573|39|NZ_CP033367|CRISPRCasFinder matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 11, identity: 0.718

ccccgtgaaattcgcgacgccgccgagattgaccgatat	CRISPR spacer
ccaggtgatattggcgacgccgccgagattgaggatggc	Protospacer
**  **** *** *******************  .  ..

37. spacer 5.1|3608404|32|NZ_CP033367|CRISPRCasFinder matches to CP047389 (Agrobacterium sp. CGMCC 11546 plasmid pA) position: , mismatch: 11, identity: 0.656

--gccgcgaaaatcgtcttcgattttcgcgtcaa	CRISPR spacer
tgtattcgaaaatcgaggactattttcgcgtc--	Protospacer
    . *********    * ***********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4117608 : 4131130

uncultured_Mediterranean_phage(80.0%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015317531.1\|4117608_4118409_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.0e-33	34.3
WP_027029295.1\|4118405_4119170_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.7e-40	46.2
WP_013895102.1\|4119351_4119573_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	5.1e-08	65.9
WP_027029294.1\|4119605_4120430_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_027029293.1\|4120426_4121302_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	7.4e-50	46.7
WP_027029292.1\|4121406_4122711_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.6e-101	56.6
WP_027029291.1\|4122710_4123469_+	5'/3'-nucleotidase SurE	NA	NA	NA	NA
WP_027029290.1\|4123465_4124119_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	8.6e-19	39.8
WP_027029289.1\|4124440_4125955_+	peptidoglycan DD-metalloendopeptidase family protein	A0A2K9VGT1	Pontimonas_phage	6.9e-11	36.9
WP_080680730.1\|4126108_4127005_+	hypothetical protein	E4ZFJ7	Streptococcus_phage	1.0e-14	23.7
WP_027029288.1\|4127054_4127945_-	ATP-binding protein	NA	NA	NA	NA
WP_027029287.1\|4128217_4128529_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.0e-10	38.4
WP_027029286.1\|4128580_4131130_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.4e-61	47.0

DBSCAN-SWA_2

6843205 : 6921972

Paenibacillus_phage(11.11%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152536301.1\|6843205_6844183_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_106406555.1\|6845812_6846609_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.0e-25	49.5
WP_027033261.1\|6847793_6848318_-	sarcosine oxidase subunit gamma	NA	NA	NA	NA
WP_027033260.1\|6848310_6851277_-	sarcosine oxidase subunit alpha family protein	NA	NA	NA	NA
WP_027033259.1\|6851276_6851552_-	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_027033258.1\|6851570_6852821_-	sarcosine oxidase subunit beta family protein	NA	NA	NA	NA
WP_027033257.1\|6852916_6853873_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_106406554.1\|6855307_6856496_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-48	41.6
WP_027033253.1\|6856612_6857356_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-29	39.2
WP_027033252.1\|6857475_6858450_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_027033251.1\|6858511_6859345_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_027033250.1\|6859942_6861277_+\|transposase	ISNCY-like element ISMlo5 family transposase	NA	NA	NA	NA
WP_051371477.1\|6862143_6863373_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	2.8e-34	27.0
WP_027033249.1\|6863442_6864402_-	aminotransferase class IV	NA	NA	NA	NA
WP_027033248.1\|6864724_6865180_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_158673669.1\|6865928_6867086_-	M24 family metallopeptidase	NA	NA	NA	NA
WP_080680520.1\|6867818_6869219_-	MmgE/PrpD family protein	NA	NA	NA	NA
WP_080680393.1\|6869420_6870131_-	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A2P9FI75	Pseudomonas_phage	1.6e-05	41.2
WP_080680519.1\|6870152_6871289_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_027033242.1\|6873302_6873857_-	sarcosine oxidase subunit gamma	NA	NA	NA	NA
WP_027033241.1\|6873849_6876783_-	sarcosine oxidase subunit alpha family protein	NA	NA	NA	NA
WP_027033240.1\|6876779_6877070_-	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_027033239.1\|6877077_6878328_-	sarcosine oxidase subunit beta family protein	NA	NA	NA	NA
WP_027033238.1\|6879422_6880460_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_027033237.1\|6880936_6881779_-	hypothetical protein	NA	NA	NA	NA
WP_027033236.1\|6881768_6883028_-	diaminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_152536176.1\|6883644_6883878_+	hypothetical protein	NA	NA	NA	NA
WP_027033235.1\|6884046_6884367_+	iron-sulfur cluster assembly accessory protein	NA	NA	NA	NA
WP_027033234.1\|6884393_6884855_+	iron-sulfur cluster assembly scaffold protein	A0A218MKD1	uncultured_virus	3.3e-09	43.9
WP_027033232.1\|6885091_6885727_+	7-carboxy-7-deazaguanine synthase	NA	NA	NA	NA
WP_027033231.1\|6885723_6886077_+	6-carboxytetrahydropterin synthase QueD	S4U060	uncultured_phage	8.2e-08	35.8
WP_027033230.1\|6886081_6886819_+	7-cyano-7-deazaguanine synthase QueC	A0A2I2L6M4	Escherichia_phage	2.0e-43	42.5
WP_027033229.1\|6887304_6888345_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_167334839.1\|6889392_6889812_+	hypothetical protein	NA	NA	NA	NA
WP_027033225.1\|6890681_6891695_-	1-aminocyclopropane-1-carboxylate deaminase	NA	NA	NA	NA
WP_027033224.1\|6892987_6893308_-	exopolysaccharide repressor protein	NA	NA	NA	NA
WP_027033223.1\|6893345_6893663_-	ferredoxin III, nif-specific	NA	NA	NA	NA
WP_027033222.1\|6893659_6893863_-	hypothetical protein	NA	NA	NA	NA
WP_027033221.1\|6895422_6897423_-\|tRNA	class I tRNA ligase family protein	NA	NA	NA	NA
WP_027033220.1\|6897750_6898530_-	phytanoyl-CoA dioxygenase family protein	NA	NA	NA	NA
WP_027033219.1\|6899291_6900596_-	lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family protein	NA	NA	NA	NA
WP_027033218.1\|6901971_6903018_-	radical SAM/SPASM domain-containing protein	NA	NA	NA	NA
WP_027033217.1\|6904026_6904770_+	acetoacetate decarboxylase family protein	NA	NA	NA	NA
WP_027033216.1\|6904794_6905196_+	hypothetical protein	NA	NA	NA	NA
WP_027033215.1\|6906714_6907602_-	universal stress protein	NA	NA	NA	NA
WP_027033214.1\|6907700_6908486_-	response regulator transcription factor	NA	NA	NA	NA
WP_027033213.1\|6908510_6908990_-	NifX-associated nitrogen fixation protein	NA	NA	NA	NA
WP_027033212.1\|6909007_6909505_-	nitrogen fixation protein NifX	NA	NA	NA	NA
WP_027033211.1\|6909470_6910853_-	nitrogenase iron-molybdenum cofactor biosynthesis protein NifN	NA	NA	NA	NA
WP_027033210.1\|6910862_6912353_-	nitrogenase iron-molybdenum cofactor biosynthesis protein NifE	NA	NA	NA	NA
WP_027033209.1\|6912413_6913955_-	nitrogenase molybdenum-iron protein subunit beta	NA	NA	NA	NA
WP_027033208.1\|6914082_6915588_-	nitrogenase molybdenum-iron protein alpha chain	NA	NA	NA	NA
WP_006331760.1\|6915692_6916586_-	nitrogenase iron protein	NA	NA	NA	NA
WP_152536177.1\|6917605_6917911_+	hypothetical protein	NA	NA	NA	NA
WP_152536178.1\|6917931_6918462_+	hypothetical protein	NA	NA	NA	NA
WP_027033206.1\|6919584_6920031_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_023772705.1\|6920027_6920384_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_106406564.1\|6920493_6921972_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.8e-105	43.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP033367

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection