CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP053582	Salmonella enterica subsp. VII serovar 1,40:g,z51:-- strain 2439-64 chromosome, complete genome	2 crisprs	DEDDh,DinG,cas3,csa3,WYL	0	30	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP053582_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053582_1

1964022-1964291

Orphan

Consensus_repeat	Method
TAGTCCTGGCGGCAGCGGCGGCAGGCNGGT	CRT

4 spacers

The CRISPR arrays of NZ_CP053582_1

>merge|NZ_CP053582|1|1964022-1964291|CRT
TAGTCCTGGCGGCAGCGGCGGCAGGCTGGTAAGCGGGTTATCAGATATCGACAGCTCCCTTAATCCTGGCGGCAGCGGCGGCAGGCGGGTCAGCCGGTTACGATAGGCCCACAGAATCTGTAGTCCTGACGGCAGCGGCGGCAGGCTGGCGAGCTGGTTATTAAAGACAGACAGCTTACATAGCCCTGGCGGCAGCGGTGGCAGGCTGGTCAGCTGGTTATAAGAGACCGATAACTCCCGTAGTCCTGGCGGCAACGTCGGCAGGCGGGT

>NZ_CP053582|1|1|1964022-1964291|CRT
TAGTCCTGGCGGCAGCGGCGGCAGGCTGGT	AAGCGGGTTATCAGATATCGACAGCTCCCT
TAATCCTGGCGGCAGCGGCGGCAGGCGGGT	CAGCCGGTTACGATAGGCCCACAGAATCTG
TAGTCCTGACGGCAGCGGCGGCAGGCTGGC	GAGCTGGTTATTAAAGACAGACAGCTTACA
TAGCCCTGGCGGCAGCGGTGGCAGGCTGGT	CAGCTGGTTATAAGAGACCGATAACTCCCG
TAGTCCTGGCGGCAACGTCGGCAGGCGGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053582.1\|WP_079824351.1\|1944881_1947854_-\|type-III-restriction-modification-system-endonuclease	unknown	unknown	gnl\|CDD\|237972
NZ_CP053582.1\|WP_079824347.1\|1956097_1959274_+\|multidrug-efflux-RND-transporter-permease-subunit-MdsB	unknown	unknown	gnl\|CDD\|223911
NZ_CP053582.1\|WP_079824683.1\|1969137_1972557_-\|DUF4765-family-protein	unknown	unknown	gnl\|CDD\|374256
NZ_CP053582.1\|WP_079805047.1\|1979712_1980114_-\|sigma-factor-binding-protein-Crl	unknown	unknown	gnl\|CDD\|182882
NZ_CP053582.1\|WP_079824680.1\|1965646_1966768_-\|transposase	unknown	unknown	gnl\|CDD\|376980
NZ_CP053582.1\|WP_071651084.1\|1951555_1951750_-\|gold-resistance-metallochaperone-GolB	unknown	unknown	gnl\|CDD\|225328
NZ_CP053582.1\|WP_079824352.1\|1959290_1960748_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP053582.1\|WP_139386343.1\|1967131_1967548_-\|transposase	unknown	unknown	gnl\|CDD\|366690
NZ_CP053582.1\|WP_079824346.1\|1954877_1956101_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_CP053582.1\|WP_079805045.1\|1977222_1978326_-\|glutamate-5-kinase	unknown	unknown	gnl\|CDD\|235460
NZ_CP053582.1\|WP_079824681.1\|1966787_1967135_-\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	unknown	unknown	gnl\|CDD\|377551
NZ_CP053582.1\|WP_079824348.1\|1961006_1962365_+\|guanine-deaminase	unknown	unknown	gnl\|CDD\|238628
NZ_CP053582.1\|WP_079824343.1\|1947863_1949822_-\|site-specific-DNA-methyltransferase	unknown	unknown	gnl\|CDD\|225100
NZ_CP053582.1\|WP_079805040.1\|1951827_1952298_-\|Au(I)-sensor-transcriptional-regulator-GolS	unknown	unknown	gnl\|CDD\|133383
NZ_CP053582.1\|WP_079824344.1\|1950007_1951261_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|273324
NZ_CP053582.1\|WP_079824686.1\|1974092_1974902_-\|CatB-related-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100040
NZ_CP053582.1\|WP_079824345.1\|1952309_1954598_-\|gold/copper-translocating-P-type-ATPase-GolT	unknown	unknown	gnl\|CDD\|319783
NZ_CP053582.1\|WP_079824687.1\|1978608_1979661_+\|phosphoporin-PhoE	unknown	unknown	gnl\|CDD\|182275
NZ_CP053582.1\|WP_171804757.1\|1973223_1973448_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|317659
NZ_CP053582.1\|WP_079805044.1\|1975960_1977211_-\|glutamate-5-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|234685

Protein	Function_ID	Function_description	E-value
NZ_CP053582.1\|WP_079824351.1\|1944881_1947854_-\|type-III-restriction-modification-system-endonuclease	gnl\|CDD\|237972	PRK15483, PRK15483, type III restriction-modification system endonuclease.	0
NZ_CP053582.1\|WP_079824347.1\|1956097_1959274_+\|multidrug-efflux-RND-transporter-permease-subunit-MdsB	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
NZ_CP053582.1\|WP_079824683.1\|1969137_1972557_-\|DUF4765-family-protein	gnl\|CDD\|374256	pfam15962, DUF4765, Domain of unknown function (DUF4765). This domain family is found in bacteria, and is approximately 90 amino acids in length.	0
NZ_CP053582.1\|WP_079805047.1\|1979712_1980114_-\|sigma-factor-binding-protein-Crl	gnl\|CDD\|182882	PRK10984, PRK10984, sigma factor-binding protein Crl.	7.84567e-91
NZ_CP053582.1\|WP_079824680.1\|1965646_1966768_-\|transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	1.32495e-37
NZ_CP053582.1\|WP_071651084.1\|1951555_1951750_-\|gold-resistance-metallochaperone-GolB	gnl\|CDD\|225328	COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism].	1.3074e-12
NZ_CP053582.1\|WP_079824352.1\|1959290_1960748_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	2.26596e-101
NZ_CP053582.1\|WP_139386343.1\|1967131_1967548_-\|transposase	gnl\|CDD\|366690	pfam01527, HTH_Tnp_1, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family consists of various E. coli insertion elements and other bacterial transposases some of which are members of the IS3 family.	2.76015e-12
NZ_CP053582.1\|WP_079824346.1\|1954877_1956101_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	3.17741e-80
NZ_CP053582.1\|WP_079805045.1\|1977222_1978326_-\|glutamate-5-kinase	gnl\|CDD\|235460	PRK05429, PRK05429, gamma-glutamyl kinase; Provisional.	0
NZ_CP053582.1\|WP_079824681.1\|1966787_1967135_-\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	4.46585e-50
NZ_CP053582.1\|WP_079824348.1\|1961006_1962365_+\|guanine-deaminase	gnl\|CDD\|238628	cd01303, GDEase, Guanine deaminase (GDEase). Guanine deaminase is an aminohydrolase responsible for the conversion of guanine to xanthine and ammonia, the first step to utilize guanine as a nitrogen source. This reaction also removes the guanine base from the pool and therefore can play a role in the regulation of cellular GTP and the guanylate nucleotide pool.	4.15732e-144
NZ_CP053582.1\|WP_079824343.1\|1947863_1949822_-\|site-specific-DNA-methyltransferase	gnl\|CDD\|225100	COG2189, COG2189, Adenine specific DNA methylase Mod [DNA replication, recombination, and repair].	3.12019e-107
NZ_CP053582.1\|WP_079805040.1\|1951827_1952298_-\|Au(I)-sensor-transcriptional-regulator-GolS	gnl\|CDD\|133383	cd01108, HTH_CueR, Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators. Helix-turn-helix (HTH) transcription regulators CueR and ActP, copper efflux regulators. In Bacillus subtilis, copper induced CueR regulates the copZA operon, preventing copper toxicity. In Rhizobium leguminosarum, ActP controls copper homeostasis; it detects cytoplasmic copper stress and activates transcription in response to increasing copper concentrations. These proteins are comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain winged HTH motifs that mediate DNA binding, while the C-terminal domains have two conserved cysteines that define a monovalent copper ion binding site. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.	1.05294e-70
NZ_CP053582.1\|WP_079824344.1\|1950007_1951261_-\|MFS-transporter	gnl\|CDD\|273324	TIGR00891, Carboxylic_acid_transporter_protein_homolog, putative sialic acid transporter. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	1.14005e-99
NZ_CP053582.1\|WP_079824686.1\|1974092_1974902_-\|CatB-related-O-acetyltransferase	gnl\|CDD\|100040	cd03349, LbH_XAT, Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. Members of this class of enzymes include Enterococcus faecium streptogramin A acetyltransferase and Pseudomonas aeruginosa chloramphenicol acetyltransferase. They contain repeated copies of a six-residue hexapeptide repeat sequence motif (X-[STAV]-X-[LIV]-[GAED]-X) and adopt a left-handed parallel beta helix (LbH) structure. The active enzyme is a trimer with CoA and substrate binding sites at the interface of two separate LbH subunits. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients.	8.62355e-63
NZ_CP053582.1\|WP_079824345.1\|1952309_1954598_-\|gold/copper-translocating-P-type-ATPase-GolT	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP053582.1\|WP_079824687.1\|1978608_1979661_+\|phosphoporin-PhoE	gnl\|CDD\|182275	PRK10159, PRK10159, phosphoporin PhoE.	0
NZ_CP053582.1\|WP_171804757.1\|1973223_1973448_+\|hypothetical-protein	gnl\|CDD\|317659	pfam15284, PAGK, Phage-encoded virulence factor. PAGK represents a new of virulence factors that is translocated into the host cytoplasm via bacterial outer membrane vesicles (OMV). Members are small proteins composed of about 70 amino acids. In Salmonella they are secreted independently of the SPI-2 type-III secretion system, T3SS. The OMV functions as a vehicle for transferring virulence determinants to the cytoplasm of the infected host cell. OMVs are released from the cell envelopes of Gram-negative bacteria and comprise a variety of outer membrane and periplasmic constituents, including proteins, phospholipids, lipopolysaccharides, and DNA.	0.000177463
NZ_CP053582.1\|WP_079805044.1\|1975960_1977211_-\|glutamate-5-semialdehyde-dehydrogenase	gnl\|CDD\|234685	PRK00197, proA, gamma-glutamyl phosphate reductase; Provisional.	0

>NZ_CP053582.1|WP_079824348.1|1961006_1962365_+|guanine-deaminase
MENLSFVLKGCGFSAHSDKNITYIKQSLFCINQAGYIARIIPADEPDYVVFLNKARKANILRELKQGEYLLPGFIDLHIHAPQWPNLGKALDRPLEKWLQEYTFPLEARYSDMEYARKNYQHLVKTLLANGTTTAVYFATIHREASVELGRICLQQGQRALVGKVAMDDKNACPENYRDASAFSAIEETRRFIDDIKQLPGNENALILPVITPRFIPCCTTELLEGLGKLAQETGCHIQTHCSESDWEHNFVLKKYSQTDTQALKRFGLLSRKTVLAHSNHITDEDMEIIKGVDAGIAHCPISNFYFANSVFPLRKAIDKQLNVGLGSDISAGFSPSLFDACRHAVVASKALNDGVDARILAAQRGCQSASISFAEAFWLATAGGGIVLDLPIGKLDTGYLFDAMIVDTNSATSNIFIYEDQDTPHDILQKIIYNTQRSDISVVWVGGKQVR
>NZ_CP053582.1|WP_079824352.1|1959290_1960748_+|efflux-transporter-outer-membrane-subunit
MKNTFTRYRQTATLAMLAFATTLAGCTMAPKHERPASPTAMVYPSETPTISGVPDAADIGWRDFFHDPLLQELIAIALRNNRDLRKAGLNVEAARRLYRIQRAEMLPNLNASAALDVGRVPADLSVTDAPEINRRYEVTGATTAWELDLWGRVRSLSDQALAAYMALDETRIATQISLVSEVSSAWLTLRADRELLRLTEDTLTAQKSSYALMVQLARAGNATQLDLRMAEIALRSAEINRAAYTRQLARDRNALELLLGQPLTPELSRRLNGAVTLTEGAIPTELPGGLPADLLMRRPDIRAAEYRLRGANARIGAARAAFFPTISLTGTAGTASASLSGLFEPGAGSWRFLPQITLPVFYGGALRANLEAAHIQKRIEIADYETVIQEAFREVADGLAGQHTLGEQVLAERRSVEASQNAFDLAELRFQEGVDDYLTLLDTWRMLYGSQQRLVRIRLMQQLNMINLYKALGGGWSEYSVKTPG
>NZ_CP053582.1|WP_079824347.1|1956097_1959274_+|multidrug-efflux-RND-transporter-permease-subunit-MdsB
MKFTHFFIARPIFAIVLSLLMLLAGAIAFLKLPLSEYPAVTPPTVQVSTSYPGANPQVIADTVAAPLEQVINGVDGMLYMNTQMAIDGRMVISIAFEQGTDPDMAQIQVQNRVSRALPRLPEEVQRIGVVTEKTSPDVLMVVHLVSPQKRYDSLYLSNFAIRQVRDELARLPGVGDVLVWGAGEYAMRVWLDPVKVANRGLTASDIVTALREQNVQVAAGSVGQQPEASAAFQVTVNTLGRLTHEEQFGEIVVKIGADGEVTRLRDVARVTLGADAYTLRSLLNGEAAPALQIIQSPGANAIDVSNAIRSKMDELQQNFPQDIEYRIAYDPTVFVRASLQSVAITLLEAIMLVVLVVVLFLQTWRASIIPLVAVPVSLVGTFALMHLFGFSLNTLSLFGLVLSIGIVVDDAIVVVENVERHISQGKSPGEAAQKAMDEVTGPILSITSVLTAVFIPSAFLAGLQGEFYRQFALTIAISTILSAINSLTLSPALAAILLKPHHDTAKADWLTRLMGTVLGGFFRRFNRFFDNASNRYVSAVRRVVRGSAIVMLLYTGFVGLTWLGFHQVPNGFVPAQDKYFLVGIAQLPSGASLDRTEAVVKQMSDIALAEPGVESVVAFPGLSVNGPVNVPNSALMFAMLKPFDEREDPSLSANAIAGKLMRKFSQIPDGFIGIFPPPPVPGLGATGGFKLQIEDRAELGFEAMAKVQSEIMSKAMQTPELANMLASFQTNAPQLQVDIDRVKAKSMGVSLTDVFETLQINLGSLYVNDFNRFGRTWRVMTQADAPFRMQQEDIGLLKVRNAKGEMIPLSAFVTITRESGPDRIIHYNGFPSVDISGGPAPGFSSGQATDAIEKIVRETLPEGMIFEWTDLVYQEKQTGNSALSIFALAVLLAFLILAAQYNSWSLPFAVLLIAPMSLLSAIVGVWVSGGDNNIFTQIGFVVLVGLAAKNAILIVEFARAKEHEGANPLTAVLEASRLRLRPILMTSFAFIAGVVPLVLATGAGAEMRHAMGIAVFAGMLGVTLFGLLLTPVFYVVVRRIALQREARQKHVGSHDQQA
>NZ_CP053582.1|WP_079824346.1|1954877_1956101_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MRRTFKITLIAGVIAAIGGVIYIAGEALWDKGNAVGPPTSAPPPSVPVAEALSRTLAPTAEFTGFLAAPETVELRSRVGGTLEAVSVPEGHLVNRGQLLFQIDPRPFQVALDTAVAQLRQAEALARQAQADFDRIQRLVASGAVSRKNFDDAIATRNARQAQAQSAKAAVAAARLELSWTRITAPIAGRVDRMRVTRGNLVSGGVAGNATLLTTIVSHNPIYVYFDIDEATWLKAVRQPRSDKNPPVVNMGLTTDNGLPYQGVLDFVGNQMNRSTGTIRARAVIPNSEGMLSPGLFARISLPTGEPRETLLIDDLAVSADQGKNYVLVVGKENQAEYRQVELGQMVDGLRVITQGLQPGEKIILKGLVRPGMIVAPRLVPMQQNVADKQTAASTKADGDSASKAVRQ
>NZ_CP053582.1|WP_079824345.1|1952309_1954598_-|gold/copper-translocating-P-type-ATPase-GolT
MSQSENRHDTISLLIEGMTCASCVARVEKGIKAVPGVTDATVNLATERATVRGTASAEAVIVAIEKTGYEARTVETSGQAEDDSEGKKEAERVSLKRDLILASVLALPVFVLEMGSHLIPGMHEWVMETIGLQQSWYWQFALTLLVLTIPGRRFYLKGFPALVRLAPDMNSLVAVGTAAAFGYSLVATFTPELLPEGTVNVYYEAAAVIVALILLGRFLEARAKGRTSEAIKRLVGLQARVAHVLREGRIVDIPVDDVVLGDMMEVRPGERIPVDGEVTEGRSFVDESMITGEPIPVEKSVGSAVVGGTVNQKGALTLRATAVGGQTMLAQIIRLVEQAQGSKLPIQAVVDKVTLWFVPMVMLIAALTFVVWLAFGPSPALTFALINGVAVLIIACPCAMGLATPTSIMVGTGRGAEMGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRPVLTDLDVAKGFERREVLAKVAAVESRSEHPIARAIVMSAEEEGIALPAMNGFESVTGMGVYATVAGTRVDVGADRYMREIGVEISGFATTAERLGQEGKSPLYAAIDGQLAAIIAVADPIKPSTPAAINALHQLGIKVAMITGDNARTAQAIARQLGIDEVVAEVLPEGKVEAIRRLKAAYGQVAFVGDGINDAPALAASDVGLAIGTGTDVAVESADVVLMSGNLQGVPNAIALSKATIRNIHQNLFWAFAYNTALIPVAAGALFPVWGILLSPVFAAGAMAMSSVFVLGNALRLRRFQAPMAAPSDTSTT
>NZ_CP053582.1|WP_079805040.1|1951827_1952298_-|Au(I)-sensor-transcriptional-regulator-GolS
MNIGKAAKASKVSAKMIRYYEQIGLIPAASRTDSGYRAYTQADINQLHFIRRARDLGFSVSEISDLLNLWNNQSRQSADVKRLAQTHIDELDRRIQNMQHMAQTLKSLIHCCAGDTLPDCPILHTLGQPDDSDPDPEACTGAVSRRDRRHGLAKRW
>NZ_CP053582.1|WP_071651084.1|1951555_1951750_-|gold-resistance-metallochaperone-GolB
MQFHIDDMTCGGCASTVKKTILTLDANAVVRTDPATRLVEVETSLSGEQIAAALQKAGFPPRKQ
>NZ_CP053582.1|WP_079824344.1|1950007_1951261_-|MFS-transporter
MYTPLNWTTTQRHVAFASFTSWMLDAFDFFILVFVLSDLAEWFHASVSDVSIAIMLTLAVRPIGALVFGRMAEKYGRRPILMLNILFFTVFELLSAWSPTFMAFLIFRVMYGVAMGGIWGVASSLAMETIPDRSRGLMSGIFQAGYPCGYLFASVIFGLFYSMVGWRGMFLIGALPIVLLPYIWFKVPESPVWLAARARKENTALLPVLRKQWKLCLYLVLVMAFFNFFSHGTQDLYPTFLKMQHGFDPHLISIIAIFYNIAAMLGGIFYGTLSERIGRKKAIMIAAFLALPVLPLWAFSSGSFTIGLGAFLMQFMVQGAWGVVPTWLNELVPANARAVLPGFVYQLGNLLASVNATLQARIAETHGGNYGLAMAIVAGAVAILICVFVAFGRETRGVVISGTDSESLPESVVSHHT
>NZ_CP053582.1|WP_079824343.1|1947863_1949822_-|site-specific-DNA-methyltransferase
MLKDNQKYNESVAPNSAFLSELQRALPEFFTADRYNEQGELIAKGGFDLARFERELKARNINELTSGYQIDFIGKDYAKKQAGEKSVTVIVPDVEHNTLAENKNSHNLFLTGDNLDVLRHLQNNYADTVDMIYIDPPYNTGSDGFVYPDHFEYSDRALQDMFGLNDTELARLKSIQGKSTHSAWLSFMYPRLFLARKLLKDTGFIFISIDDNEHANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAKTGQGALRLEPLSKEYIQKSYKEPTEQFPEGKWRPVPLTVSKGLSGGGYTYKITTPNGTVHERLWAYPEASYQKLVADNLVYFGKDNGGIPQRVMYAHHSKGQPTTNYWDNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMVLNEEDGGQRTFILCTIDQALSNNTIAKKAGYNTIDEISRERITRVAAKIRANNPATNSDLGFKHYRFATPTQQTLDDLDSFDIATGHFVNTSGQLAAFTESGFTDMINPFSARGLGVPGGASGEETLLTTWLVADGYKMDIDVQTVDFSGYCARYVDNTRLYLIDERWGTEQTRDLLNHIGTHQLPVQTIVIYGYSFDLESIRELEIGLKQLDQKVNLVKRY
>NZ_CP053582.1|WP_079824351.1|1944881_1947854_-|type-III-restriction-modification-system-endonuclease
MMNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKERYDDKANIDVKMETGTGKTYVYTRLMYELHQNYGLFKFVLVVPTPAIKEGARNFITSDYARQHFSQFYENTRMELCTINAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQMLNSASMTRDDYDQTLLGGLTSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIVRFGATFPDIVEGKGKNKCVRKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQANNRYIVDSVTAKKLILRRGGKIAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAGMALVPGTFGASYQELIIQDAIDKHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSYRDDEGWLKVTFERLLKKKLTQLIDDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGYFGEDRGSGDEAIQAEVDDILKNKEKLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFVIAKLRSSGSESSKIQEVGRGLRLPVDENGHRVHQEEWPSRLAFLIGYDEKAFASMLVDEINRDSKVQLNEQKLDEAMITLIVTERQKVDPAFTELRLLEDLDDKKLINRSNEFKPSVTLNGETKSGFAWLLEFYPELTQARVRADRIRDNKPASRLRVRLRKENWEQLSSIWEQFSRRYMLQFERSGASLEQIAAEVLRDPALYIRQKPSQVQQRLVSNEDNGRFEVAQREGELAASKFMAGMKYGHFLKQLALRTSLPVNVLHPVLMAMLRDVLQGDSRYLSEISLDNMTRALQTRINAHFAQRHDYLPLDFQASTSVFDSTARQFREEISAEIVGKNVDENAIDDPRSLYQIPPLRYDSVDPELPLLKYDYPQQVSVFGKLPKRAIQIPKYTGGSTTPDFVYRIERQDADSVYLLVETKAENMRVGDQVILDAQRKFFDMLRRQNINVEFAEATSAPAVFSTINSLIEGKVK
>NZ_CP053582.1|WP_079824680.1|1965646_1966768_-|transposase
MKTEFPDGIDLLKGILLQHQAMLKQQAQMKQQQAQLHNYAGQVAGYEREIERLKAQLDKLRRILFGQSSEKLRLRLEKEIHEAEKRLGEMEDRLNTAKGCLEAAAAVLSEKVIEQLDIINNAFKVIETVRPKLACRKCDAIVQAPLPAKPIDRSYASPGLLARILMARYVEHIPLYRQCDIYARHGLRLSRNTLVRWVLELADKLSPLAELTTGALRRIAELYAIEADIRGSPEETRLSVRKEKSQPLMQSLYGWIQAQLKTLSVHAEMAKAFGYMLKQCDALNVFCSDGRVEIDNNICENALRCVALGRRNYLFFGSDRGGEAAAIIYSLLGTCKLNGVEPGAWLRDVLWKISDWPSNRVHELLPWSLDTVK
>NZ_CP053582.1|WP_079824681.1|1966787_1967135_-|IS66-family-insertion-sequence-element-accessory-protein-TnpB
MISLPEGSRIWLVAGVTDMRNGFNGLASHVQSVLNDDPFSGHLFIFRGRRGDMRKLLWADAEGLCLFVKRLERGHFVWPAVTEGKIHLTPAQLVMLLEGLNWKHPQRTYQTGLRV
>NZ_CP053582.1|WP_139386343.1|1967131_1967548_-|transposase
MTEPTARRKRASYPMSFKIDLVQQSLQPGASVARLAREHGINDNLLFTWRQRYRHLVDAPVDDGAGETGALTDNIVPVVLKRQLLLLSAAPPAAVPASPPGSEQTCEIVIGRARLKLSGHLTPAMLATLLRELKRGRR
>NZ_CP053582.1|WP_079824683.1|1969137_1972557_-|DUF4765-family-protein
MPITLEHIAAKPFQEKLKAKGIRTWDTIQYLSALDGAYKDTVFHEQISNLPKDYILLDEMARDEKEYSLNVFDFFFEPTSEIIYDVIKSTLDFYYSNSPTFRRLVNYKVGYSMSNDIDTSKCEVKVSPNYSYENTEGDSVYLSLPFDKKGFPIDPGFHDCETRITSEKVFLDLFLKHLLYDELKMNYEATNIYSNVIFKEIDSPAMAHASLCFSQASVNDEYELFDIDSVAALPKTTEQIIFEGKKIQKEILSSFEREKNSQPTIIHKMERSIKNIAVTGLLLSSRLKIVDSYNIKNSNSEDNNKFSSSKEPLRYARALPEDHSAPNMEPHPLGQALDGIVKHSLFAAGLPLLEILKKLGDEQLMNNYKRGYHELLVFSQTGQWTHGGRRLAAEYMFNGLVIHLNEIEIILDNGRKVSFEYFVKEHIEHQYKIYRLIARDMLVHPFYIRSTISVTRKIASVLVNESHYTKVLNQKFPEISSSNFDTFYGKEAIFTALQIFNFTRKNHGISTFNLKKMKELFKRVQLVIHHLSRNGGSRLLLSSDGIKHNFIIMRNIIQLCTLMAGPVNDRKINSLSRKIVVNNEFSSHIKSLFSKGDQFLGLLMKAAIDKELNWAEKYYQAESHIKNHMQNCDLMGLMDIKKILREAVVGLIHEISDIAQSSWMTEEEQYHKQVQALEAFKSKVSSMDGGQAFVYGFNKVIQEGLWGLIELSFDVDDTAHHRTISSLSPASRSGLHFLGTIWNIVMSFIPGFNALAGTSSILNRAIVENSADICGYVQDIIRIGMEAVPVAEAKFTERASNAKYTGLRFVESKIESGLIKPPIQKGSNYKVIESIEYTDFIYQKSNRKILELNSEGSDGLYCATGFDKEIHGYYKQSGNGFYRKQKSFLPLSTEKPNTIKYGERDLILTKEPGSETYQGTYSDTGKNAGMTFYRDSEGKFYKASGLKGGGLIRHIDKPYSELREGDIGYDEDLLDISDDSPLLEEMLPSLSEELYPTLEENVQSVYKNLQSGDTTAGEIEVVLCRGTTGPQAENIVKFKTAGGVEGADPNILPVSVETAREQVRSGRVVPEFTTDLSVADRFSREHHLIIVKIKAKYLTRGSTSESGWVMPHTAPVEPVGIIDRTYGHAENIGQANASK
>NZ_CP053582.1|WP_171804757.1|1973223_1973448_+|hypothetical-protein
MKHVKNVFLVLAFALSAAAFSTSAMAASTPPPAHKPGGLDVGDIIMPPPPDWCKNYPEDKMRPPELAKICQWNK
>NZ_CP053582.1|WP_079824686.1|1974092_1974902_-|CatB-related-O-acetyltransferase
MNIKLFKFIEGGSKKYVFRWTKKHYEFCMDNNIFLSHKGKKVYKERNFFLLSKGEKIAIEDNVIAEQYSTMPVRNFSSVGAFSFPTCHFSGNVKIGRFCSIASNVKIMGGNHPMNRFTTHMVTYNGEFDKYAMSEFNHAWTLKPFKTISQNPVIGNDVWIGNDVVLKGGITIGDGAVIAANSVVTKNVPPYAIVAGVPARIIRYRFNPDIVIKLMKIKWWNYNFFDLPDNNKCDDIDYFISEMNSMISSGAIQECVYKSFNLSEVFRTI
>NZ_CP053582.1|WP_079805044.1|1975960_1977211_-|glutamate-5-semialdehyde-dehydrogenase
MLEQMGIAAKAASYKLALLSSREKNGVLGKIADELEAQTETILSANAQDVAQARENGLSEAMLDRLALTPARLKAIADDVRQVCYLTDPVGQVIDGSLLDSGLRLERRRVPLGVVGVIYEARPNVTVDVASLCLKTGNAVILRGGKETHRTNAATVRVIQKALKACGLPEAAVQAIDNPDRSLVNEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGIGVCHIFVDSSAEIAPALEIIVNAKTQRPSTCNTVETLLVHQEIAERFLPALSQQMAESGVTLHGDETVMQVMKGPAKCVPLKPEELDNEFLSLDLNVVIVINIDDAIDHIREHGTQHSDAILTCDMHNAARFVNEVDSAAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGLEALTTYKWIGFGDGTIRA
>NZ_CP053582.1|WP_079805045.1|1977222_1978326_-|glutamate-5-kinase
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADMEDRERFLNARDTLRALLDNRIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPRSNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIASGSKPGVIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVDEGATAAMLERGSSLLPKGIKSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAGHHSQQIDAILGYEYGPVAVHRDDMITR
>NZ_CP053582.1|WP_079824687.1|1978608_1979661_+|phosphoporin-PhoE
MKKSTLAVVMSIIASASVHAAEIYNKNGNKLDVYGKVKAMHYMSDYDSKDGDQSYVRFGFKGETQINDQLTGYGRWEAEFAGNKAESDSSQQKTRLAFAGLKLKDIGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGIVDGLDLTLQYQGKNDDRDVKKQNGDGFGTSLSYDFGGSDFAVSGAYTHSDRTHEQNLQRRGTGDKAEAWATGLKYDTNDIYIATFYSETRNMTPVSGGFANKTQNFEAVIQYQFDFGLRPSLGYVLSKGKDIEGVGSEDLVNYIDVGAIYYFNKNMSAFVDYKINQLDSDNRLGMNDDDIVAVGLTYQF
>NZ_CP053582.1|WP_079805047.1|1979712_1980114_-|sigma-factor-binding-protein-Crl
MTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKEGNWTAVPINETEVVERLEYTLREFHEKLRDLLVSMELALEPSDDFNDEPVKLSA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP053582_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP053582_2

3153993-3155363

Unclear

I-E

Consensus_repeat	Method
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CRISPRCasFinder
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CRT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	PILER-CR

22 spacers

cas3

The CRISPR arrays of NZ_CP053582_2

>merge|NZ_CP053582|2|3153993-3155363|CRISPRCasFinder,CRT,PILER-CR
ACGTTTATCCCCGCTGGCGCGGGGAACTCTCGGTCCACTGAAGCACCTCTTGAAAGAAGCGCGGTTTATCCCCGCTGGCGCGGGGAACTCTAACGAACGGTGGCCTGTCTGTTTCCTGTTTGCGGTTTATCCCCGCTGGCGCGGGGAACTCGATCGTTCTGCGTCACTTTCCCCGCATTTAACCGGTTTATCCCCGCTGGCGCGGGGAACTCAGTTGTGCTACCCGAACCGATTGTTACCAAACCGGTTTATCCCCGCTGGCGCGGGGAACTCCCAGCCACTGCCGGAAACTACGCTCATTCCGCCGGTTTATCCCCGCTGGCGCGGGGAACTCTGTAGCACCAGCAATAACAGTCGGTAGATGGGCGGTTTATCCCCGCTGGCGCGGGGAACTCATCCGTCGCGGCGCTGGTAAACCATGAATTTTCGGTTTATCCCCGCTGGCGCGGGGAACTCCCAGTGTATGAATCAGAAAATGAAGTATAAAACGGTTTATCCCCGCTGGCGCGGGGAACTCTCCTGCGCGTATCCAGCCGTCCAGATGTTTCGCGGTTTATCCCCGCTGGCGCGGGGAACTCTGCGTTATCTGGAACATCGATTTCTATCGTGACGGTTTATCCCCGCTGGCGCGGGGAACTCCTCCGAGACTCTATGCGCAGAAAGATAGAAAGCGGTTTATCCCCGCTGGCGCGGGGAACTCACGCCATACTCCCAGCATATTGATGCTGGTCGCGGTTTATCCCCGCTGGCGCGGGGAACTCAACGTTGCCCTGTGCATTGATGCGGCCAAAAACGGTTTATCCCCGCTGGCGCGGGGAACTCTTCGAAAAAATAATCCCCATCCATTTCATGCACGGTTTATCCCCGCTGGCGCGGGGAACTCGCGCGCTCAATACCGTCAGGAATAAGCCCCAGCGGTTTATCCCCGCTGGCGCGGGGAACTCCAACCGGATAGACAGCATTTTTCGTTGAGACTCGGTTTATCCCCGCTGGCGCGGGGAACTCTTATTAAATAACCAAAATATGGTTATATTCGACGGTTTATCCCCGCTGGCGCGGGGAACTCCTGATACTCATGCCCAGGTCGGAACGGATCACCGGTTTATCCCCGCTGGCGCGGGGAACTCAGCTTGCCGCCAACCATGCGATCACTGTCGAACGGTTTATCCCCGCTGGCGCGGGGAACTCTTCTCTAACGCCGAAGCCAGCTTTTCATTCGTCGGTTTATCCCCGCTGGCGCGGGGAACTCATCTCTTAGTGCTACGGTCATGCTCATTCCCCCGGTTTATCCCCGCTGGCGCGGGGAACTCTTACAGCTACCTATGGAACGGAACGAGAGTTACGGTTTATCCCCGCTGGCGCGGGGAACTC

>NZ_CP053582|2|1|3153993-3155363|CRISPRCasFinder
ACGTTTATCCCCGCTGGCGCGGGGAACTC	TCGGTCCACTGAAGCACCTCTTGAAAGAAGCG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TAACGAACGGTGGCCTGTCTGTTTCCTGTTTG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	GATCGTTCTGCGTCACTTTCCCCGCATTTAAC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	AGTTGTGCTACCCGAACCGATTGTTACCAAAC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CCAGCCACTGCCGGAAACTACGCTCATTCCGC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TGTAGCACCAGCAATAACAGTCGGTAGATGGG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	ATCCGTCGCGGCGCTGGTAAACCATGAATTTT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CCAGTGTATGAATCAGAAAATGAAGTATAAAA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TCCTGCGCGTATCCAGCCGTCCAGATGTTTCG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TGCGTTATCTGGAACATCGATTTCTATCGTGA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CTCCGAGACTCTATGCGCAGAAAGATAGAAAG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	ACGCCATACTCCCAGCATATTGATGCTGGTCG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	AACGTTGCCCTGTGCATTGATGCGGCCAAAAA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TTCGAAAAAATAATCCCCATCCATTTCATGCA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	GCGCGCTCAATACCGTCAGGAATAAGCCCCAG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CAACCGGATAGACAGCATTTTTCGTTGAGACT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TTATTAAATAACCAAAATATGGTTATATTCGA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CTGATACTCATGCCCAGGTCGGAACGGATCAC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	AGCTTGCCGCCAACCATGCGATCACTGTCGAA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TTCTCTAACGCCGAAGCCAGCTTTTCATTCGT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	ATCTCTTAGTGCTACGGTCATGCTCATTCCCC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TTACAGCTACCTATGGAACGGAACGAGAGTTA
CGGTTTATCCCCGCTGGCGCGGGGAACTC

>NZ_CP053582|2|2|3153993-3155363|CRT
ACGTTTATCCCCGCTGGCGCGGGGAACTC	TCGGTCCACTGAAGCACCTCTTGAAAGAAGCG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TAACGAACGGTGGCCTGTCTGTTTCCTGTTTG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	GATCGTTCTGCGTCACTTTCCCCGCATTTAAC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	AGTTGTGCTACCCGAACCGATTGTTACCAAAC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CCAGCCACTGCCGGAAACTACGCTCATTCCGC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TGTAGCACCAGCAATAACAGTCGGTAGATGGG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	ATCCGTCGCGGCGCTGGTAAACCATGAATTTT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CCAGTGTATGAATCAGAAAATGAAGTATAAAA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TCCTGCGCGTATCCAGCCGTCCAGATGTTTCG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TGCGTTATCTGGAACATCGATTTCTATCGTGA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CTCCGAGACTCTATGCGCAGAAAGATAGAAAG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	ACGCCATACTCCCAGCATATTGATGCTGGTCG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	AACGTTGCCCTGTGCATTGATGCGGCCAAAAA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TTCGAAAAAATAATCCCCATCCATTTCATGCA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	GCGCGCTCAATACCGTCAGGAATAAGCCCCAG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CAACCGGATAGACAGCATTTTTCGTTGAGACT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TTATTAAATAACCAAAATATGGTTATATTCGA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CTGATACTCATGCCCAGGTCGGAACGGATCAC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	AGCTTGCCGCCAACCATGCGATCACTGTCGAA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TTCTCTAACGCCGAAGCCAGCTTTTCATTCGT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	ATCTCTTAGTGCTACGGTCATGCTCATTCCCC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TTACAGCTACCTATGGAACGGAACGAGAGTTA
CGGTTTATCCCCGCTGGCGCGGGGAACTC

>NZ_CP053582|2|1|3153995-3155363|PILER-CR
GTTTATCCCCGCTGGCGCGGGGAACTCTC	GGTCCACTGAAGCACCTCTTGAAAGAAGCGCG
GTTTATCCCCGCTGGCGCGGGGAACTCTA	ACGAACGGTGGCCTGTCTGTTTCCTGTTTGCG
GTTTATCCCCGCTGGCGCGGGGAACTCGA	TCGTTCTGCGTCACTTTCCCCGCATTTAACCG
GTTTATCCCCGCTGGCGCGGGGAACTCAG	TTGTGCTACCCGAACCGATTGTTACCAAACCG
GTTTATCCCCGCTGGCGCGGGGAACTCCC	AGCCACTGCCGGAAACTACGCTCATTCCGCCG
GTTTATCCCCGCTGGCGCGGGGAACTCTG	TAGCACCAGCAATAACAGTCGGTAGATGGGCG
GTTTATCCCCGCTGGCGCGGGGAACTCAT	CCGTCGCGGCGCTGGTAAACCATGAATTTTCG
GTTTATCCCCGCTGGCGCGGGGAACTCCC	AGTGTATGAATCAGAAAATGAAGTATAAAACG
GTTTATCCCCGCTGGCGCGGGGAACTCTC	CTGCGCGTATCCAGCCGTCCAGATGTTTCGCG
GTTTATCCCCGCTGGCGCGGGGAACTCTG	CGTTATCTGGAACATCGATTTCTATCGTGACG
GTTTATCCCCGCTGGCGCGGGGAACTCCT	CCGAGACTCTATGCGCAGAAAGATAGAAAGCG
GTTTATCCCCGCTGGCGCGGGGAACTCAC	GCCATACTCCCAGCATATTGATGCTGGTCGCG
GTTTATCCCCGCTGGCGCGGGGAACTCAA	CGTTGCCCTGTGCATTGATGCGGCCAAAAACG
GTTTATCCCCGCTGGCGCGGGGAACTCTT	CGAAAAAATAATCCCCATCCATTTCATGCACG
GTTTATCCCCGCTGGCGCGGGGAACTCGC	GCGCTCAATACCGTCAGGAATAAGCCCCAGCG
GTTTATCCCCGCTGGCGCGGGGAACTCCA	ACCGGATAGACAGCATTTTTCGTTGAGACTCG
GTTTATCCCCGCTGGCGCGGGGAACTCTT	ATTAAATAACCAAAATATGGTTATATTCGACG
GTTTATCCCCGCTGGCGCGGGGAACTCCT	GATACTCATGCCCAGGTCGGAACGGATCACCG
GTTTATCCCCGCTGGCGCGGGGAACTCAG	CTTGCCGCCAACCATGCGATCACTGTCGAACG
GTTTATCCCCGCTGGCGCGGGGAACTCTT	CTCTAACGCCGAAGCCAGCTTTTCATTCGTCG
GTTTATCCCCGCTGGCGCGGGGAACTCAT	CTCTTAGTGCTACGGTCATGCTCATTCCCCCG
GTTTATCCCCGCTGGCGCGGGGAACTCTT	ACAGCTACCTATGGAACGGAACGAGAGTTACG
GTTTATCCCCGCTGGCGCGGGGAACTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP053582.1\|WP_079824583.1\|3152931_3153978_+\|aminopeptidase	unknown	unknown	gnl\|CDD\|182299
NZ_CP053582.1\|WP_079803121.1\|3157834_3158569_-\|phosphoadenosine-phosphosulfate-reductase	unknown	unknown	gnl\|CDD\|234997
NZ_CP053582.1\|WP_079803126.1\|3163721_3164036_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053582.1\|WP_023187404.1\|3151772_3152681_-\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
NZ_CP053582.1\|WP_001219241.1\|3147647_3148127_-\|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase	unknown	unknown	gnl\|CDD\|178851
NZ_CP053582.1\|WP_000517480.1\|3148855_3149167_-\|cell-division-protein-FtsB	unknown	unknown	gnl\|CDD\|179156
NZ_CP053582.1\|WP_079803128.1\|3164470_3165256_-\|DUF4225-domain-containing-protein	unknown	unknown	gnl\|CDD\|372865
NZ_CP053582.1\|WP_079824584.1\|3156791_3157745_+\|SPI-1-type-III-secretion-system-effector-SopD	unknown	unknown	gnl\|CDD\|185277
NZ_CP053582.1\|WP_079824585.1\|3160380_3162180_-\|NADPH-dependent-assimilatory-sulfite-reductase-flavoprotein-subunit	unknown	unknown	gnl\|CDD\|182862
NZ_CP053582.1\|WP_079824582.1\|3148126_3148837_-\|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|234670
NZ_CP053582.1\|WP_171804779.1\|3155376_3156393_+\|CRISPR-associated-helicase-Cas3'	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|182031
NZ_CP053582.1\|WP_079824581.1\|3146601_3147651_-\|tRNA-pseudouridine(13)-synthase-TruD	unknown	unknown	gnl\|CDD\|234884
NZ_CP053582.1\|WP_001221536.1\|3145859_3146621_-\|5'/3'-nucleotidase-SurE	unknown	unknown	gnl\|CDD\|234732
NZ_CP053582.1\|WP_079803125.1\|3162924_3163596_-\|7-carboxy-7-deazaguanine-synthase-QueE	unknown	unknown	gnl\|CDD\|275126
NZ_CP053582.1\|WP_079824587.1\|3164141_3164468_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP053582.1\|WP_079803122.1\|3158668_3160381_-\|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit	unknown	unknown	gnl\|CDD\|237402
NZ_CP053582.1\|WP_023187406.1\|3149731_3150337_-\|adenylyl-sulfate-kinase	unknown	unknown	gnl\|CDD\|179661
NZ_CP053582.1\|WP_023187407.1\|3149357_3149681_-\|DUF3561-family-protein	unknown	unknown	gnl\|CDD\|371891
NZ_CP053582.1\|WP_023187405.1\|3150323_3151763_-\|sulfate-adenylyltransferase-subunit-CysN	unknown	unknown	gnl\|CDD\|235349
NZ_CP053582.1\|WP_079824586.1\|3162484_3162847_+\|6-carboxytetrahydropterin-synthase-QueD	unknown	unknown	gnl\|CDD\|238264

Protein	Function_ID	Function_description	E-value
NZ_CP053582.1\|WP_079824583.1\|3152931_3153978_+\|aminopeptidase	gnl\|CDD\|182299	PRK10199, PRK10199, alkaline phosphatase isozyme conversion aminopeptidase; Provisional.	0
NZ_CP053582.1\|WP_079803121.1\|3157834_3158569_-\|phosphoadenosine-phosphosulfate-reductase	gnl\|CDD\|234997	PRK02090, PRK02090, phosphoadenylyl-sulfate reductase.	3.86554e-136
NZ_CP053582.1\|WP_023187404.1\|3151772_3152681_-\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
NZ_CP053582.1\|WP_001219241.1\|3147647_3148127_-\|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase	gnl\|CDD\|178851	PRK00084, ispF, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; Reviewed.	3.77176e-104
NZ_CP053582.1\|WP_000517480.1\|3148855_3149167_-\|cell-division-protein-FtsB	gnl\|CDD\|179156	PRK00888, ftsB, cell division protein FtsB; Reviewed.	1.08865e-64
NZ_CP053582.1\|WP_079803128.1\|3164470_3165256_-\|DUF4225-domain-containing-protein	gnl\|CDD\|372865	pfam13988, DUF4225, Protein of unknown function (DUF4225). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 182 and 282 amino acids in length.	3.31882e-35
NZ_CP053582.1\|WP_079824584.1\|3156791_3157745_+\|SPI-1-type-III-secretion-system-effector-SopD	gnl\|CDD\|185277	PRK15379, PRK15379, type III secretion system effector SopD.	0
NZ_CP053582.1\|WP_079824585.1\|3160380_3162180_-\|NADPH-dependent-assimilatory-sulfite-reductase-flavoprotein-subunit	gnl\|CDD\|182862	PRK10953, cysJ, NADPH-dependent assimilatory sulfite reductase flavoprotein subunit.	0
NZ_CP053582.1\|WP_079824582.1\|3148126_3148837_-\|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase	gnl\|CDD\|234670	PRK00155, ispD, D-ribitol-5-phosphate cytidylyltransferase.	2.69974e-118
NZ_CP053582.1\|WP_171804779.1\|3155376_3156393_+\|CRISPR-associated-helicase-Cas3'	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	8.31416e-50
NZ_CP053582.1\|WP_079824581.1\|3146601_3147651_-\|tRNA-pseudouridine(13)-synthase-TruD	gnl\|CDD\|234884	PRK00984, truD, tRNA pseudouridine synthase D; Reviewed.	0
NZ_CP053582.1\|WP_001221536.1\|3145859_3146621_-\|5'/3'-nucleotidase-SurE	gnl\|CDD\|234732	PRK00346, surE, 5'(3')-nucleotidase/polyphosphatase; Provisional.	6.02604e-147
NZ_CP053582.1\|WP_079803125.1\|3162924_3163596_-\|7-carboxy-7-deazaguanine-synthase-QueE	gnl\|CDD\|275126	TIGR04322, organic_radical_activating_enzyme, putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE. Members of this radical SAM domain protein family appear to be the E. coli form of the queuosine biosynthesis protein QueE. QueE is involved in making preQ0 (7-cyano-7-deazaquanine), a precursor of both the bacterial/eukaryotic modified tRNA base queuosine and the archaeal modified base archaeosine. Members occur in species that lack known forms of QueE but usually are not found in queuosine biosynthesis operons. Members of this family tend to form bi-directional best hit matches to members of known (TIGR03365) and putative (TIGR03963) QueE families from other lineages.	4.48739e-155
NZ_CP053582.1\|WP_079803122.1\|3158668_3160381_-\|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit	gnl\|CDD\|237402	PRK13504, PRK13504, NADPH-dependent assimilatory sulfite reductase hemoprotein subunit.	0
NZ_CP053582.1\|WP_023187406.1\|3149731_3150337_-\|adenylyl-sulfate-kinase	gnl\|CDD\|179661	PRK03846, PRK03846, adenylylsulfate kinase; Provisional.	2.79913e-143
NZ_CP053582.1\|WP_023187407.1\|3149357_3149681_-\|DUF3561-family-protein	gnl\|CDD\|371891	pfam12084, DUF3561, Protein of unknown function (DUF3561). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 110 amino acids in length.	3.02901e-47
NZ_CP053582.1\|WP_023187405.1\|3150323_3151763_-\|sulfate-adenylyltransferase-subunit-CysN	gnl\|CDD\|235349	PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional.	0
NZ_CP053582.1\|WP_079824586.1\|3162484_3162847_+\|6-carboxytetrahydropterin-synthase-QueD	gnl\|CDD\|238264	cd00470, PTPS, 6-pyruvoyl tetrahydropterin synthase (PTPS). Folate derivatives are essential cofactors in the biosynthesis of purines, pyrimidines, and amino acids, as well as formyl-tRNA. Mammalian cells are able to utilize pre-formed folates after uptake by a carrier-mediated active transport system. Most microbes and plants lack this system and must synthesize folates de novo from guanosine triphosphate. One enzyme from this pathway is PTPS which catalyzes the conversion of dihydroneopterin triphosphate to 6-pyruvoyl tetrahydropterin. The functional enzyme is a hexamer of identical subunits.	4.89743e-58

>NZ_CP053582.1|WP_079824583.1|3152931_3153978_+|aminopeptidase
MFSATRRSTVILALGVGFILPVQAASPQPGEIANIQARHIATVFPGRMTGSPAEMLSADYLRQQFARMGYQSDIRTFNSRFIYTTKDNRKNWHNVTGSTVIAAHEGRVPQQIIIMAHLDTYAPQSDADVDANLGGLTLQGMDDNAAGLGVMLELAARLKDIPTHYGIRFIATSGEEEGKLGAENLLKRMSDTEKKNTLLVINLDNLIVGDKLYFNSGKNTPEAVRTLTRDRALAIAHHHGIAASTNPGLNPAYPEGTGCCNDAEVFDKSGMSVLSVEATNWSLGKKDGYQQRVKNASFPNGNSWHDVRLDNQQHIDKALPGRIERRSRDVVRIMLPLVKELAKAEKTS
>NZ_CP053582.1|WP_023187404.1|3151772_3152681_-|sulfate-adenylyltransferase-subunit-CysD
MDQKRLTHLRQLEAESIHIIREVAAEFANPVMLYSIGKDSSVMLHLARKAFYPGTLPFPLLHVDTGWKFREMYAFRDRTASAYGCELLVHKNPEGVAMGINPFVHGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWRNYNGQINKGESIRVFPLSNWTEQDIWQYIWLENIHIVPLYLAAERPVLERDGMLMMVDDDRIDLQPGEVIKKRMVRFRTLGCWPLTGAVESRAQTLPEIIEEMLVSTTSERQGRVIDRDQAGSMELKKRQGYF
>NZ_CP053582.1|WP_023187405.1|3150323_3151763_-|sulfate-adenylyltransferase-subunit-CysN
MNTTLAQQIAHEGGVEAWMTAQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLDQTRRHSFISTLLGIKYLVVAINKMDLVDYSEETFARIREDYLTFAEKLPGDLDIRFVPLSALEGDNVAAQSANMRWYSGPTLLEVLETVEIQRSVDTQPMRFPVQYVNRPNLDFRGYAGTLASGSVKVGQRVKVLPSGVESSVARIVTFDGDREEAYAGEAITLVLNDEIDISRGDLLLAANEALAPTQHAAIDVVWMAEQPLTPGQSYDVKLAGKKTRARIETIRYQIDINNLTQRDVESLPLNGIGLVDMIFDEPIALDVYQQNPVTGGLIFIDRLSNVTVGAGMVRESVEHGAMPPVEYGAFERELNALIRRHFPHWDARDLPGDKYGAV
>NZ_CP053582.1|WP_023187406.1|3149731_3150337_-|adenylyl-sulfate-kinase
MALYDKNVVWHPHPVTVAAREQLHGHRGVVLWFTGLSGSGKSTIAGALEEALHHRGVSTYLLDGDNVRHGLCRDLDFSDADRKENIRRVGEVASLMADAGLIVLTAFISPHRAERQLVQERVGHDRFIEIYVDTPLVICEQRDPKGLYKKARAGELRHFTGIDAIYEAPESPQVHLNGEQLVTNLVSQLLDLLRRRDIIRS
>NZ_CP053582.1|WP_023187407.1|3149357_3149681_-|DUF3561-family-protein
MRNSHNITFTRSDAFIVDDDTTRSLPGAVVGFVSWLLALGIPFLLYGPNTLFFFLYTWPFFLALMPVSVVIGIALHLLVKGKILFSLTFTLLTVGAFFGALFIWLLG
>NZ_CP053582.1|WP_000517480.1|3148855_3149167_-|cell-division-protein-FtsB
MGKLTLLLLALLVWLQYSLWFGKNGIHDYSRVNDDVVAQQATNAKLKARNDQLFAEIDDLNGGQEAIEERARNELSMTKPGETFYRLVPDASKRAATAGQTHR
>NZ_CP053582.1|WP_079824582.1|3148126_3148837_-|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase
MAATLLDVCAVVPAAGFGRRMQTECPKQYLSIGNKTILEHSVHALLAHPRVTRVVIAISPGDNRFAQLPLANHPQITVVDGGNERADSVLAGLQAVAQASWVLVHDAARPCLHQDDLARLLAISENSRVGGILASPVRDTMKRGEPGKTAIAHTVERADLWHALTPQFFPRELLHDCLTRALHEGATITDEASALEYCGFHPALVEGRADNIKVTRPEDLALAEFYLTRTIHQEKA
>NZ_CP053582.1|WP_001219241.1|3147647_3148127_-|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRIFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLMKAAK
>NZ_CP053582.1|WP_079824581.1|3146601_3147651_-|tRNA-pseudouridine(13)-synthase-TruD
MTEFDNLTWLHGKPQGSGLLKANPEDFVVVEDLGFTPDGEGEHILLRILKNGCNTRFVADALAKFLKIHAREVSFAGQKDKHAVTEQWLCVRVPGKEMPDFSAFQLEGCKVLEYARHKRKLRLGALKGNAFTLVLREISDRRDVEARLQAIRDGGVPNYFGAQRFGIGGNNLQGALRWAQSDAPVRDRNKRSFWLSAARSALFNQIVHQRLKKPDFNQVVDGDALQLAGRGSWFVATSEELPELQRRVDEKELMITASLPGSGEWGTQREALAFEQEAIAQETMLQSLLLREKVEASRRAMLLYPQQLSWNWWDDVTVELRFWLPAGSFATSVVRELINTMGDYAHIAE
>NZ_CP053582.1|WP_001221536.1|3145859_3146621_-|5'/3'-nucleotidase-SurE
MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFDNGDIAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPALAVSLDGYQHYDTAAAVTCALLRGLSREPLRTGRILNVNVPDLPLAQIKGIRVTRCGSRHPADKVIPQEDPRGNTLYWIGPPGDKYDAGPDTDFAAVDEGYVSVTPLHVDLTAHSAHDVVSDWLDSVGVGTQW
>NZ_CP053582.1|WP_171804779.1|3155376_3156393_+|CRISPR-associated-helicase-Cas3'
MVAAGQCVCWIRNTVDDAREIYQQLLHEGLIPEQDLLLFHSRFAFADRIAIEDKTLNWFGNSAPVSERRGKVLIATQVVEQSLDLDFDWMISDLAPIDLLIQRAGRLQRHIRDAHGQRQSALPDGRQPPILHILAPEWQEHAEEGWLGQELKGTGFVYADHACLWRTQALLRQYGEIRMPDNARDLVDGVYEQKIAAPADLQTFSDIAFGKVLSQRSVAAQNLLRHDLGYDRESSDFLWDKDREFSTRLGEESVDVYLARKGIDGQLRPLVDEIDFCWEKSRLSVRKSWWQKNSGTFQCPDEETLTCFRKRHHRPSGHIVLVSEMGEASYYSKRFGLV
>NZ_CP053582.1|WP_079824584.1|3156791_3157745_+|SPI-1-type-III-secretion-system-effector-SopD
MPVTLNFGNHHNYTLNESRLSHLLSADKEKATRIGSWDKLQDHFRSERKDHALEVLYSIIHGQGRGEPGEMEVNIEDMGKIYAFKNLQHLACPAHQDLFKIKMDASQTQFLFMVGDTVISQSRIQDILNLSDNVVVESMNNEERQLFLQICEIIGSNIAWHPELLQASVSTLRKEVTSNVQIKEAVYGLVRPAEAPDHQFVEWQSSLSDDEKSMLTCINAGSFDPITQFCKIGYQEVQGEVAFCMMHPCISYLLHTYSPFAEFKETNAGFLNELNQDYKDYHKNKVFIDAILEKIYLTHERSLHIGENECSRNILLA
>NZ_CP053582.1|WP_079803121.1|3157834_3158569_-|phosphoadenosine-phosphosulfate-reductase
MSKLDLNALNDLPKVERVMALAETNSQLEKLSAEERVAWALENLPGEYVLSSSFGMQAAVSLHLVNQISPDIPVILTDTGYLFPETYQFIDELTDKLNLNLKVYRAKESAAWQEARYGKLWEQGVEGIEQYNEINKVEPMNRALEELNAQTWFAGLRREQSGSRAHLPVLAIQRRVFKVLPIIDWDNRTVYQYLQKQGLKYHPLWDQGYLSVGDTHTTRKWEPGMAEEETRFFGLKRECGLHEG
>NZ_CP053582.1|WP_079803122.1|3158668_3160381_-|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit
MSEKHPGPLVVEGKLSDAERMKLESNYLRGTIAEDLNDGLTGGFKGDNFLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPGGVITTKQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLHSVGLDALATANDMNRNVLCTSNPYESQLHADAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTDEEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAENGKLVGFNLLVGGGLSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGLETFKAEVERRAGITFEPIRPYKFTGRGDRIGWVKGIDDNWHLTLFIENGRILDYPGRPLKAGLLEIAKIHKGGFRITANQNLIIAGVPESQKAKIEKLARDHGLMNAVKPQRENSMACVSFPTCPLAMAEAERFLPSFTDKVEAVMTKHGVGDEHIVLRVTGCPNGCGRAMLAEIGLVGKAPGRYNLHLGGNRIGSRIPRMYKENITEPEILASLDELIGRWAKEREAGEGFGDFTVRAGIIRPVLDPARDFWE
>NZ_CP053582.1|WP_079824585.1|3160380_3162180_-|NADPH-dependent-assimilatory-sulfite-reductase-flavoprotein-subunit
MTTQAPLSNLLPLSPEQLARLQAATTDLTPAQLAWVSGYFWGVLNHQPGANVTVPAPAVEMPGITLISASQTGNARRVAEALSDDLIAAKLNVTLINAGDYKFKQIANEKLLVVVASTQGEGEPAEEAVALHKFLFSKKAPKLDNTAFAVFSLGDTSYEFFCQAGKDFDSKLAELGGERLLDRVDADVEYQAAAAQWRARLVDVLKARAPAAPSVQAVASGAVNDVHSSPYTKEAPLTATLAVNQKITGRESEKDVRHIEIDLGDSGLRYQPGDALGVWYQNDPALVKEIVELLWLKGDEPVTVEGKTLPLAEALQWHFELTVNTANIVENYATLTRSESLLPLVGDKAQLQYYAAATPIVDMLRFSPAQLDADALVGLLRPLTPRLYSIASSQAEVNNEVHLTVGVVRYDIEGRARAGGASSFLADRVDDESEVRVFIEHNDNFRLPANPQTPVIMIGPGTGIAPFRAFMQQRAAEDAPGRNWLFFGNPHFTEDFLYQVEWQRYVKEGLLSRIDLAWSRDQKEKIYVQDKLREQGAELWRWINDGAHIYVCGDANRMAKDVEQALLEVIAEFGGMDLESADEYLSELRVERRYQRDVY
>NZ_CP053582.1|WP_079824586.1|3162484_3162847_+|6-carboxytetrahydropterin-synthase-QueD
MSTTLYKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPTYDRLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCVYRGQ
>NZ_CP053582.1|WP_079803125.1|3162924_3163596_-|7-carboxy-7-deazaguanine-synthase-QueE
MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWDKLEDREVSLYSILAKTKESDKWGAASSEDLLAVIQRQGYTARHVVITGGEPCIHDLMPLTSLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKVNMRGGYNVLSQALERANEIKHPVGRIRDIEALDELLTTLSDDKPRIIALQPISQKEDATRLCIDTCIARNWRLSMQTHKYLNIA
>NZ_CP053582.1|WP_079803126.1|3163721_3164036_-|hypothetical-protein
MDNDIKKILVNAGMKEKNVRFLLKLAGKKNISVSRAFLLYAWKYYAWGGALFFSMLFPATMGGFELFIIYILCCLALALISVFFNSFFINLVWSIKVQIKLIGK
>NZ_CP053582.1|WP_079824587.1|3164141_3164468_-|hypothetical-protein
MESQITVEKLVALGLTEYKAEHLIKFAQDENLSLQKAYYESHCRIFRADMALLSAFLFFFVSILIGGDRDGLFVLLFLALLYGAGELCFRFHKGCWERLRIYCALKKL
>NZ_CP053582.1|WP_079803128.1|3164470_3165256_-|DUF4225-domain-containing-protein
MSSYGLMSLQREKEKIDQLVFDIGFQYRHDPAMRSKYMIEEHRVTSDYLEKYQYGKLDFGRAMDRLREHHTSLIKYHIHLRMGSIKIYAIAQKERNATSLTILSLKGVGFAGGLFQILGGIGFCVKDIRSACGKFGVPLIIQGGENSYENGYYLFTHKEPTDIPIRHAYRYIANLLGGDDKTGNIAFSSVDIALSVGSLGSLTHIDGARKLFYYIREDFIRGWRAMGVAGIGTELVGDASSGFSIYQVVSQPETNWSELKD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	CP053410	Salmonella enterica strain 2014K-0203 plasmid unnamed, complete sequence	17712-17743	0	1.0
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	CP053410	Salmonella enterica strain 2014K-0203 plasmid unnamed, complete sequence	17712-17743	0	1.0
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	KP682381	Escherichia phage PA28, complete genome	20073-20104	1	0.969
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MK972697	Salmonella phage SF10, complete genome	36172-36203	1	0.969
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	AP012533	Stx2-converting phage Stx2a_F723 proviral DNA, complete genome	21566-21597	1	0.969
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MT225101	Escherichia phage Lys19259Vzw, complete genome	21677-21708	1	0.969
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	KU977419	Stx1 converting phage AU5Stx1, complete genome	19326-19357	1	0.969
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MK972696	Salmonella phage Si3 KFo-2019, complete genome	36037-36068	1	0.969
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	NC_049944	Stx2-converting phage Stx2a_WGPS8 proviral DNA, complete genome	17312-17343	1	0.969
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	JQ011316	Escherichia phage TL-2011a, partial genome	18778-18809	1	0.969
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MK972695	Salmonella phage SI5, complete genome	691-722	1	0.969
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	NC_049925	Stx converting phage vB_EcoS_P27, complete genome	18934-18965	1	0.969
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MK972688	Salmonella phage SI8, complete genome	39394-39425	1	0.969
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MK972689	Salmonella phage SF6, complete genome	26074-26105	1	0.969
NZ_CP053582_2	2.21\|3155242\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155242-3155273	32	NZ_KP763470	Salmonella enterica subsp. enterica serovar Typhimurium strain L946 plasmid pSTM_Phi, complete sequence	44236-44267	1	0.969
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	KP682381	Escherichia phage PA28, complete genome	20073-20104	1	0.969
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MK972697	Salmonella phage SF10, complete genome	36172-36203	1	0.969
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	AP012533	Stx2-converting phage Stx2a_F723 proviral DNA, complete genome	21566-21597	1	0.969
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MT225101	Escherichia phage Lys19259Vzw, complete genome	21677-21708	1	0.969
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	KU977419	Stx1 converting phage AU5Stx1, complete genome	19326-19357	1	0.969
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MK972696	Salmonella phage Si3 KFo-2019, complete genome	36037-36068	1	0.969
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	NC_049944	Stx2-converting phage Stx2a_WGPS8 proviral DNA, complete genome	17312-17343	1	0.969
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	JQ011316	Escherichia phage TL-2011a, partial genome	18778-18809	1	0.969
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MK972695	Salmonella phage SI5, complete genome	691-722	1	0.969
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	NC_049925	Stx converting phage vB_EcoS_P27, complete genome	18934-18965	1	0.969
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MK972688	Salmonella phage SI8, complete genome	39394-39425	1	0.969
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MK972689	Salmonella phage SF6, complete genome	26074-26105	1	0.969
NZ_CP053582_2	2.43\|3155244\|32\|NZ_CP053582\|PILER-CR	3155244-3155275	32	NZ_KP763470	Salmonella enterica subsp. enterica serovar Typhimurium strain L946 plasmid pSTM_Phi, complete sequence	44236-44267	1	0.969
NZ_CP053582_2	2.1\|3154022\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154022-3154053	32	CP051275	Salmonella phage SW-37, complete genome	24319-24350	2	0.938
NZ_CP053582_2	2.1\|3154022\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154022-3154053	32	NC_028696	Salmonella phage SEN22, complete genome	23380-23411	2	0.938
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	AF034975	Bacteriophage H-19B essential recombination function protein (erf), kil protein (kil), regulatory protein cIII (cIII), protein gp17 (17), N protein (N), cI protein (cI), cro protein (cro), cII protein (cII), O protein (O), P protein (P), ren protein (ren), nin orf-58-A, nin orf-58-B, Roi (roi), nin orf-204, nin orf-59, Q protein (Q), Shiga-like toxin A subunit (slt-IA), Shiga-like toxin B subunit (slt-IB), putative holin protein (S), R protein (R), and Rz protein (Rz) genes, complete cds	9289-9320	2	0.938
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	JQ086376	Enterobacteria phage HK630, complete genome	40332-40363	2	0.938
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	NC_019705	Enterobacteria phage mEpX2, complete genome	32115-32146	2	0.938
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	NC_019711	Enterobacteria phage HK629, complete genome	40015-40046	2	0.938
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	AP005153	Stx1 converting phage DNA, complete genome	49090-49121	2	0.938
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	KY979108	Escherichia phage ECP1, complete genome	3614-3645	2	0.938
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	AP000400	Enterobacteria phage VT1-Sakai genomic DNA, prophage inserted region in Escherichia coli O157:H7	40059-40090	2	0.938
NZ_CP053582_2	2.23\|3154024\|32\|NZ_CP053582\|PILER-CR	3154024-3154055	32	CP051275	Salmonella phage SW-37, complete genome	24319-24350	2	0.938
NZ_CP053582_2	2.23\|3154024\|32\|NZ_CP053582\|PILER-CR	3154024-3154055	32	NC_028696	Salmonella phage SEN22, complete genome	23380-23411	2	0.938
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	AF034975	Bacteriophage H-19B essential recombination function protein (erf), kil protein (kil), regulatory protein cIII (cIII), protein gp17 (17), N protein (N), cI protein (cI), cro protein (cro), cII protein (cII), O protein (O), P protein (P), ren protein (ren), nin orf-58-A, nin orf-58-B, Roi (roi), nin orf-204, nin orf-59, Q protein (Q), Shiga-like toxin A subunit (slt-IA), Shiga-like toxin B subunit (slt-IB), putative holin protein (S), R protein (R), and Rz protein (Rz) genes, complete cds	9289-9320	2	0.938
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	JQ086376	Enterobacteria phage HK630, complete genome	40332-40363	2	0.938
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	NC_019705	Enterobacteria phage mEpX2, complete genome	32115-32146	2	0.938
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	NC_019711	Enterobacteria phage HK629, complete genome	40015-40046	2	0.938
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	AP005153	Stx1 converting phage DNA, complete genome	49090-49121	2	0.938
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	KY979108	Escherichia phage ECP1, complete genome	3614-3645	2	0.938
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	AP000400	Enterobacteria phage VT1-Sakai genomic DNA, prophage inserted region in Escherichia coli O157:H7	40059-40090	2	0.938
NZ_CP053582_2	2.1\|3154022\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154022-3154053	32	KC139516	Salmonella phage FSL SP-016, partial genome	43947-43978	3	0.906
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MK972693	Salmonella phage SI23, complete genome	9153-9184	3	0.906
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MG969415	UNVERIFIED: Salmonella phage GE_vB_TR, complete genome	6785-6816	3	0.906
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MK770415	Salmonella phage SF11, complete genome	12445-12476	3	0.906
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MK972694	Salmonella phage SE22, complete genome	30241-30272	3	0.906
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MK770414	Salmonella phage SE16, complete genome	16341-16372	3	0.906
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MH370364	Salmonella phage S107, complete genome	44558-44589	3	0.906
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MK972686	Salmonella phage SF3, complete genome	35795-35826	3	0.906
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MK972685	Salmonella phage SE10, complete genome	37014-37045	3	0.906
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MK972687	Salmonella phage SE1 (in:P22virus), complete genome	27288-27319	3	0.906
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MH370382	Salmonella phage S135, complete genome	45331-45362	3	0.906
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MH370383	Salmonella phage S137, complete genome	45333-45364	3	0.906
NZ_CP053582_2	2.16\|3154937\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154937-3154968	32	MK972692	Salmonella phage SE21, complete genome	29377-29408	3	0.906
NZ_CP053582_2	2.23\|3154024\|32\|NZ_CP053582\|PILER-CR	3154024-3154055	32	KC139516	Salmonella phage FSL SP-016, partial genome	43947-43978	3	0.906
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MK972693	Salmonella phage SI23, complete genome	9153-9184	3	0.906
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MG969415	UNVERIFIED: Salmonella phage GE_vB_TR, complete genome	6785-6816	3	0.906
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MK770415	Salmonella phage SF11, complete genome	12445-12476	3	0.906
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MK972694	Salmonella phage SE22, complete genome	30241-30272	3	0.906
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MK770414	Salmonella phage SE16, complete genome	16341-16372	3	0.906
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MH370364	Salmonella phage S107, complete genome	44558-44589	3	0.906
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MK972686	Salmonella phage SF3, complete genome	35795-35826	3	0.906
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MK972685	Salmonella phage SE10, complete genome	37014-37045	3	0.906
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MK972687	Salmonella phage SE1 (in:P22virus), complete genome	27288-27319	3	0.906
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MH370382	Salmonella phage S135, complete genome	45331-45362	3	0.906
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MH370383	Salmonella phage S137, complete genome	45333-45364	3	0.906
NZ_CP053582_2	2.38\|3154939\|32\|NZ_CP053582\|PILER-CR	3154939-3154970	32	MK972692	Salmonella phage SE21, complete genome	29377-29408	3	0.906
NZ_CP053582_1	1.3\|1964172\|30\|NZ_CP053582\|CRT	1964172-1964201	30	MN693215	Marine virus AFVG_25M456, complete genome	9251-9280	6	0.8
NZ_CP053582_1	1.1\|1964052\|30\|NZ_CP053582\|CRT	1964052-1964081	30	KC182543	Lactococcus lactis phage 645, complete genome	16313-16342	7	0.767
NZ_CP053582_1	1.1\|1964052\|30\|NZ_CP053582\|CRT	1964052-1964081	30	KC182542	Lactococcus phage 340, complete genome	16312-16341	7	0.767
NZ_CP053582_2	2.8\|3154449\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154449-3154480	32	MK387337	Vibrio phage ValB1MD, complete genome	102179-102210	7	0.781
NZ_CP053582_2	2.17\|3154998\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154998-3155029	32	NC_010371	Finegoldia magna ATCC 29328 plasmid pFMC, complete sequence	134928-134959	7	0.781
NZ_CP053582_2	2.17\|3154998\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154998-3155029	32	MH051913	Enterobacteria phage vB_EcoM_IME281, complete genome	38027-38058	7	0.781
NZ_CP053582_2	2.17\|3154998\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154998-3155029	32	MT611523	Escherichia phage DK-13, complete genome	50627-50658	7	0.781
NZ_CP053582_2	2.17\|3154998\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154998-3155029	32	AP014358	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C94, * SEQUENCING IN PROGRESS *	23777-23808	7	0.781
NZ_CP053582_2	2.18\|3155059\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155059-3155090	32	MN813684	Microbacterium phage Terij, complete genome	9922-9953	7	0.781
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	295268-295299	7	0.781
NZ_CP053582_2	2.30\|3154451\|32\|NZ_CP053582\|PILER-CR	3154451-3154482	32	MK387337	Vibrio phage ValB1MD, complete genome	102179-102210	7	0.781
NZ_CP053582_2	2.39\|3155000\|32\|NZ_CP053582\|PILER-CR	3155000-3155031	32	NC_010371	Finegoldia magna ATCC 29328 plasmid pFMC, complete sequence	134928-134959	7	0.781
NZ_CP053582_2	2.39\|3155000\|32\|NZ_CP053582\|PILER-CR	3155000-3155031	32	MH051913	Enterobacteria phage vB_EcoM_IME281, complete genome	38027-38058	7	0.781
NZ_CP053582_2	2.39\|3155000\|32\|NZ_CP053582\|PILER-CR	3155000-3155031	32	MT611523	Escherichia phage DK-13, complete genome	50627-50658	7	0.781
NZ_CP053582_2	2.39\|3155000\|32\|NZ_CP053582\|PILER-CR	3155000-3155031	32	AP014358	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C94, * SEQUENCING IN PROGRESS *	23777-23808	7	0.781
NZ_CP053582_2	2.40\|3155061\|32\|NZ_CP053582\|PILER-CR	3155061-3155092	32	MN813684	Microbacterium phage Terij, complete genome	9922-9953	7	0.781
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	295268-295299	7	0.781
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	254982-255013	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1486850-1486881	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1451527-1451558	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	254753-254784	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1553075-1553106	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1490072-1490103	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	250002-250033	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	248814-248845	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1055617-1055648	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	516098-516129	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	594445-594476	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	499933-499964	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1175583-1175614	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	129936-129967	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	714613-714644	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1037608-1037639	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	766984-767015	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	403311-403342	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	253916-253947	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	19560-19591	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1380661-1380692	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1486859-1486890	8	0.75
NZ_CP053582_2	2.6\|3154327\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154327-3154358	32	AF242738	Bacteriophage phi LC3, complete genome	22704-22735	8	0.75
NZ_CP053582_2	2.6\|3154327\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154327-3154358	32	NC_005822	Lactococcus phage phiLC3, complete genome	22704-22735	8	0.75
NZ_CP053582_2	2.6\|3154327\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154327-3154358	32	KX160220	Lactococcus phage Dub35A, complete genome	26465-26496	8	0.75
NZ_CP053582_2	2.8\|3154449\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154449-3154480	32	NC_018686	Bacillus thuringiensis MC28 plasmid pMC183, complete sequence	92521-92552	8	0.75
NZ_CP053582_2	2.14\|3154815\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154815-3154846	32	NZ_CP047432	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-4, complete sequence	17893-17924	8	0.75
NZ_CP053582_2	2.14\|3154815\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154815-3154846	32	NZ_CP046370	Spiroplasma citri strain BR12 plasmid pScpBR12-2, complete sequence	16359-16390	8	0.75
NZ_CP053582_2	2.14\|3154815\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154815-3154846	32	NZ_CP047441	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-4, complete sequence	14538-14569	8	0.75
NZ_CP053582_2	2.14\|3154815\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154815-3154846	32	NZ_CP053311	Spiroplasma citri strain C5 plasmid pScpC5-7, complete sequence	20802-20833	8	0.75
NZ_CP053582_2	2.17\|3154998\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154998-3155029	32	MN693026	Marine virus AFVG_117M72, complete genome	66637-66668	8	0.75
NZ_CP053582_2	2.17\|3154998\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154998-3155029	32	NZ_CP028244	Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence	16520-16551	8	0.75
NZ_CP053582_2	2.17\|3154998\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154998-3155029	32	NZ_CP054261	Lactobacillus plantarum strain TCI507 plasmid unnamed2	1676-1707	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	CP007642	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence	83461-83492	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_014312	Klebsiella pneumoniae plasmid pKP048, complete sequence	28939-28970	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KX147633	Citrobacter freundii strain AMA332 plasmid pT1, complete sequence	6832-6863	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KX709966	Pseudomonas aeruginosa strain IP40a plasmid pIP40a, complete sequence	143076-143107	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KX786648	Enterobacter cloacae strain B557 plasmid pB557-NDM, complete sequence	121685-121716	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KX869741	Enterobacter cloacae strain 20130723 plasmid R222, complete sequence	113151-113182	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KY399978	Vibrio cholerae O139 strain ICDC-211 plasmid pVC211, complete sequence	127230-127261	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KY986974	Citrobacter freundii strain 112298 plasmid p112298-tetA, complete sequence	170338-170369	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KY887592	Citrobacter freundii strain Cf52 plasmid pCf52, complete sequence	200489-200520	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KY887593	Citrobacter freundii strain Cf53 plasmid pCf53, complete sequence	181606-181637	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KY887594	Klebsiella pneumoniae strain Kp55 plasmid pKp55, complete sequence	196694-196725	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_AP023051	Citrobacter portucalensis strain IOMTU157 plasmid pIOMTU157, complete sequence	152992-153023	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_022652	Klebsiella pneumoniae strain CRE114 plasmid pIMP-PH114, complete sequence	131848-131879	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP033514	Vibrio cholerae strain E4 plasmid pVCR94, complete sequence	78291-78322	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP009414	Salmonella enterica strain CFSAN007428 isolate N11150 plasmid pCFSAN007428_01, complete sequence	146082-146113	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KU726616	Salmonella enterica subsp. enterica serovar Stanley strain LS001 plasmid pHS36-NDM, complete sequence	18794-18825	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KX458222	Klebsiella pneumoniae strain B2 plasmid pB2-1, complete sequence	153328-153359	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KX636095	Klebsiella pneumoniae strain RJ119 plasmid pRJ119-NDM1, complete sequence	12505-12536	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KX815983	Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence	135906-135937	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KT997783	Escherichia coli strain Y5 plasmid pECY53, complete sequence	133285-133316	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KX156772	Escherichia coli strain K-12 plasmid IP40a, complete sequence	145947-145978	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KU302802	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence	112270-112301	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KT935446	Klebsiella pneumoniae strain Kp2964 plasmid 2964TF, complete sequence	150243-150274	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KX156773	Escherichia coli strain K-12 plasmid R16a, complete sequence	154270-154301	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KX029331	Klebsiella pneumoniae strain K-109-R plasmid unnamed, complete sequence	136562-136593	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KU302801	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence	110611-110642	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP035548	Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence	133034-133065	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP009412	Salmonella enterica strain CFSAN007426 isolate N19767 plasmid pCFSAN007426_01, complete sequence	84743-84774	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP009411	Salmonella enterica strain CFSAN007425 isolate 22697 plasmid pCFSAN007425_01, complete sequence	147655-147686	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP009413	Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence	155846-155877	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KJ588779	Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pNDM-US-2, complete sequence	118757-118788	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KJ909290	Aeromonas salmonicida subsp. salmonicida strain 2004-05MF26 plasmid pSN254b, complete sequence	132199-132230	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KM083064	Vibrio cholerae strain ICDC-1447 plasmid pVC1447, complete sequence	104893-104924	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KR559888	Klebsiella pneumoniae strain Kpn642 plasmid pKP-Gr642, complete sequence	140141-140172	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KR559889	Klebsiella pneumoniae strain Kpn8143 plasmid pKP-Gr8143, complete sequence	134289-134320	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KJ802405	Providencia stuartii isolate GN576 plasmid pNDM-PstGN576, complete sequence	127924-127955	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KP742988	Salmonella enterica subsp. enterica serovar Senftenberg strain BCH02406 plasmid pNDM-SAL, complete sequence	70788-70819	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KM670336	Salmonella enterica subsp. enterica serovar Senftenberg strain SRC119 plasmid pSRC119-A/C, complete sequence	125762-125793	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KR091911	Salmonella enterica subsp. enterica serovar Corvallis strain RH-1238 plasmid pRH-1238, complete sequence	49389-49420	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KP975074	Citrobacter freundii strain MRSN11938 plasmid pMRVIM0912, complete sequence	90001-90032	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KR559890	Enterobacter cloacae strain Ecl4873 plasmid pEcl-Gr4873, complete sequence	135124-135155	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KJ802404	Escherichia coli isolate GN568 plasmid pNDM-EcoGN568, complete sequence	146789-146820	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KP056256	Escherichia coli strain YDC637 plasmid pYDC637, complete sequence	178175-178206	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KP345882	Escherichia coli strain BK32533 plasmid pBK32533, complete sequence	77624-77655	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	AP014611	Serratia marcescens plasmid p11663 DNA, complete sequence, strain: 11663	134491-134522	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP028197	Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence	386243-386274	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP041027	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence	122212-122243	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP025141	Klebsiella pneumoniae strain KP1768 plasmid KP1768_p1, complete sequence	120645-120676	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP032391	Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_1, complete sequence	93699-93730	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP017987	Klebsiella pneumoniae strain 825795-1 plasmid unnamed2, complete sequence	13252-13283	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP022126	Klebsiella pneumoniae strain DHQP1605752_NV plasmid p1605752AC2, complete sequence	131049-131080	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP017387	Klebsiella pneumoniae strain KP36 plasmid 2, complete sequence	89223-89254	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP047308	Citrobacter freundii strain L75 plasmid pCf75, complete sequence	126280-126311	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP045742	Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence	44964-44995	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP013324	Klebsiella pneumoniae strain CAV1193 plasmid pCAV1193-166, complete sequence	86279-86310	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP034402	Escherichia coli strain CRE10 plasmid pCRE10.2, complete sequence	60866-60897	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP010373	Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence	171020-171051	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP048305	Escherichia coli strain 9 plasmid p009_A, complete sequence	139663-139694	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP025240	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE3-1928, complete sequence	127739-127770	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP025242	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1929 plasmid pSNE1-1929, complete sequence	79252-79283	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	LC055503	Klebsiella pneumoniae plasmid pHM881QN DNA, complete sequence, strain: Y881	140686-140717	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP024192	Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed1, complete sequence	192914-192945	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN477204	Escherichia coli strain S15FP06257 plasmid unnamed, complete sequence	29756-29787	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP027679	Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-2, complete sequence	38706-38737	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP017058	Citrobacter freundii strain SL151 plasmid unnamed1, complete sequence	123457-123488	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP020513	Escherichia coli strain 165 plasmid unnamed4, complete sequence	7329-7360	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP029730	Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed2, complete sequence	97927-97958	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LS992184	Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence	54980-55011	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KC999035	Escherichia coli strain EC2 plasmid pEC2-NDM-3, complete sequence	142165-142196	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP018716	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-2, complete sequence	3681-3712	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP018722	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-2, complete sequence	49775-49806	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP018704	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-2, complete sequence	74778-74809	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP029249	Salmonella enterica subsp. enterica serovar Thompson strain HFCDC-SM-846 plasmid p846, complete sequence	113673-113704	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_008612	Photobacterium damselae subsp. piscicida plasmid pP99-018, complete sequence	98563-98594	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP025470	Klebsiella pneumoniae strain JS187 plasmid p187-4, complete sequence	24328-24359	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP020524	Escherichia coli strain 190 plasmid unnamed1, complete sequence	67462-67493	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_AP022377	Providencia stuartii strain BML2537 plasmid pBML2537, complete sequence	110700-110731	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP022359	Shewanella bicestrii strain JAB-1 plasmid pSHE-CTX-M, complete sequence	121634-121665	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT904892	Salmonella enterica subsp. enterica serovar Typhi strain 80-2002 plasmid 2	26499-26530	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP029802	Salmonella enterica subsp. enterica serovar Anatum strain R16.0676 plasmid pR16.0676_90k, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP008790	Klebsiella oxytoca KONIH1 plasmid pKOX-86d, complete sequence	165802-165833	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP027038	Klebsiella pneumoniae strain 16_GR_13 plasmid IncAC2, complete sequence	37984-38015	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP028316	Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067217 plasmid pSC-31-2, complete sequence	70704-70735	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	CP009868	Pantoea sp. PSNIH2 plasmid pPSP-100, complete sequence	97402-97433	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP012682	Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence	141304-141335	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP042646	Escherichia coli strain NCYU-21-79 plasmid pNCYU-21-79-1, complete sequence	167986-168017	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP031549	Escherichia coli strain cq9 plasmid unnamed3, complete sequence	136774-136805	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP032385	Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_1, complete sequence	6167-6198	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	LC556210	Enterobacter cloacae CC23 plasmid pCC23 DNA, complete sequence	20100-20131	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	LC556211	Enterobacter cloacae CC32 plasmid pCC32 DNA, complete sequence	146525-146556	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	LC556212	Klebsiella pneumoniae CC37 plasmid pCC37 DNA, complete sequence	20854-20885	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	LC556213	Escherichia coli S44 plasmid pS44 DNA, complete sequence	21168-21199	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_018994	Escherichia coli plasmid pNDM-1_Dok01, complete sequence	176736-176767	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP022063	Salmonella enterica strain FDAARGOS_312 plasmid unnamed3, complete sequence	26426-26457	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN175387	Klebsiella pneumoniae strain KP-14-6 plasmid pKP-14-6-NDM-1, complete sequence	179128-179159	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP014978	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1896 isolate ST03-F34 plasmid pSTY1-1896, complete sequence	128454-128485	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_008613	Photobacterium damselae subsp. piscicida plasmid pP91278, complete sequence	93017-93048	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_019045	Escherichia coli strain N10-2337 plasmid pNDM102337, complete sequence	147150-147181	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP042479	Citrobacter freundii strain C50 plasmid pC50_001, complete sequence	216741-216772	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP031570	Enterobacter hormaechei strain 2013_1a plasmid pIncAC2-1301491, complete sequence	138962-138993	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP031564	Klebsiella pneumoniae strain 2-1 plasmid pKP21AC2, complete sequence	11865-11896	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP032397	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence	162135-162166	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP027055	Klebsiella pneumoniae strain 2_GR_12 plasmid IncAC2	37988-38019	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN254970	Escherichia coli strain EC009 plasmid pEC009.1, complete sequence	147600-147631	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	CP052444	Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-1, complete sequence	144521-144552	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP014658	Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1736 plasmid pSAN1-1736, complete sequence	140536-140567	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_019158	Klebsiella pneumoniae plasmid pNDM10469, complete sequence	118980-119011	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_019153	Klebsiella pneumoniae plasmid pNDM-KN, complete sequence	79339-79370	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP043190	Escherichia coli O16:H48 strain PG20180175 plasmid pPG20180175.1-IncAC2, complete sequence	145668-145699	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP044142	Escherichia coli O157 strain AR-0429 plasmid pAR-0429-1, complete sequence	70468-70499	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN310375	Klebsiella quasipneumoniae strain QD1501 plasmid pQD1501-Ct1, complete sequence	112445-112476	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN310377	Klebsiella pneumoniae strain 12085 plasmid p12085-Ct1, complete sequence	70290-70321	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP047421	Shewanella algae strain 18064-CSB-B-B plasmid p18064-65-CSB-B-B, complete sequence	83884-83915	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP025231	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1924 plasmid pSNE1-1924, complete sequence	139371-139402	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP026552	Citrobacter sp. SL156 plasmid unnamed3	190686-190717	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP039562	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014847 plasmid p08-5333.1, complete sequence	67553-67584	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP018817	Klebsiella pneumoniae strain AR_0049 plasmid unitig_1, complete sequence	37319-37350	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP038330	Escherichia coli O157:H7 strain NE 1092-2 plasmid pNE1092-3, complete sequence	72676-72707	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP038326	Escherichia coli O157:H7 strain NE 1169-1 plasmid pNE1169-3, complete sequence	55716-55747	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP030077	Enterobacter hormaechei strain 20710 plasmid p3-20710, complete sequence	146019-146050	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP041083	Klebsiella pneumoniae strain Kp202 plasmid pKp202_1, complete sequence	159237-159268	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP043215	Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.1-IncAC2, complete sequence	145668-145699	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP031362	Salmonella enterica subsp. enterica serovar Heidelberg strain 5 plasmid p3, complete sequence	5131-5162	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	KU160531	Vibrio alginolyticus strain VAS3-1 plasmid pVAS3-1, complete sequence	155273-155304	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP038322	Escherichia coli O157:H7 strain NE1127 plasmid pNE1127-2, complete sequence	125357-125388	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP028170	Salmonella enterica strain CFSAN064034 plasmid pGMI17-002_1, complete sequence	44829-44860	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_016974	Providencia stuartii plasmid pMR0211, complete sequence	159454-159485	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP008824	UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKEC-39c, complete sequence	292053-292084	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP041103	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed4, complete sequence	62838-62869	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN310369	Klebsiella pneumoniae strain Kpn47 plasmid pKpn47-Ct1/2, complete sequence	134232-134263	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN310370	Klebsiella pneumoniae strain 11935 plasmid p11935-Ct1/2, complete sequence	134232-134263	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN310378	Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence	159795-159826	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021835	Klebsiella pneumoniae strain AR_0120 plasmid tig00000516_pilon, complete sequence	178542-178573	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021956	Klebsiella pneumoniae strain AR_0107 plasmid unitig_1_pilon, complete sequence	75626-75657	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP009560	Salmonella enterica subsp. enterica serovar Newport str. CVM 22425 plasmid pCVM22425, complete sequence	73295-73326	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP045459	Salmonella enterica subsp. enterica serovar Anatum strain M-3471 plasmid pM-3471_DHA, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_022372	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT3 DNA, complete sequence	75875-75906	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP041641	Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-MCR1, complete sequence	24695-24726	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP026207	Escherichia coli strain ECONIH5 plasmid pECO-dc1b, complete sequence	179150-179181	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP009562	Salmonella enterica subsp. enterica serovar Newport str. CVM 22513 plasmid pCVM22513, complete sequence	38529-38560	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP031802	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed2, complete sequence	108257-108288	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP036192	Klebsiella pneumoniae strain BA34918 plasmid pIncAC2, complete sequence	8090-8121	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP040024	Klebsiella pneumoniae strain KPC160132 plasmid pIncC-L132, complete sequence	124415-124446	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP045517	Salmonella enterica subsp. enterica serovar Anatum strain Sal-4737 plasmid pSal-4737_DHA, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP045520	Salmonella enterica subsp. enterica serovar Anatum strain Sal-5091 plasmid pSal-5091_DHA, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP045462	Salmonella enterica subsp. enterica serovar Anatum strain M-3851 plasmid pM-3851_DHA, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP045467	Salmonella enterica subsp. enterica serovar Anatum strain Sal-3973 plasmid pSal-3973_DHA_CMY, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP045510	Salmonella enterica subsp. enterica serovar Anatum strain M-5360 plasmid pM-5360_DHA, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_023291	Vibrio cholerae strain BI144 plasmid pVCR94deltaX, complete sequence	101426-101457	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP007732	Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKEC-dc3, complete sequence	240411-240442	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP028996	Klebsiella pneumoniae strain AR_0079 plasmid unnamed5, complete sequence	117064-117095	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP006029	Escherichia coli O145:H28 str. RM13514 plasmid pRM13514, complete sequence	21882-21913	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP040039	Klebsiella pneumoniae strain KPC160125 plasmid pIncC-L125	145397-145428	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP040034	Klebsiella pneumoniae strain KPC160117 plasmid pIncC-L117, complete sequence	144831-144862	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP038464	Aeromonas hydrophila strain WCX23 plasmid unnamed, complete sequence	72733-72764	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP031610	Escherichia coli strain N3 plasmid pIncAC2-1502318, complete sequence	140287-140318	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP031584	Klebsiella pneumoniae strain N4b plasmid pIncAC2-1502320, complete sequence	144078-144109	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP027043	Klebsiella pneumoniae strain 1_GR_13 plasmid IncAC2, complete sequence	81083-81114	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP007137	Escherichia coli O145:H28 str. RM12581 plasmid pRM12581, complete sequence	21883-21914	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP029123	Escherichia coli strain AR434 plasmid unnamed1, complete sequence	811-842	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP047350	Proteus cibarius strain ZN2 plasmid pZN2-tetX-171kb, complete sequence	151246-151277	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_009140	Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence	157631-157662	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021719	Escherichia coli strain AR_0128 plasmid tig00000792, complete sequence	37863-37894	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP024824	Escherichia coli strain CREC-591 plasmid pCREC-591_3, complete sequence	28558-28589	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP031573	Enterobacter hormaechei strain N1 plasmid pIncAC2-1502262, complete sequence	143672-143703	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021536	Escherichia coli strain AR_0119 plasmid unitig_2, complete sequence	54666-54697	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP038466	Aeromonas hydrophila strain 23-C-23 plasmid unnamed, complete sequence	33909-33940	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_AP019688	Klebsiella quasipneumoniae strain SNI47 plasmid pTMSNI47-1, complete sequence	165329-165360	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_009139	Yersinia ruckeri YR71 plasmid pYR1, complete sequence	139130-139161	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_021667	Klebsiella pneumoniae plasmid IncA/C-LS6, complete sequence	7980-8011	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP003998	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13e, complete sequence	542-573	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP047345	Proteus vulgaris strain ZN3 plasmid pZN3-tetX-171kb, complete sequence	151244-151275	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP047353	Proteus mirabilis strain ZA25 plasmid pZA25-tetX-168kb, complete sequence	148550-148581	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP006661	Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pNDM-US, complete sequence	132856-132887	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP026405	Escherichia coli strain ECONIH4 plasmid pECO-c85f, complete sequence	58314-58345	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_017645	Escherichia coli UMNK88 plasmid pUMNK88, complete sequence	141729-141760	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP009567	Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 plasmid pCFSAN000934_02, complete sequence	95704-95735	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP029118	Escherichia coli strain AR435 plasmid unnamed5, complete sequence	72805-72836	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP007636	Vibrio cholerae strain 2012EL-2176 plasmid unnamed, complete sequence	165257-165288	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_012690	Escherichia coli plasmid peH4H, complete sequence	129252-129283	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP041052	Enterobacter hormaechei strain C126 plasmid pEnC126NDM, complete sequence	57747-57778	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP032238	Escherichia coli strain ECCWS199 plasmid pTB221, complete sequence	142391-142422	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP031576	Enterobacter hormaechei strain A1 plasmid pIncAC2-1502264, complete sequence	140303-140334	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP024557	Klebsiella pneumoniae strain INF164 plasmid unnamed1, complete sequence	191527-191558	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	CP050164	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence	117631-117662	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	CP050162	Escherichia coli plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence	96846-96877	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP035908	Klebsiella pneumoniae strain BA4656 plasmid pIncAC2, complete sequence	143179-143210	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP041172	Salmonella enterica subsp. enterica serovar Thompson strain SH11G0791 plasmid pSH11G0791, complete sequence	39215-39246	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP024529	Klebsiella pneumoniae strain INF157 plasmid unnamed1, complete sequence	192914-192945	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP011429	Salmonella enterica subsp. enterica serovar Typhimurium strain YU39 isolate YUHS 05-78 plasmid pYU39_IncA/C, complete sequence	137480-137511	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP018457	Shewanella algae strain CCU101 plasmid unnamed, complete sequence	28354-28385	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MK638972	Escherichia coli J53 plasmid pMG252, complete sequence	126593-126624	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP016013	Salmonella enterica subsp. enterica serovar Newport strain CFSAN003890 plasmid pCFSAN003890, complete sequence	126377-126408	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP032491	Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence	128726-128757	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP032496	Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_IncA/C2, complete sequence	70626-70657	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP024522	Klebsiella pneumoniae strain INF158 plasmid unnamed1, complete sequence	192914-192945	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP011540	Klebsiella aerogenes strain G7 plasmid pGPN1, complete sequence	41661-41692	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP015139	Escherichia coli strain Ecol_732 plasmid pEC732_IMP14, complete sequence	156610-156641	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_019065	Escherichia coli plasmid pPG010208, complete sequence	116960-116991	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_019066	Escherichia coli plasmid pAPEC1990_61, complete sequence	142237-142268	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_019069	Escherichia coli plasmid pNDM10505, complete sequence	147920-147951	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	CP028804	Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence	303963-303994	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP017084	Proteus mirabilis strain T21 plasmid pT212, complete sequence	12388-12419	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP040029	Klebsiella pneumoniae strain KPC160121 plasmid pIncC-L121, complete sequence	144831-144862	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	KY014464	Vibrio parahaemolyticus plasmid pVPS129, complete sequence	133779-133810	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	KY014465	Vibrio parahaemolyticus plasmid pVPS114, complete sequence	99560-99591	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	KY014466	Vibrio vulnificus plasmid pVVS1-per1, complete sequence	73973-74004	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP031122	Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid pIMP69_000369, complete sequence	58817-58848	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP019001	Escherichia coli strain Ecol_AZ155 plasmid pECAZ155_KPC, complete sequence	105881-105912	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP023724	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed2, complete sequence	17519-17550	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_016976	Klebsiella pneumoniae plasmid pR55, complete sequence	119362-119393	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP044075	Providencia stuartii strain FDAARGOS_645 plasmid unnamed1, complete sequence	121398-121429	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP026225	Aeromonas sp. ASNIH3 plasmid pKPC-8e09, complete sequence	161582-161613	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP034397	Escherichia coli strain CRE1 plasmid pCRE1.2, complete sequence	28967-28998	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP025275	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1923 plasmid pSNE2-1923	101006-101037	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	LC536681	Klebsiella pneumoniae MyNCGM076 plasmid pMyNCGM076, complete sequence	138986-139017	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	LC536682	Klebsiella pneumoniae MyNCGM079 plasmid pMyNCGM079, complete sequence	138986-139017	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	KM506769	Uncultured bacterium plasmid pKAZ1, complete sequence	104864-104895	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP045016	Klebsiella pneumoniae subsp. pneumoniae strain BK13048 plasmid pBK13048-1, complete sequence	62248-62279	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021853	Proteus mirabilis strain AR_0156 plasmid unitig_1, complete sequence	18904-18935	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP017055	Providencia stuartii strain BE2467 plasmid pPS1, complete sequence	165783-165814	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	CP028419	Aeromonas hydrophila strain WCX23 plasmid pWCX23_1, complete sequence	112824-112855	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP044962	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014881 plasmid pPNCS014881.1, complete sequence	107604-107635	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP024550	Klebsiella pneumoniae strain INF163 plasmid unnamed1, complete sequence	161450-161481	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP018318	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-2, complete sequence	29189-29220	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN823987	Escherichia coli strain 2016061604 plasmid p6061604-KPC, complete sequence	46694-46725	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	KR827391	Uncultured bacterium plasmid pKAZ2, complete sequence	116786-116817	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	KR827392	Uncultured bacterium plasmid pKAZ3, complete sequence	101358-101389	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	KR827393	Uncultured bacterium plasmid pKAZ4, complete sequence	125759-125790	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	KR827394	Uncultured bacterium plasmid pKAZ5, complete sequence	92053-92084	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP007558	Citrobacter freundii CFNIH1 plasmid pKEC-a3c, complete sequence	244374-244405	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021709	Klebsiella pneumoniae strain AR_0143 plasmid tig00000001_p1, complete sequence	115984-116015	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021551	Proteus mirabilis strain AR_0159 plasmid tig00000137, complete sequence	82411-82442	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP025236	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1926 plasmid pSNE2-1926, complete sequence	103759-103790	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP053365	Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence	85013-85044	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_AP018672	Klebsiella pneumoniae strain GSU10-3 plasmid pGSU10-3-1, complete sequence	132744-132775	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP009570	Salmonella enterica subsp. enterica serovar Newport str. CVM N1543 isolate CFSAN000926 plasmid pCVMN1543, complete sequence	92006-92037	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP009564	Salmonella enterica subsp. enterica serovar Newport str. CVM 21550 plasmid pCVM21550, complete sequence	38134-38165	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP009563	Salmonella enterica subsp. enterica serovar Newport str. CVM 21538 plasmid pCVM21538, complete sequence	40788-40819	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP011622	Klebsiella pneumoniae strain CAV1344 plasmid pKPC_CAV1344, complete sequence	86279-86310	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_AP019818	Enterobacter hormaechei subsp. hoffmannii strain OIPH-N069 plasmid pN069_1, complete sequence	116858-116889	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP041209	Salmonella enterica subsp. enterica serovar Newport strain SAP18-8729 plasmid pCFSAN074384_1, complete sequence	82906-82937	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP014295	Klebsiella pneumoniae strain KP38731 plasmid unnamed1, complete sequence	66403-66434	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021936	Escherichia coli strain AR_0055 plasmid unitig_2, complete sequence	70071-70102	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP031106	Escherichia coli strain AMSCJX02 plasmid pAMSC1, complete sequence	128555-128586	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP012902	Escherichia coli strain N15-01078 plasmid pNDM15-1078, complete sequence	33421-33452	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP023948	Klebsiella pneumoniae strain FDAARGOS_446 plasmid unnamed1, complete sequence	196697-196728	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP018689	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-2, complete sequence	3704-3735	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_019107	Salmonella enterica subsp. enterica serovar Dublin plasmid pSD_174, complete sequence	155696-155727	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_019116	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH163_135, complete sequence	116325-116356	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_019118	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH696_135, complete sequence	116580-116611	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_019121	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_166, complete sequence	38725-38756	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP020049	Escherichia coli strain AR_0118 plasmid unitig_1, complete sequence	51912-51943	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP019053	Escherichia coli strain CRE1540 plasmid p1540-2, complete sequence	135830-135861	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP029743	Escherichia coli strain AR_0085 plasmid unnamed2, complete sequence	28686-28717	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP020056	Escherichia coli strain AR_0069 plasmid unitig_2, complete sequence	29900-29931	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP032192	Salmonella enterica subsp. enterica serovar Senftenberg strain AR_0127 plasmid unnamed1, complete sequence	73107-73138	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP026233	Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-0b27, complete sequence	107433-107464	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_012692	Escherichia coli plasmid pAR060302, complete sequence	147687-147718	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_012693	Salmonella enterica plasmid pAM04528, complete sequence	139371-139402	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_016839	Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS3, complete sequence	75004-75035	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP015835	Escherichia coli strain MS6198 plasmid pMS6198A, complete sequence	117601-117632	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP024564	Klebsiella pneumoniae strain INF278 plasmid unnamed1, complete sequence	161450-161481	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP046773	Vibrio alginolyticus strain 2014V-1011 plasmid unnamed2, complete sequence	84296-84327	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP014775	Aeromonas veronii strain AVNIH1 plasmid pASP-a58, complete sequence	52313-52344	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP025245	Salmonella enterica subsp. enterica serovar Newport str. CDC 2012K-0663 isolate USDA-ARS-USMARC-1936 plasmid pSNE2-2012K-0663, complete sequence	92677-92708	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_019375	Providencia stuartii plasmid pTC2, complete sequence	155452-155483	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_019380	Aeromonas hydrophila plasmid pR148, complete sequence	145944-145975	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_023908	Klebsiella pneumoniae strain KP1 plasmid pKP1-NDM-1, complete sequence	118714-118745	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_022377	Escherichia coli strain SCEC2 plasmid pSCEC2, complete sequence	115642-115673	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021695	Proteus mirabilis strain AR_0155 plasmid tig00000123, complete sequence	209816-209847	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021952	Klebsiella pneumoniae strain AR_0148 plasmid tig00000169_pilon, complete sequence	68839-68870	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP032395	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_1, complete sequence	37526-37557	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP050732	Salmonella enterica subsp. enterica serovar Typhimurium strain ST101 plasmid pST101-1, complete sequence	160028-160059	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_023898	Klebsiella pneumoniae plasmid pRMH760, complete sequence	151789-151820	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP040884	Escherichia coli strain K71-77 plasmid pK71-77-1-NDM, complete sequence	97502-97533	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP025144	Klebsiella pneumoniae strain NR5632 plasmid NR5632_p1, complete sequence	120497-120528	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP025147	Klebsiella pneumoniae strain KP1766 plasmid KP1766_p1, complete sequence	125951-125982	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	LC225353	Photobacterium damselae subsp. piscicida plasmid pP0855 DNA, complete sequence	98563-98594	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_AP018143	Escherichia coli strain M214 isolate M214 plasmid pM214_AC2, complete sequence	156064-156095	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_AP018145	Escherichia coli strain M216 isolate M216 plasmid pM216_AC2, complete sequence	181176-181207	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP029718	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed5, complete sequence	75511-75542	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LN831185	Vibrio cholerae isolate V. cholerae 116-17a plasmid pNDM-116-17, complete sequence	103431-103462	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP031297	Escherichia coli strain EC17GD31 plasmid pGD31-NDM, complete sequence	153189-153220	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP050727	Salmonella enterica subsp. enterica serovar Typhimurium strain ST113 plasmid pST-1, complete sequence	32016-32047	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP050740	Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-1, complete sequence	33822-33853	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP048797	Providencia vermicola strain P8538 plasmid p8538-NDM-1, complete sequence	117591-117622	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP015394	Klebsiella pneumoniae strain CR14 plasmid pCR14_2, complete sequence	134335-134366	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP018698	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-2, complete sequence	84367-84398	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP018220	Salmonella enterica subsp. enterica strain LSP 389/97 plasmid pUO-STmRV1, complete sequence	167033-167064	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP027695	Klebsiella pneumoniae strain KP30835 plasmid unnamed2, complete sequence	10622-10653	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP045953	Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00008979 plasmid pAUSMDU00008979_01, complete sequence	128701-128732	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN550958	Proteus mirabilis strain PRT-ndm plasmid pPM154, complete sequence	106727-106758	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN603981	Klebsiella aerogenes strain 1564 plasmid p1564, complete sequence	116940-116971	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT882698	Klebsiella pneumoniae strain Klebsiella pneumoniae KLPN57 isolate KLPN57 plasmid I, complete sequence	68083-68114	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT882699	Enterobacter cloacae isolate Enterobacter cloacae ENCL58 plasmid I, complete sequence	108095-108126	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT985220	Escherichia coli strain 83 plasmid RCS1TR83_p, complete sequence	172879-172910	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT985234	Escherichia coli strain 557 plasmid RCS32TR557_p, complete sequence	30982-31013	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT985225	Escherichia coli strain 89 plasmid RCS2TR89_p, complete sequence	14792-14823	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT985258	Escherichia coli strain 726 plasmid RCS54TR726_p, complete sequence	135178-135209	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT985222	Escherichia coli strain 548 plasmid RCS24TR548_p, complete sequence	163166-163197	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT985228	Escherichia coli strain 552 plasmid RCS28TR552_p, complete sequence	68264-68295	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT985218	Escherichia coli strain 541 plasmid RCS18TR541_p, complete sequence	18748-18779	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT985260	Escherichia coli strain 724 plasmid RCS53TR724_p, complete sequence	23180-23211	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT985253	Escherichia coli strain 660 plasmid RCS48TR660_p, complete sequence	125802-125833	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT985250	Escherichia coli strain 170 plasmid RCS38_p, complete sequence	18853-18884	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT985224	Escherichia coli strain 513 plasmid RCS30_p, complete sequence	72425-72456	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT985243	Escherichia coli strain 722 plasmid RCS41_p, complete sequence	24355-24386	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_LT985244	Escherichia coli strain 167 plasmid RCS39_p, complete sequence	19537-19568	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP018956	Escherichia coli strain Ecol_316 plasmid pEC316_KPC, complete sequence	158551-158582	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN604267	Salmonella enterica subsp. enterica serovar London strain SAL-19-0623 plasmid pSAL-19-0623_NDM, complete sequence	241654-241685	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN604268	Escherichia coli strain J53 plasmid pJ53_SAL-19-0623_NDM, complete sequence	183993-184024	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP018710	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-2, complete sequence	77192-77223	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MK733575	Escherichia coli strain J53 plasmid pMG252A, complete sequence	84223-84254	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MK388209	Escherichia coli strain Ec20-Lar plasmid pC-Ec20-KPC, complete sequence	171835-171866	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MK439959	Escherichia coli strain Ec-2Lar plasmid pC-Ec2-KPC, complete sequence	209025-209056	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MN101850	Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence	252386-252417	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MN101853	Escherichia coli strain 13ZX36 plasmid p13ZX36-200, complete sequence	178749-178780	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MK770642	Klebsiella pneumoniae strain T38 plasmid pT38_MCR3, complete sequence	127988-128019	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MK123268	Serratia marcescens strain M17468 plasmid pSMA17468, complete sequence	120173-120204	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MN148427	Proteus vulgaris strain PV835 plasmid pPV835TEM24, complete sequence	119367-119398	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_022522	Salmonella enterica subsp. enterica serovar Kentucky strain 1643/10 plasmid p1643_10, complete sequence	148777-148808	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN657249	Enterobacteriaceae bacterium strain 1086-16 plasmid pKP39-T3, complete sequence	135178-135209	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN657250	Enterobacteriaceae bacterium strain 1083-16 plasmid pKP39-T4, complete sequence	136414-136445	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN657252	Enterobacteriaceae bacterium strain 21-16 plasmid pPS-T1, complete sequence	149095-149126	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP032380	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69807 plasmid pSDU1-USMARC-69807, complete sequence	1094-1125	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP032448	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69840 plasmid pSDU2-USMARC-69840, complete sequence	20832-20863	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH995508	Enterobacter cloacae strain ECL17464 plasmid pECL17464, complete sequence	120174-120205	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH995506	Citrobacter freundii strain CFR17394 plasmid pCFR17394, complete sequence	120174-120205	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH105050	Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncA/C-IncX3, complete sequence	127260-127291	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH917285	Klebsiella pneumoniae strain 427113 plasmid p427113-Ct1/2, complete sequence	185702-185733	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH909327	Klebsiella pneumoniae strain 526316 plasmid p526316-KPC, complete sequence	147028-147059	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH263652	Providencia rettgeri strain QD51 plasmid pNDM-QD51, complete sequence	114840-114871	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH917284	Klebsiella pneumoniae strain 397108 plasmid p397108-Ct2, complete sequence	91989-92020	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH760469	Salmonella enterica strain 2016K-0796 plasmid p2016K-0796, complete sequence	161016-161047	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MK205418	Salmonella enterica subsp. enterica serovar Dublin strain 14-1360 plasmid p14-1360-1, complete sequence	82443-82474	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MK205416	Salmonella enterica subsp. enterica serovar Dublin strain N13-01070 plasmid pN13-01070-1, complete sequence	88461-88492	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MK205417	Salmonella enterica subsp. enterica serovar Dublin strain N13-01141 plasmid pN13-01141, complete sequence	64549-64580	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH061195	Klebsiella pneumoniae strain AHM7C8I plasmid pHNAH8I-NDM, complete sequence	81351-81382	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MK033499	Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence	66358-66389	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH011352	Klebsiella pneumoniae strain 185 plasmid pNDM-185, complete sequence	192661-192692	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH476540	Klebsiella pneumoniae strain KP1276 plasmid pIA/C-KLUC, complete sequence	172254-172285	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MK101346	Citrobacter freundii strain CRE3 plasmid pCRE7-NDM, complete sequence	109367-109398	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN657241	Enterobacteriaceae bacterium strain 20-16 plasmid pCF104a-T3, complete sequence	156543-156574	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN657242	Enterobacteriaceae bacterium strain 128-16 plasmid pEC405a-T3, complete sequence	68568-68599	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN657243	Enterobacteriaceae bacterium strain 24-16 plasmid pEC744-T5, complete sequence	127560-127591	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN657244	Enterobacteriaceae bacterium strain 690-16 plasmid pEC6332-T3, complete sequence	95303-95334	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MN657247	Enterobacteriaceae bacterium strain 460-16 plasmid pECl-T3, complete sequence	74957-74988	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP009410	Salmonella enterica strain CFSAN007405 isolate 30034 plasmid pCFSAN007405_01, complete sequence	113313-113344	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MG764534	Klebsiella aerogenes strain EA409 plasmid pEA409TEM24, complete sequence	113186-113217	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MF627444	Vibrio parahaemolyticus strain Vb0267 plasmid pVb0267, complete sequence	146496-146527	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH001166	Escherichia coli strain TAEC1 plasmid pNDM-TAEC1, complete sequence	164040-164071	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MF150121	Klebsiella pneumoniae strain A64477 plasmid pKP64477c, complete sequence	7962-7993	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MF150123	Klebsiella pneumoniae strain A64216 plasmid pKP64216b, complete sequence	6903-6934	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MF344573	Klebsiella pneumoniae strain N201205880 plasmid p205880-Ct1/2, complete sequence	133401-133432	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MF344572	Enterobacter hormaechei strain 24845 plasmid p24845-Ct2, complete sequence	147627-147658	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MF344574	Enterobacter hormaechei strain T5282 plasmid pT5282-Ct2, complete sequence	115821-115852	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MG450360	Escherichia coli strain AMA566 plasmid pAMA566, complete sequence	169885-169916	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MG252895	Escherichia coli strain Esco-36073cz plasmid pEsco-36073cz, complete sequence	282125-282156	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH113855	Vibrio alginolyticus strain Vb1796 plasmid pVb1796, complete sequence	143860-143891	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH457126	Vibrio alginolyticus strain Vb1394 plasmid pC1394, complete sequence	147178-147209	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH475146	Citrobacter freundii strain 164 plasmid pCf164_LMB-1, complete sequence	129613-129644	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH763829	Citrobacter freundii strain JY-17 plasmid pCFJY-17, complete sequence	140752-140783	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH892479	Citrobacter freundii strain 2262 plasmid pNDM-2262, complete sequence	155503-155534	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MH844629	Escherichia coli strain 2248 plasmid pNDM-2248, complete sequence	162661-162692	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP030132	Klebsiella pneumoniae strain 160111 plasmid pIncAC2_L111, complete sequence	103191-103222	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MT219816	Escherichia coli strain RF173-1 plasmid pRF173-1_87k_tetX, complete sequence	67483-67514	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KY887591	Escherichia coli strain Ec19 plasmid pEc19, complete sequence	170002-170033	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KY887590	Escherichia coli strain Ec9 plasmid pEc9, complete sequence	209664-209695	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_KY887595	Escherichia coli strain Ec78 plasmid pEc78, complete sequence	214204-214235	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MF582638	Klebsiella pneumoniae strain KKp4 plasmid pKKp4-VIM, complete sequence	142136-142167	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MF072965	Citrobacter freundii strain P10159 plasmid pP10159-5, complete sequence	143000-143031	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MG764552	Klebsiella pneumoniae strain A1763 plasmid pA1763-Ct2, complete sequence	73433-73464	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MF150118	Proteus mirabilis strain A64421 plasmid pPM64421a, complete sequence	105797-105828	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MF627445	Vibrio parahaemolyticus strain Vb0499 plasmid pVb0499, complete sequence	172765-172796	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_MF497432	Vibrio alginolyticus strain Vb0506 plasmid pVb0506, complete sequence	113752-113783	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP040068	Escherichia coli strain A1_181 plasmid p_unnamed1_KPC2, complete sequence	160332-160363	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP044189	Salmonella enterica subsp. enterica strain AR-0401 plasmid pAR-0401-1, complete sequence	78629-78660	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP028814	Edwardsiella ictaluri strain MS-17-156 plasmid pEI-MS-17-156-1, complete sequence	51373-51404	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP020913	Salmonella enterica subsp. enterica serovar Montevideo str. CDC 2010K-0257 plasmid pSMO-2010K-0257, complete sequence	101044-101075	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP029737	Providencia rettgeri strain AR_0082 plasmid unnamed, complete sequence	4670-4701	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP048384	Citrobacter freundii strain 62 plasmid p6_B, complete sequence	170674-170705	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP032168	Klebsiella pneumoniae strain AR_0076 plasmid unnamed1, complete sequence	122818-122849	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP053192	Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37b, complete sequence	109054-109085	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	MT151380	Vibrio cholerae strain YA00120881 plasmid pYA00120881, complete sequence	139898-139929	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP054305	Klebsiella pneumoniae strain MS14393 plasmid pMS14393B, complete sequence	86205-86236	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	692498-692529	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1044204-1044235	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1013041-1013072	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	677353-677384	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1110424-1110455	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	274398-274429	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	685598-685629	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	675142-675173	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	614953-614984	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1343306-1343337	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	1030186-1030217	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	936847-936878	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	731834-731865	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	599586-599617	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	251291-251322	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1464116-1464147	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	332189-332220	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	837319-837350	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	699032-699063	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1184782-1184813	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	957465-957496	8	0.75
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1044207-1044238	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	254982-255013	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1486850-1486881	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1451527-1451558	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	254753-254784	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1553075-1553106	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1490072-1490103	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	250002-250033	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	248814-248845	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1055617-1055648	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	516098-516129	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	594445-594476	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	499933-499964	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1175583-1175614	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	129936-129967	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	714613-714644	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1037608-1037639	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	766984-767015	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	403311-403342	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	253916-253947	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	19560-19591	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1380661-1380692	8	0.75
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1486859-1486890	8	0.75
NZ_CP053582_2	2.28\|3154329\|32\|NZ_CP053582\|PILER-CR	3154329-3154360	32	AF242738	Bacteriophage phi LC3, complete genome	22704-22735	8	0.75
NZ_CP053582_2	2.28\|3154329\|32\|NZ_CP053582\|PILER-CR	3154329-3154360	32	NC_005822	Lactococcus phage phiLC3, complete genome	22704-22735	8	0.75
NZ_CP053582_2	2.28\|3154329\|32\|NZ_CP053582\|PILER-CR	3154329-3154360	32	KX160220	Lactococcus phage Dub35A, complete genome	26465-26496	8	0.75
NZ_CP053582_2	2.30\|3154451\|32\|NZ_CP053582\|PILER-CR	3154451-3154482	32	NC_018686	Bacillus thuringiensis MC28 plasmid pMC183, complete sequence	92521-92552	8	0.75
NZ_CP053582_2	2.36\|3154817\|32\|NZ_CP053582\|PILER-CR	3154817-3154848	32	NZ_CP047432	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-4, complete sequence	17893-17924	8	0.75
NZ_CP053582_2	2.36\|3154817\|32\|NZ_CP053582\|PILER-CR	3154817-3154848	32	NZ_CP046370	Spiroplasma citri strain BR12 plasmid pScpBR12-2, complete sequence	16359-16390	8	0.75
NZ_CP053582_2	2.36\|3154817\|32\|NZ_CP053582\|PILER-CR	3154817-3154848	32	NZ_CP047441	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-4, complete sequence	14538-14569	8	0.75
NZ_CP053582_2	2.36\|3154817\|32\|NZ_CP053582\|PILER-CR	3154817-3154848	32	NZ_CP053311	Spiroplasma citri strain C5 plasmid pScpC5-7, complete sequence	20802-20833	8	0.75
NZ_CP053582_2	2.39\|3155000\|32\|NZ_CP053582\|PILER-CR	3155000-3155031	32	MN693026	Marine virus AFVG_117M72, complete genome	66637-66668	8	0.75
NZ_CP053582_2	2.39\|3155000\|32\|NZ_CP053582\|PILER-CR	3155000-3155031	32	NZ_CP028244	Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence	16520-16551	8	0.75
NZ_CP053582_2	2.39\|3155000\|32\|NZ_CP053582\|PILER-CR	3155000-3155031	32	NZ_CP054261	Lactobacillus plantarum strain TCI507 plasmid unnamed2	1676-1707	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	CP007642	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence	83461-83492	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_014312	Klebsiella pneumoniae plasmid pKP048, complete sequence	28939-28970	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KX147633	Citrobacter freundii strain AMA332 plasmid pT1, complete sequence	6832-6863	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KX709966	Pseudomonas aeruginosa strain IP40a plasmid pIP40a, complete sequence	143076-143107	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KX786648	Enterobacter cloacae strain B557 plasmid pB557-NDM, complete sequence	121685-121716	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KX869741	Enterobacter cloacae strain 20130723 plasmid R222, complete sequence	113151-113182	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KY399978	Vibrio cholerae O139 strain ICDC-211 plasmid pVC211, complete sequence	127230-127261	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KY986974	Citrobacter freundii strain 112298 plasmid p112298-tetA, complete sequence	170338-170369	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KY887592	Citrobacter freundii strain Cf52 plasmid pCf52, complete sequence	200489-200520	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KY887593	Citrobacter freundii strain Cf53 plasmid pCf53, complete sequence	181606-181637	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KY887594	Klebsiella pneumoniae strain Kp55 plasmid pKp55, complete sequence	196694-196725	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_AP023051	Citrobacter portucalensis strain IOMTU157 plasmid pIOMTU157, complete sequence	152992-153023	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_022652	Klebsiella pneumoniae strain CRE114 plasmid pIMP-PH114, complete sequence	131848-131879	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP033514	Vibrio cholerae strain E4 plasmid pVCR94, complete sequence	78291-78322	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP009414	Salmonella enterica strain CFSAN007428 isolate N11150 plasmid pCFSAN007428_01, complete sequence	146082-146113	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KU726616	Salmonella enterica subsp. enterica serovar Stanley strain LS001 plasmid pHS36-NDM, complete sequence	18794-18825	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KX458222	Klebsiella pneumoniae strain B2 plasmid pB2-1, complete sequence	153328-153359	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KX636095	Klebsiella pneumoniae strain RJ119 plasmid pRJ119-NDM1, complete sequence	12505-12536	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KX815983	Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence	135906-135937	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KT997783	Escherichia coli strain Y5 plasmid pECY53, complete sequence	133285-133316	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KX156772	Escherichia coli strain K-12 plasmid IP40a, complete sequence	145947-145978	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KU302802	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence	112270-112301	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KT935446	Klebsiella pneumoniae strain Kp2964 plasmid 2964TF, complete sequence	150243-150274	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KX156773	Escherichia coli strain K-12 plasmid R16a, complete sequence	154270-154301	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KX029331	Klebsiella pneumoniae strain K-109-R plasmid unnamed, complete sequence	136562-136593	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KU302801	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence	110611-110642	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP035548	Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence	133034-133065	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP009412	Salmonella enterica strain CFSAN007426 isolate N19767 plasmid pCFSAN007426_01, complete sequence	84743-84774	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP009411	Salmonella enterica strain CFSAN007425 isolate 22697 plasmid pCFSAN007425_01, complete sequence	147655-147686	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP009413	Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence	155846-155877	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KJ588779	Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pNDM-US-2, complete sequence	118757-118788	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KJ909290	Aeromonas salmonicida subsp. salmonicida strain 2004-05MF26 plasmid pSN254b, complete sequence	132199-132230	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KM083064	Vibrio cholerae strain ICDC-1447 plasmid pVC1447, complete sequence	104893-104924	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KR559888	Klebsiella pneumoniae strain Kpn642 plasmid pKP-Gr642, complete sequence	140141-140172	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KR559889	Klebsiella pneumoniae strain Kpn8143 plasmid pKP-Gr8143, complete sequence	134289-134320	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KJ802405	Providencia stuartii isolate GN576 plasmid pNDM-PstGN576, complete sequence	127924-127955	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KP742988	Salmonella enterica subsp. enterica serovar Senftenberg strain BCH02406 plasmid pNDM-SAL, complete sequence	70788-70819	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KM670336	Salmonella enterica subsp. enterica serovar Senftenberg strain SRC119 plasmid pSRC119-A/C, complete sequence	125762-125793	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KR091911	Salmonella enterica subsp. enterica serovar Corvallis strain RH-1238 plasmid pRH-1238, complete sequence	49389-49420	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KP975074	Citrobacter freundii strain MRSN11938 plasmid pMRVIM0912, complete sequence	90001-90032	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KR559890	Enterobacter cloacae strain Ecl4873 plasmid pEcl-Gr4873, complete sequence	135124-135155	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KJ802404	Escherichia coli isolate GN568 plasmid pNDM-EcoGN568, complete sequence	146789-146820	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KP056256	Escherichia coli strain YDC637 plasmid pYDC637, complete sequence	178175-178206	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KP345882	Escherichia coli strain BK32533 plasmid pBK32533, complete sequence	77624-77655	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	AP014611	Serratia marcescens plasmid p11663 DNA, complete sequence, strain: 11663	134491-134522	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP028197	Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence	386243-386274	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP041027	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence	122212-122243	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP025141	Klebsiella pneumoniae strain KP1768 plasmid KP1768_p1, complete sequence	120645-120676	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP032391	Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_1, complete sequence	93699-93730	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP017987	Klebsiella pneumoniae strain 825795-1 plasmid unnamed2, complete sequence	13252-13283	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP022126	Klebsiella pneumoniae strain DHQP1605752_NV plasmid p1605752AC2, complete sequence	131049-131080	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP017387	Klebsiella pneumoniae strain KP36 plasmid 2, complete sequence	89223-89254	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP047308	Citrobacter freundii strain L75 plasmid pCf75, complete sequence	126280-126311	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP045742	Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence	44964-44995	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP013324	Klebsiella pneumoniae strain CAV1193 plasmid pCAV1193-166, complete sequence	86279-86310	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP034402	Escherichia coli strain CRE10 plasmid pCRE10.2, complete sequence	60866-60897	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP010373	Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence	171020-171051	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP048305	Escherichia coli strain 9 plasmid p009_A, complete sequence	139663-139694	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP025240	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE3-1928, complete sequence	127739-127770	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP025242	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1929 plasmid pSNE1-1929, complete sequence	79252-79283	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	LC055503	Klebsiella pneumoniae plasmid pHM881QN DNA, complete sequence, strain: Y881	140686-140717	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP024192	Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed1, complete sequence	192914-192945	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN477204	Escherichia coli strain S15FP06257 plasmid unnamed, complete sequence	29756-29787	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP027679	Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-2, complete sequence	38706-38737	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP017058	Citrobacter freundii strain SL151 plasmid unnamed1, complete sequence	123457-123488	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP020513	Escherichia coli strain 165 plasmid unnamed4, complete sequence	7329-7360	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP029730	Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed2, complete sequence	97927-97958	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LS992184	Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence	54980-55011	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KC999035	Escherichia coli strain EC2 plasmid pEC2-NDM-3, complete sequence	142165-142196	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP018716	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-2, complete sequence	3681-3712	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP018722	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-2, complete sequence	49775-49806	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP018704	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-2, complete sequence	74778-74809	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP029249	Salmonella enterica subsp. enterica serovar Thompson strain HFCDC-SM-846 plasmid p846, complete sequence	113673-113704	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_008612	Photobacterium damselae subsp. piscicida plasmid pP99-018, complete sequence	98563-98594	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP025470	Klebsiella pneumoniae strain JS187 plasmid p187-4, complete sequence	24328-24359	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP020524	Escherichia coli strain 190 plasmid unnamed1, complete sequence	67462-67493	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_AP022377	Providencia stuartii strain BML2537 plasmid pBML2537, complete sequence	110700-110731	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP022359	Shewanella bicestrii strain JAB-1 plasmid pSHE-CTX-M, complete sequence	121634-121665	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT904892	Salmonella enterica subsp. enterica serovar Typhi strain 80-2002 plasmid 2	26499-26530	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP029802	Salmonella enterica subsp. enterica serovar Anatum strain R16.0676 plasmid pR16.0676_90k, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP008790	Klebsiella oxytoca KONIH1 plasmid pKOX-86d, complete sequence	165802-165833	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP027038	Klebsiella pneumoniae strain 16_GR_13 plasmid IncAC2, complete sequence	37984-38015	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP028316	Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067217 plasmid pSC-31-2, complete sequence	70704-70735	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	CP009868	Pantoea sp. PSNIH2 plasmid pPSP-100, complete sequence	97402-97433	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP012682	Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence	141304-141335	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP042646	Escherichia coli strain NCYU-21-79 plasmid pNCYU-21-79-1, complete sequence	167986-168017	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP031549	Escherichia coli strain cq9 plasmid unnamed3, complete sequence	136774-136805	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP032385	Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_1, complete sequence	6167-6198	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	LC556210	Enterobacter cloacae CC23 plasmid pCC23 DNA, complete sequence	20100-20131	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	LC556211	Enterobacter cloacae CC32 plasmid pCC32 DNA, complete sequence	146525-146556	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	LC556212	Klebsiella pneumoniae CC37 plasmid pCC37 DNA, complete sequence	20854-20885	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	LC556213	Escherichia coli S44 plasmid pS44 DNA, complete sequence	21168-21199	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_018994	Escherichia coli plasmid pNDM-1_Dok01, complete sequence	176736-176767	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP022063	Salmonella enterica strain FDAARGOS_312 plasmid unnamed3, complete sequence	26426-26457	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN175387	Klebsiella pneumoniae strain KP-14-6 plasmid pKP-14-6-NDM-1, complete sequence	179128-179159	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP014978	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1896 isolate ST03-F34 plasmid pSTY1-1896, complete sequence	128454-128485	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_008613	Photobacterium damselae subsp. piscicida plasmid pP91278, complete sequence	93017-93048	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_019045	Escherichia coli strain N10-2337 plasmid pNDM102337, complete sequence	147150-147181	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP042479	Citrobacter freundii strain C50 plasmid pC50_001, complete sequence	216741-216772	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP031570	Enterobacter hormaechei strain 2013_1a plasmid pIncAC2-1301491, complete sequence	138962-138993	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP031564	Klebsiella pneumoniae strain 2-1 plasmid pKP21AC2, complete sequence	11865-11896	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP032397	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence	162135-162166	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP027055	Klebsiella pneumoniae strain 2_GR_12 plasmid IncAC2	37988-38019	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN254970	Escherichia coli strain EC009 plasmid pEC009.1, complete sequence	147600-147631	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	CP052444	Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-1, complete sequence	144521-144552	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP014658	Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1736 plasmid pSAN1-1736, complete sequence	140536-140567	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_019158	Klebsiella pneumoniae plasmid pNDM10469, complete sequence	118980-119011	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_019153	Klebsiella pneumoniae plasmid pNDM-KN, complete sequence	79339-79370	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP043190	Escherichia coli O16:H48 strain PG20180175 plasmid pPG20180175.1-IncAC2, complete sequence	145668-145699	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP044142	Escherichia coli O157 strain AR-0429 plasmid pAR-0429-1, complete sequence	70468-70499	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN310375	Klebsiella quasipneumoniae strain QD1501 plasmid pQD1501-Ct1, complete sequence	112445-112476	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN310377	Klebsiella pneumoniae strain 12085 plasmid p12085-Ct1, complete sequence	70290-70321	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP047421	Shewanella algae strain 18064-CSB-B-B plasmid p18064-65-CSB-B-B, complete sequence	83884-83915	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP025231	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1924 plasmid pSNE1-1924, complete sequence	139371-139402	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP026552	Citrobacter sp. SL156 plasmid unnamed3	190686-190717	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP039562	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014847 plasmid p08-5333.1, complete sequence	67553-67584	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP018817	Klebsiella pneumoniae strain AR_0049 plasmid unitig_1, complete sequence	37319-37350	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP038330	Escherichia coli O157:H7 strain NE 1092-2 plasmid pNE1092-3, complete sequence	72676-72707	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP038326	Escherichia coli O157:H7 strain NE 1169-1 plasmid pNE1169-3, complete sequence	55716-55747	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP030077	Enterobacter hormaechei strain 20710 plasmid p3-20710, complete sequence	146019-146050	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP041083	Klebsiella pneumoniae strain Kp202 plasmid pKp202_1, complete sequence	159237-159268	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP043215	Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.1-IncAC2, complete sequence	145668-145699	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP031362	Salmonella enterica subsp. enterica serovar Heidelberg strain 5 plasmid p3, complete sequence	5131-5162	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	KU160531	Vibrio alginolyticus strain VAS3-1 plasmid pVAS3-1, complete sequence	155273-155304	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP038322	Escherichia coli O157:H7 strain NE1127 plasmid pNE1127-2, complete sequence	125357-125388	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP028170	Salmonella enterica strain CFSAN064034 plasmid pGMI17-002_1, complete sequence	44829-44860	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_016974	Providencia stuartii plasmid pMR0211, complete sequence	159454-159485	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP008824	UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKEC-39c, complete sequence	292053-292084	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP041103	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed4, complete sequence	62838-62869	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN310369	Klebsiella pneumoniae strain Kpn47 plasmid pKpn47-Ct1/2, complete sequence	134232-134263	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN310370	Klebsiella pneumoniae strain 11935 plasmid p11935-Ct1/2, complete sequence	134232-134263	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN310378	Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence	159795-159826	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021835	Klebsiella pneumoniae strain AR_0120 plasmid tig00000516_pilon, complete sequence	178542-178573	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021956	Klebsiella pneumoniae strain AR_0107 plasmid unitig_1_pilon, complete sequence	75626-75657	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP009560	Salmonella enterica subsp. enterica serovar Newport str. CVM 22425 plasmid pCVM22425, complete sequence	73295-73326	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP045459	Salmonella enterica subsp. enterica serovar Anatum strain M-3471 plasmid pM-3471_DHA, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_022372	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT3 DNA, complete sequence	75875-75906	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP041641	Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-MCR1, complete sequence	24695-24726	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP026207	Escherichia coli strain ECONIH5 plasmid pECO-dc1b, complete sequence	179150-179181	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP009562	Salmonella enterica subsp. enterica serovar Newport str. CVM 22513 plasmid pCVM22513, complete sequence	38529-38560	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP031802	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed2, complete sequence	108257-108288	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP036192	Klebsiella pneumoniae strain BA34918 plasmid pIncAC2, complete sequence	8090-8121	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP040024	Klebsiella pneumoniae strain KPC160132 plasmid pIncC-L132, complete sequence	124415-124446	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP045517	Salmonella enterica subsp. enterica serovar Anatum strain Sal-4737 plasmid pSal-4737_DHA, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP045520	Salmonella enterica subsp. enterica serovar Anatum strain Sal-5091 plasmid pSal-5091_DHA, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP045462	Salmonella enterica subsp. enterica serovar Anatum strain M-3851 plasmid pM-3851_DHA, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP045467	Salmonella enterica subsp. enterica serovar Anatum strain Sal-3973 plasmid pSal-3973_DHA_CMY, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP045510	Salmonella enterica subsp. enterica serovar Anatum strain M-5360 plasmid pM-5360_DHA, complete sequence	17130-17161	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_023291	Vibrio cholerae strain BI144 plasmid pVCR94deltaX, complete sequence	101426-101457	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP007732	Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKEC-dc3, complete sequence	240411-240442	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP028996	Klebsiella pneumoniae strain AR_0079 plasmid unnamed5, complete sequence	117064-117095	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP006029	Escherichia coli O145:H28 str. RM13514 plasmid pRM13514, complete sequence	21882-21913	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP040039	Klebsiella pneumoniae strain KPC160125 plasmid pIncC-L125	145397-145428	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP040034	Klebsiella pneumoniae strain KPC160117 plasmid pIncC-L117, complete sequence	144831-144862	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP038464	Aeromonas hydrophila strain WCX23 plasmid unnamed, complete sequence	72733-72764	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP031610	Escherichia coli strain N3 plasmid pIncAC2-1502318, complete sequence	140287-140318	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP031584	Klebsiella pneumoniae strain N4b plasmid pIncAC2-1502320, complete sequence	144078-144109	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP027043	Klebsiella pneumoniae strain 1_GR_13 plasmid IncAC2, complete sequence	81083-81114	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP007137	Escherichia coli O145:H28 str. RM12581 plasmid pRM12581, complete sequence	21883-21914	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP029123	Escherichia coli strain AR434 plasmid unnamed1, complete sequence	811-842	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP047350	Proteus cibarius strain ZN2 plasmid pZN2-tetX-171kb, complete sequence	151246-151277	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_009140	Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence	157631-157662	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021719	Escherichia coli strain AR_0128 plasmid tig00000792, complete sequence	37863-37894	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP024824	Escherichia coli strain CREC-591 plasmid pCREC-591_3, complete sequence	28558-28589	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP031573	Enterobacter hormaechei strain N1 plasmid pIncAC2-1502262, complete sequence	143672-143703	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021536	Escherichia coli strain AR_0119 plasmid unitig_2, complete sequence	54666-54697	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP038466	Aeromonas hydrophila strain 23-C-23 plasmid unnamed, complete sequence	33909-33940	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_AP019688	Klebsiella quasipneumoniae strain SNI47 plasmid pTMSNI47-1, complete sequence	165329-165360	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_009139	Yersinia ruckeri YR71 plasmid pYR1, complete sequence	139130-139161	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_021667	Klebsiella pneumoniae plasmid IncA/C-LS6, complete sequence	7980-8011	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP003998	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13e, complete sequence	542-573	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP047345	Proteus vulgaris strain ZN3 plasmid pZN3-tetX-171kb, complete sequence	151244-151275	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP047353	Proteus mirabilis strain ZA25 plasmid pZA25-tetX-168kb, complete sequence	148550-148581	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP006661	Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pNDM-US, complete sequence	132856-132887	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP026405	Escherichia coli strain ECONIH4 plasmid pECO-c85f, complete sequence	58314-58345	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_017645	Escherichia coli UMNK88 plasmid pUMNK88, complete sequence	141729-141760	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP009567	Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 plasmid pCFSAN000934_02, complete sequence	95704-95735	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP029118	Escherichia coli strain AR435 plasmid unnamed5, complete sequence	72805-72836	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP007636	Vibrio cholerae strain 2012EL-2176 plasmid unnamed, complete sequence	165257-165288	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_012690	Escherichia coli plasmid peH4H, complete sequence	129252-129283	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP041052	Enterobacter hormaechei strain C126 plasmid pEnC126NDM, complete sequence	57747-57778	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP032238	Escherichia coli strain ECCWS199 plasmid pTB221, complete sequence	142391-142422	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP031576	Enterobacter hormaechei strain A1 plasmid pIncAC2-1502264, complete sequence	140303-140334	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP024557	Klebsiella pneumoniae strain INF164 plasmid unnamed1, complete sequence	191527-191558	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	CP050164	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence	117631-117662	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	CP050162	Escherichia coli plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence	96846-96877	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP035908	Klebsiella pneumoniae strain BA4656 plasmid pIncAC2, complete sequence	143179-143210	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP041172	Salmonella enterica subsp. enterica serovar Thompson strain SH11G0791 plasmid pSH11G0791, complete sequence	39215-39246	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP024529	Klebsiella pneumoniae strain INF157 plasmid unnamed1, complete sequence	192914-192945	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP011429	Salmonella enterica subsp. enterica serovar Typhimurium strain YU39 isolate YUHS 05-78 plasmid pYU39_IncA/C, complete sequence	137480-137511	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP018457	Shewanella algae strain CCU101 plasmid unnamed, complete sequence	28354-28385	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MK638972	Escherichia coli J53 plasmid pMG252, complete sequence	126593-126624	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP016013	Salmonella enterica subsp. enterica serovar Newport strain CFSAN003890 plasmid pCFSAN003890, complete sequence	126377-126408	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP032491	Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence	128726-128757	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP032496	Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_IncA/C2, complete sequence	70626-70657	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP024522	Klebsiella pneumoniae strain INF158 plasmid unnamed1, complete sequence	192914-192945	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP011540	Klebsiella aerogenes strain G7 plasmid pGPN1, complete sequence	41661-41692	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP015139	Escherichia coli strain Ecol_732 plasmid pEC732_IMP14, complete sequence	156610-156641	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_019065	Escherichia coli plasmid pPG010208, complete sequence	116960-116991	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_019066	Escherichia coli plasmid pAPEC1990_61, complete sequence	142237-142268	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_019069	Escherichia coli plasmid pNDM10505, complete sequence	147920-147951	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	CP028804	Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence	303963-303994	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP017084	Proteus mirabilis strain T21 plasmid pT212, complete sequence	12388-12419	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP040029	Klebsiella pneumoniae strain KPC160121 plasmid pIncC-L121, complete sequence	144831-144862	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	KY014464	Vibrio parahaemolyticus plasmid pVPS129, complete sequence	133779-133810	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	KY014465	Vibrio parahaemolyticus plasmid pVPS114, complete sequence	99560-99591	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	KY014466	Vibrio vulnificus plasmid pVVS1-per1, complete sequence	73973-74004	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP031122	Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid pIMP69_000369, complete sequence	58817-58848	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP019001	Escherichia coli strain Ecol_AZ155 plasmid pECAZ155_KPC, complete sequence	105881-105912	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP023724	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed2, complete sequence	17519-17550	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_016976	Klebsiella pneumoniae plasmid pR55, complete sequence	119362-119393	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP044075	Providencia stuartii strain FDAARGOS_645 plasmid unnamed1, complete sequence	121398-121429	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP026225	Aeromonas sp. ASNIH3 plasmid pKPC-8e09, complete sequence	161582-161613	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP034397	Escherichia coli strain CRE1 plasmid pCRE1.2, complete sequence	28967-28998	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP025275	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1923 plasmid pSNE2-1923	101006-101037	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	LC536681	Klebsiella pneumoniae MyNCGM076 plasmid pMyNCGM076, complete sequence	138986-139017	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	LC536682	Klebsiella pneumoniae MyNCGM079 plasmid pMyNCGM079, complete sequence	138986-139017	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	KM506769	Uncultured bacterium plasmid pKAZ1, complete sequence	104864-104895	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP045016	Klebsiella pneumoniae subsp. pneumoniae strain BK13048 plasmid pBK13048-1, complete sequence	62248-62279	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021853	Proteus mirabilis strain AR_0156 plasmid unitig_1, complete sequence	18904-18935	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP017055	Providencia stuartii strain BE2467 plasmid pPS1, complete sequence	165783-165814	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	CP028419	Aeromonas hydrophila strain WCX23 plasmid pWCX23_1, complete sequence	112824-112855	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP044962	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014881 plasmid pPNCS014881.1, complete sequence	107604-107635	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP024550	Klebsiella pneumoniae strain INF163 plasmid unnamed1, complete sequence	161450-161481	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP018318	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-2, complete sequence	29189-29220	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN823987	Escherichia coli strain 2016061604 plasmid p6061604-KPC, complete sequence	46694-46725	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	KR827391	Uncultured bacterium plasmid pKAZ2, complete sequence	116786-116817	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	KR827392	Uncultured bacterium plasmid pKAZ3, complete sequence	101358-101389	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	KR827393	Uncultured bacterium plasmid pKAZ4, complete sequence	125759-125790	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	KR827394	Uncultured bacterium plasmid pKAZ5, complete sequence	92053-92084	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP007558	Citrobacter freundii CFNIH1 plasmid pKEC-a3c, complete sequence	244374-244405	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021709	Klebsiella pneumoniae strain AR_0143 plasmid tig00000001_p1, complete sequence	115984-116015	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021551	Proteus mirabilis strain AR_0159 plasmid tig00000137, complete sequence	82411-82442	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP025236	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1926 plasmid pSNE2-1926, complete sequence	103759-103790	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP053365	Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence	85013-85044	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_AP018672	Klebsiella pneumoniae strain GSU10-3 plasmid pGSU10-3-1, complete sequence	132744-132775	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP009570	Salmonella enterica subsp. enterica serovar Newport str. CVM N1543 isolate CFSAN000926 plasmid pCVMN1543, complete sequence	92006-92037	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP009564	Salmonella enterica subsp. enterica serovar Newport str. CVM 21550 plasmid pCVM21550, complete sequence	38134-38165	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP009563	Salmonella enterica subsp. enterica serovar Newport str. CVM 21538 plasmid pCVM21538, complete sequence	40788-40819	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP011622	Klebsiella pneumoniae strain CAV1344 plasmid pKPC_CAV1344, complete sequence	86279-86310	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_AP019818	Enterobacter hormaechei subsp. hoffmannii strain OIPH-N069 plasmid pN069_1, complete sequence	116858-116889	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP041209	Salmonella enterica subsp. enterica serovar Newport strain SAP18-8729 plasmid pCFSAN074384_1, complete sequence	82906-82937	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP014295	Klebsiella pneumoniae strain KP38731 plasmid unnamed1, complete sequence	66403-66434	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021936	Escherichia coli strain AR_0055 plasmid unitig_2, complete sequence	70071-70102	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP031106	Escherichia coli strain AMSCJX02 plasmid pAMSC1, complete sequence	128555-128586	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP012902	Escherichia coli strain N15-01078 plasmid pNDM15-1078, complete sequence	33421-33452	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP023948	Klebsiella pneumoniae strain FDAARGOS_446 plasmid unnamed1, complete sequence	196697-196728	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP018689	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-2, complete sequence	3704-3735	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_019107	Salmonella enterica subsp. enterica serovar Dublin plasmid pSD_174, complete sequence	155696-155727	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_019116	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH163_135, complete sequence	116325-116356	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_019118	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH696_135, complete sequence	116580-116611	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_019121	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_166, complete sequence	38725-38756	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP020049	Escherichia coli strain AR_0118 plasmid unitig_1, complete sequence	51912-51943	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP019053	Escherichia coli strain CRE1540 plasmid p1540-2, complete sequence	135830-135861	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP029743	Escherichia coli strain AR_0085 plasmid unnamed2, complete sequence	28686-28717	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP020056	Escherichia coli strain AR_0069 plasmid unitig_2, complete sequence	29900-29931	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP032192	Salmonella enterica subsp. enterica serovar Senftenberg strain AR_0127 plasmid unnamed1, complete sequence	73107-73138	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP026233	Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-0b27, complete sequence	107433-107464	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_012692	Escherichia coli plasmid pAR060302, complete sequence	147687-147718	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_012693	Salmonella enterica plasmid pAM04528, complete sequence	139371-139402	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_016839	Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS3, complete sequence	75004-75035	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP015835	Escherichia coli strain MS6198 plasmid pMS6198A, complete sequence	117601-117632	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP024564	Klebsiella pneumoniae strain INF278 plasmid unnamed1, complete sequence	161450-161481	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP046773	Vibrio alginolyticus strain 2014V-1011 plasmid unnamed2, complete sequence	84296-84327	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP014775	Aeromonas veronii strain AVNIH1 plasmid pASP-a58, complete sequence	52313-52344	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP025245	Salmonella enterica subsp. enterica serovar Newport str. CDC 2012K-0663 isolate USDA-ARS-USMARC-1936 plasmid pSNE2-2012K-0663, complete sequence	92677-92708	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_019375	Providencia stuartii plasmid pTC2, complete sequence	155452-155483	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_019380	Aeromonas hydrophila plasmid pR148, complete sequence	145944-145975	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_023908	Klebsiella pneumoniae strain KP1 plasmid pKP1-NDM-1, complete sequence	118714-118745	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_022377	Escherichia coli strain SCEC2 plasmid pSCEC2, complete sequence	115642-115673	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021695	Proteus mirabilis strain AR_0155 plasmid tig00000123, complete sequence	209816-209847	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021952	Klebsiella pneumoniae strain AR_0148 plasmid tig00000169_pilon, complete sequence	68839-68870	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP032395	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_1, complete sequence	37526-37557	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP050732	Salmonella enterica subsp. enterica serovar Typhimurium strain ST101 plasmid pST101-1, complete sequence	160028-160059	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_023898	Klebsiella pneumoniae plasmid pRMH760, complete sequence	151789-151820	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP040884	Escherichia coli strain K71-77 plasmid pK71-77-1-NDM, complete sequence	97502-97533	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP025144	Klebsiella pneumoniae strain NR5632 plasmid NR5632_p1, complete sequence	120497-120528	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP025147	Klebsiella pneumoniae strain KP1766 plasmid KP1766_p1, complete sequence	125951-125982	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	LC225353	Photobacterium damselae subsp. piscicida plasmid pP0855 DNA, complete sequence	98563-98594	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_AP018143	Escherichia coli strain M214 isolate M214 plasmid pM214_AC2, complete sequence	156064-156095	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_AP018145	Escherichia coli strain M216 isolate M216 plasmid pM216_AC2, complete sequence	181176-181207	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP029718	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed5, complete sequence	75511-75542	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LN831185	Vibrio cholerae isolate V. cholerae 116-17a plasmid pNDM-116-17, complete sequence	103431-103462	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP031297	Escherichia coli strain EC17GD31 plasmid pGD31-NDM, complete sequence	153189-153220	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP050727	Salmonella enterica subsp. enterica serovar Typhimurium strain ST113 plasmid pST-1, complete sequence	32016-32047	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP050740	Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-1, complete sequence	33822-33853	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP048797	Providencia vermicola strain P8538 plasmid p8538-NDM-1, complete sequence	117591-117622	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP015394	Klebsiella pneumoniae strain CR14 plasmid pCR14_2, complete sequence	134335-134366	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP018698	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-2, complete sequence	84367-84398	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP018220	Salmonella enterica subsp. enterica strain LSP 389/97 plasmid pUO-STmRV1, complete sequence	167033-167064	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP027695	Klebsiella pneumoniae strain KP30835 plasmid unnamed2, complete sequence	10622-10653	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP045953	Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00008979 plasmid pAUSMDU00008979_01, complete sequence	128701-128732	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN550958	Proteus mirabilis strain PRT-ndm plasmid pPM154, complete sequence	106727-106758	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN603981	Klebsiella aerogenes strain 1564 plasmid p1564, complete sequence	116940-116971	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT882698	Klebsiella pneumoniae strain Klebsiella pneumoniae KLPN57 isolate KLPN57 plasmid I, complete sequence	68083-68114	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT882699	Enterobacter cloacae isolate Enterobacter cloacae ENCL58 plasmid I, complete sequence	108095-108126	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT985220	Escherichia coli strain 83 plasmid RCS1TR83_p, complete sequence	172879-172910	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT985234	Escherichia coli strain 557 plasmid RCS32TR557_p, complete sequence	30982-31013	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT985225	Escherichia coli strain 89 plasmid RCS2TR89_p, complete sequence	14792-14823	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT985258	Escherichia coli strain 726 plasmid RCS54TR726_p, complete sequence	135178-135209	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT985222	Escherichia coli strain 548 plasmid RCS24TR548_p, complete sequence	163166-163197	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT985228	Escherichia coli strain 552 plasmid RCS28TR552_p, complete sequence	68264-68295	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT985218	Escherichia coli strain 541 plasmid RCS18TR541_p, complete sequence	18748-18779	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT985260	Escherichia coli strain 724 plasmid RCS53TR724_p, complete sequence	23180-23211	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT985253	Escherichia coli strain 660 plasmid RCS48TR660_p, complete sequence	125802-125833	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT985250	Escherichia coli strain 170 plasmid RCS38_p, complete sequence	18853-18884	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT985224	Escherichia coli strain 513 plasmid RCS30_p, complete sequence	72425-72456	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT985243	Escherichia coli strain 722 plasmid RCS41_p, complete sequence	24355-24386	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_LT985244	Escherichia coli strain 167 plasmid RCS39_p, complete sequence	19537-19568	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP018956	Escherichia coli strain Ecol_316 plasmid pEC316_KPC, complete sequence	158551-158582	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN604267	Salmonella enterica subsp. enterica serovar London strain SAL-19-0623 plasmid pSAL-19-0623_NDM, complete sequence	241654-241685	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN604268	Escherichia coli strain J53 plasmid pJ53_SAL-19-0623_NDM, complete sequence	183993-184024	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP018710	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-2, complete sequence	77192-77223	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MK733575	Escherichia coli strain J53 plasmid pMG252A, complete sequence	84223-84254	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MK388209	Escherichia coli strain Ec20-Lar plasmid pC-Ec20-KPC, complete sequence	171835-171866	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MK439959	Escherichia coli strain Ec-2Lar plasmid pC-Ec2-KPC, complete sequence	209025-209056	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MN101850	Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence	252386-252417	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MN101853	Escherichia coli strain 13ZX36 plasmid p13ZX36-200, complete sequence	178749-178780	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MK770642	Klebsiella pneumoniae strain T38 plasmid pT38_MCR3, complete sequence	127988-128019	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MK123268	Serratia marcescens strain M17468 plasmid pSMA17468, complete sequence	120173-120204	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MN148427	Proteus vulgaris strain PV835 plasmid pPV835TEM24, complete sequence	119367-119398	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_022522	Salmonella enterica subsp. enterica serovar Kentucky strain 1643/10 plasmid p1643_10, complete sequence	148777-148808	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN657249	Enterobacteriaceae bacterium strain 1086-16 plasmid pKP39-T3, complete sequence	135178-135209	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN657250	Enterobacteriaceae bacterium strain 1083-16 plasmid pKP39-T4, complete sequence	136414-136445	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN657252	Enterobacteriaceae bacterium strain 21-16 plasmid pPS-T1, complete sequence	149095-149126	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP032380	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69807 plasmid pSDU1-USMARC-69807, complete sequence	1094-1125	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP032448	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69840 plasmid pSDU2-USMARC-69840, complete sequence	20832-20863	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH995508	Enterobacter cloacae strain ECL17464 plasmid pECL17464, complete sequence	120174-120205	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH995506	Citrobacter freundii strain CFR17394 plasmid pCFR17394, complete sequence	120174-120205	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH105050	Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncA/C-IncX3, complete sequence	127260-127291	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH917285	Klebsiella pneumoniae strain 427113 plasmid p427113-Ct1/2, complete sequence	185702-185733	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH909327	Klebsiella pneumoniae strain 526316 plasmid p526316-KPC, complete sequence	147028-147059	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH263652	Providencia rettgeri strain QD51 plasmid pNDM-QD51, complete sequence	114840-114871	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH917284	Klebsiella pneumoniae strain 397108 plasmid p397108-Ct2, complete sequence	91989-92020	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH760469	Salmonella enterica strain 2016K-0796 plasmid p2016K-0796, complete sequence	161016-161047	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MK205418	Salmonella enterica subsp. enterica serovar Dublin strain 14-1360 plasmid p14-1360-1, complete sequence	82443-82474	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MK205416	Salmonella enterica subsp. enterica serovar Dublin strain N13-01070 plasmid pN13-01070-1, complete sequence	88461-88492	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MK205417	Salmonella enterica subsp. enterica serovar Dublin strain N13-01141 plasmid pN13-01141, complete sequence	64549-64580	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH061195	Klebsiella pneumoniae strain AHM7C8I plasmid pHNAH8I-NDM, complete sequence	81351-81382	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MK033499	Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence	66358-66389	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH011352	Klebsiella pneumoniae strain 185 plasmid pNDM-185, complete sequence	192661-192692	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH476540	Klebsiella pneumoniae strain KP1276 plasmid pIA/C-KLUC, complete sequence	172254-172285	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MK101346	Citrobacter freundii strain CRE3 plasmid pCRE7-NDM, complete sequence	109367-109398	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN657241	Enterobacteriaceae bacterium strain 20-16 plasmid pCF104a-T3, complete sequence	156543-156574	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN657242	Enterobacteriaceae bacterium strain 128-16 plasmid pEC405a-T3, complete sequence	68568-68599	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN657243	Enterobacteriaceae bacterium strain 24-16 plasmid pEC744-T5, complete sequence	127560-127591	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN657244	Enterobacteriaceae bacterium strain 690-16 plasmid pEC6332-T3, complete sequence	95303-95334	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MN657247	Enterobacteriaceae bacterium strain 460-16 plasmid pECl-T3, complete sequence	74957-74988	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP009410	Salmonella enterica strain CFSAN007405 isolate 30034 plasmid pCFSAN007405_01, complete sequence	113313-113344	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MG764534	Klebsiella aerogenes strain EA409 plasmid pEA409TEM24, complete sequence	113186-113217	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MF627444	Vibrio parahaemolyticus strain Vb0267 plasmid pVb0267, complete sequence	146496-146527	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH001166	Escherichia coli strain TAEC1 plasmid pNDM-TAEC1, complete sequence	164040-164071	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MF150121	Klebsiella pneumoniae strain A64477 plasmid pKP64477c, complete sequence	7962-7993	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MF150123	Klebsiella pneumoniae strain A64216 plasmid pKP64216b, complete sequence	6903-6934	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MF344573	Klebsiella pneumoniae strain N201205880 plasmid p205880-Ct1/2, complete sequence	133401-133432	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MF344572	Enterobacter hormaechei strain 24845 plasmid p24845-Ct2, complete sequence	147627-147658	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MF344574	Enterobacter hormaechei strain T5282 plasmid pT5282-Ct2, complete sequence	115821-115852	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MG450360	Escherichia coli strain AMA566 plasmid pAMA566, complete sequence	169885-169916	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MG252895	Escherichia coli strain Esco-36073cz plasmid pEsco-36073cz, complete sequence	282125-282156	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH113855	Vibrio alginolyticus strain Vb1796 plasmid pVb1796, complete sequence	143860-143891	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH457126	Vibrio alginolyticus strain Vb1394 plasmid pC1394, complete sequence	147178-147209	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH475146	Citrobacter freundii strain 164 plasmid pCf164_LMB-1, complete sequence	129613-129644	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH763829	Citrobacter freundii strain JY-17 plasmid pCFJY-17, complete sequence	140752-140783	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH892479	Citrobacter freundii strain 2262 plasmid pNDM-2262, complete sequence	155503-155534	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MH844629	Escherichia coli strain 2248 plasmid pNDM-2248, complete sequence	162661-162692	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP030132	Klebsiella pneumoniae strain 160111 plasmid pIncAC2_L111, complete sequence	103191-103222	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MT219816	Escherichia coli strain RF173-1 plasmid pRF173-1_87k_tetX, complete sequence	67483-67514	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KY887591	Escherichia coli strain Ec19 plasmid pEc19, complete sequence	170002-170033	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KY887590	Escherichia coli strain Ec9 plasmid pEc9, complete sequence	209664-209695	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_KY887595	Escherichia coli strain Ec78 plasmid pEc78, complete sequence	214204-214235	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MF582638	Klebsiella pneumoniae strain KKp4 plasmid pKKp4-VIM, complete sequence	142136-142167	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MF072965	Citrobacter freundii strain P10159 plasmid pP10159-5, complete sequence	143000-143031	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MG764552	Klebsiella pneumoniae strain A1763 plasmid pA1763-Ct2, complete sequence	73433-73464	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MF150118	Proteus mirabilis strain A64421 plasmid pPM64421a, complete sequence	105797-105828	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MF627445	Vibrio parahaemolyticus strain Vb0499 plasmid pVb0499, complete sequence	172765-172796	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_MF497432	Vibrio alginolyticus strain Vb0506 plasmid pVb0506, complete sequence	113752-113783	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP040068	Escherichia coli strain A1_181 plasmid p_unnamed1_KPC2, complete sequence	160332-160363	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP044189	Salmonella enterica subsp. enterica strain AR-0401 plasmid pAR-0401-1, complete sequence	78629-78660	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP028814	Edwardsiella ictaluri strain MS-17-156 plasmid pEI-MS-17-156-1, complete sequence	51373-51404	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP020913	Salmonella enterica subsp. enterica serovar Montevideo str. CDC 2010K-0257 plasmid pSMO-2010K-0257, complete sequence	101044-101075	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP029737	Providencia rettgeri strain AR_0082 plasmid unnamed, complete sequence	4670-4701	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP048384	Citrobacter freundii strain 62 plasmid p6_B, complete sequence	170674-170705	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP032168	Klebsiella pneumoniae strain AR_0076 plasmid unnamed1, complete sequence	122818-122849	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP053192	Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37b, complete sequence	109054-109085	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	MT151380	Vibrio cholerae strain YA00120881 plasmid pYA00120881, complete sequence	139898-139929	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP054305	Klebsiella pneumoniae strain MS14393 plasmid pMS14393B, complete sequence	86205-86236	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	692498-692529	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1044204-1044235	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1013041-1013072	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	677353-677384	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1110424-1110455	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	274398-274429	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	685598-685629	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	675142-675173	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	614953-614984	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1343306-1343337	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	1030186-1030217	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	936847-936878	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	731834-731865	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	599586-599617	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	251291-251322	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1464116-1464147	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	332189-332220	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	837319-837350	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	699032-699063	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1184782-1184813	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	957465-957496	8	0.75
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1044207-1044238	8	0.75
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1676794-1676825	9	0.719
NZ_CP053582_2	2.4\|3154205\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154205-3154236	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1653435-1653466	9	0.719
NZ_CP053582_2	2.6\|3154327\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154327-3154358	32	LC487410	Vibrio phage KIT04 DNA, complete genome	22938-22969	9	0.719
NZ_CP053582_2	2.9\|3154510\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154510-3154541	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	407006-407037	9	0.719
NZ_CP053582_2	2.14\|3154815\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154815-3154846	32	NZ_CP020429	Streptococcus sp. FDAARGOS_192 plasmid unnamed1, complete sequence	203816-203847	9	0.719
NZ_CP053582_2	2.14\|3154815\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154815-3154846	32	NZ_CP043831	Bacillus sp. BS98 plasmid unnamed1	126771-126802	9	0.719
NZ_CP053582_2	2.14\|3154815\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154815-3154846	32	NZ_CP018188	Streptococcus salivarius strain ICDC2 plasmid, complete sequence	181552-181583	9	0.719
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	86100-86131	9	0.719
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP049157	Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence	473385-473416	9	0.719
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP049317	Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence	1169279-1169310	9	0.719
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	405283-405314	9	0.719
NZ_CP053582_2	2.19\|3155120\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3155120-3155151	32	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	662798-662829	9	0.719
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1676794-1676825	9	0.719
NZ_CP053582_2	2.26\|3154207\|32\|NZ_CP053582\|PILER-CR	3154207-3154238	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1653435-1653466	9	0.719
NZ_CP053582_2	2.28\|3154329\|32\|NZ_CP053582\|PILER-CR	3154329-3154360	32	LC487410	Vibrio phage KIT04 DNA, complete genome	22938-22969	9	0.719
NZ_CP053582_2	2.31\|3154512\|32\|NZ_CP053582\|PILER-CR	3154512-3154543	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	407006-407037	9	0.719
NZ_CP053582_2	2.36\|3154817\|32\|NZ_CP053582\|PILER-CR	3154817-3154848	32	NZ_CP020429	Streptococcus sp. FDAARGOS_192 plasmid unnamed1, complete sequence	203816-203847	9	0.719
NZ_CP053582_2	2.36\|3154817\|32\|NZ_CP053582\|PILER-CR	3154817-3154848	32	NZ_CP043831	Bacillus sp. BS98 plasmid unnamed1	126771-126802	9	0.719
NZ_CP053582_2	2.36\|3154817\|32\|NZ_CP053582\|PILER-CR	3154817-3154848	32	NZ_CP018188	Streptococcus salivarius strain ICDC2 plasmid, complete sequence	181552-181583	9	0.719
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	86100-86131	9	0.719
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP049157	Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence	473385-473416	9	0.719
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP049317	Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence	1169279-1169310	9	0.719
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	405283-405314	9	0.719
NZ_CP053582_2	2.41\|3155122\|32\|NZ_CP053582\|PILER-CR	3155122-3155153	32	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	662798-662829	9	0.719
NZ_CP053582_2	2.3\|3154144\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154144-3154175	32	NZ_CP012627	Escherichia coli strain SF-468 plasmid pSF-468-2, complete sequence	73187-73218	10	0.688
NZ_CP053582_2	2.7\|3154388\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154388-3154419	32	CP034667	Proteus vulgaris strain PvSC3 plasmid pPvSC3, complete sequence	113050-113081	10	0.688
NZ_CP053582_2	2.25\|3154146\|32\|NZ_CP053582\|PILER-CR	3154146-3154177	32	NZ_CP012627	Escherichia coli strain SF-468 plasmid pSF-468-2, complete sequence	73187-73218	10	0.688
NZ_CP053582_2	2.29\|3154390\|32\|NZ_CP053582\|PILER-CR	3154390-3154421	32	CP034667	Proteus vulgaris strain PvSC3 plasmid pPvSC3, complete sequence	113050-113081	10	0.688
NZ_CP053582_2	2.15\|3154876\|32\|NZ_CP053582\|CRISPRCasFinder,CRT	3154876-3154907	32	NZ_CP043437	Enterobacter sp. LU1 plasmid unnamed	312749-312780	11	0.656
NZ_CP053582_2	2.37\|3154878\|32\|NZ_CP053582\|PILER-CR	3154878-3154909	32	NZ_CP043437	Enterobacter sp. LU1 plasmid unnamed	312749-312780	11	0.656

1. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to CP053410 (Salmonella enterica strain 2014K-0203 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacagcatttttcgttgagact	Protospacer
********************************

2. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to CP053410 (Salmonella enterica strain 2014K-0203 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacagcatttttcgttgagact	Protospacer
********************************

3. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KP682381 (Escherichia phage PA28, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

4. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK972697 (Salmonella phage SF10, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

5. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to AP012533 (Stx2-converting phage Stx2a_F723 proviral DNA, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

6. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MT225101 (Escherichia phage Lys19259Vzw, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

7. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KU977419 (Stx1 converting phage AU5Stx1, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

8. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK972696 (Salmonella phage Si3 KFo-2019, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

9. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_049944 (Stx2-converting phage Stx2a_WGPS8 proviral DNA, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

10. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to JQ011316 (Escherichia phage TL-2011a, partial genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

11. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK972695 (Salmonella phage SI5, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

12. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_049925 (Stx converting phage vB_EcoS_P27, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

13. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK972688 (Salmonella phage SI8, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

14. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK972689 (Salmonella phage SF6, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

15. spacer 2.21|3155242|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KP763470 (Salmonella enterica subsp. enterica serovar Typhimurium strain L946 plasmid pSTM_Phi, complete sequence) position: , mismatch: 1, identity: 0.969

atctcttagtgctacggtcatgctcattcccc	CRISPR spacer
atctctcagtgctacggtcatgctcattcccc	Protospacer
******.*************************

16. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to KP682381 (Escherichia phage PA28, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

17. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MK972697 (Salmonella phage SF10, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

18. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to AP012533 (Stx2-converting phage Stx2a_F723 proviral DNA, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

19. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MT225101 (Escherichia phage Lys19259Vzw, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

20. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to KU977419 (Stx1 converting phage AU5Stx1, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

21. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MK972696 (Salmonella phage Si3 KFo-2019, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

22. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to NC_049944 (Stx2-converting phage Stx2a_WGPS8 proviral DNA, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

23. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to JQ011316 (Escherichia phage TL-2011a, partial genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

24. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MK972695 (Salmonella phage SI5, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

25. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to NC_049925 (Stx converting phage vB_EcoS_P27, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

26. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MK972688 (Salmonella phage SI8, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

27. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MK972689 (Salmonella phage SF6, complete genome) position: , mismatch: 1, identity: 0.969

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgagact	Protospacer
************** *****************

28. spacer 2.43|3155244|32|NZ_CP053582|PILER-CR matches to NZ_KP763470 (Salmonella enterica subsp. enterica serovar Typhimurium strain L946 plasmid pSTM_Phi, complete sequence) position: , mismatch: 1, identity: 0.969

atctcttagtgctacggtcatgctcattcccc	CRISPR spacer
atctctcagtgctacggtcatgctcattcccc	Protospacer
******.*************************

29. spacer 2.1|3154022|32|NZ_CP053582|CRISPRCasFinder,CRT matches to CP051275 (Salmonella phage SW-37, complete genome) position: , mismatch: 2, identity: 0.938

tcggtccactgaagcacctcttgaaagaagcg	CRISPR spacer
tcggtccgctgaagcacctctcgaaagaagcg	Protospacer
*******.*************.**********

30. spacer 2.1|3154022|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_028696 (Salmonella phage SEN22, complete genome) position: , mismatch: 2, identity: 0.938

tcggtccactgaagcacctcttgaaagaagcg	CRISPR spacer
tcggtccactgaaacacctctcgaaagaagcg	Protospacer
*************.*******.**********

31. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to AF034975 (Bacteriophage H-19B essential recombination function protein (erf), kil protein (kil), regulatory protein cIII (cIII), protein gp17 (17), N protein (N), cI protein (cI), cro protein (cro), cII protein (cII), O protein (O), P protein (P), ren protein (ren), nin orf-58-A, nin orf-58-B, Roi (roi), nin orf-204, nin orf-59, Q protein (Q), Shiga-like toxin A subunit (slt-IA), Shiga-like toxin B subunit (slt-IB), putative holin protein (S), R protein (R), and Rz protein (Rz) genes, complete cds) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgtgact	Protospacer
************** ************ ****

32. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to JQ086376 (Enterobacteria phage HK630, complete genome) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caactggatagacaccatttttcgttgagact	Protospacer
****.********* *****************

33. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019705 (Enterobacteria phage mEpX2, complete genome) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caactggatagacaccatttttcgttgagact	Protospacer
****.********* *****************

34. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019711 (Enterobacteria phage HK629, complete genome) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caactggatagacaccatttttcgttgagact	Protospacer
****.********* *****************

35. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to AP005153 (Stx1 converting phage DNA, complete genome) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgtgact	Protospacer
************** ************ ****

36. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KY979108 (Escherichia phage ECP1, complete genome) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgtgact	Protospacer
************** ************ ****

37. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to AP000400 (Enterobacteria phage VT1-Sakai genomic DNA, prophage inserted region in Escherichia coli O157:H7) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgtgact	Protospacer
************** ************ ****

38. spacer 2.23|3154024|32|NZ_CP053582|PILER-CR matches to CP051275 (Salmonella phage SW-37, complete genome) position: , mismatch: 2, identity: 0.938

tcggtccactgaagcacctcttgaaagaagcg	CRISPR spacer
tcggtccgctgaagcacctctcgaaagaagcg	Protospacer
*******.*************.**********

39. spacer 2.23|3154024|32|NZ_CP053582|PILER-CR matches to NC_028696 (Salmonella phage SEN22, complete genome) position: , mismatch: 2, identity: 0.938

tcggtccactgaagcacctcttgaaagaagcg	CRISPR spacer
tcggtccactgaaacacctctcgaaagaagcg	Protospacer
*************.*******.**********

40. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to AF034975 (Bacteriophage H-19B essential recombination function protein (erf), kil protein (kil), regulatory protein cIII (cIII), protein gp17 (17), N protein (N), cI protein (cI), cro protein (cro), cII protein (cII), O protein (O), P protein (P), ren protein (ren), nin orf-58-A, nin orf-58-B, Roi (roi), nin orf-204, nin orf-59, Q protein (Q), Shiga-like toxin A subunit (slt-IA), Shiga-like toxin B subunit (slt-IB), putative holin protein (S), R protein (R), and Rz protein (Rz) genes, complete cds) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgtgact	Protospacer
************** ************ ****

41. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to JQ086376 (Enterobacteria phage HK630, complete genome) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caactggatagacaccatttttcgttgagact	Protospacer
****.********* *****************

42. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to NC_019705 (Enterobacteria phage mEpX2, complete genome) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caactggatagacaccatttttcgttgagact	Protospacer
****.********* *****************

43. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to NC_019711 (Enterobacteria phage HK629, complete genome) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caactggatagacaccatttttcgttgagact	Protospacer
****.********* *****************

44. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to AP005153 (Stx1 converting phage DNA, complete genome) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgtgact	Protospacer
************** ************ ****

45. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to KY979108 (Escherichia phage ECP1, complete genome) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgtgact	Protospacer
************** ************ ****

46. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to AP000400 (Enterobacteria phage VT1-Sakai genomic DNA, prophage inserted region in Escherichia coli O157:H7) position: , mismatch: 2, identity: 0.938

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatagacaccatttttcgttgtgact	Protospacer
************** ************ ****

47. spacer 2.1|3154022|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KC139516 (Salmonella phage FSL SP-016, partial genome) position: , mismatch: 3, identity: 0.906

tcggtccactgaagcacctcttgaaagaagcg	CRISPR spacer
tcggtccactgaagcacctctcgaaagaggca	Protospacer
*********************.******.**.

48. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK972693 (Salmonella phage SI23, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

49. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MG969415 (UNVERIFIED: Salmonella phage GE_vB_TR, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

50. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK770415 (Salmonella phage SF11, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

51. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK972694 (Salmonella phage SE22, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

52. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK770414 (Salmonella phage SE16, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

53. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MH370364 (Salmonella phage S107, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

54. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK972686 (Salmonella phage SF3, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

55. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK972685 (Salmonella phage SE10, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

56. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK972687 (Salmonella phage SE1 (in:P22virus), complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

57. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MH370382 (Salmonella phage S135, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

58. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MH370383 (Salmonella phage S137, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

59. spacer 2.16|3154937|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK972692 (Salmonella phage SE21, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

60. spacer 2.23|3154024|32|NZ_CP053582|PILER-CR matches to KC139516 (Salmonella phage FSL SP-016, partial genome) position: , mismatch: 3, identity: 0.906

tcggtccactgaagcacctcttgaaagaagcg	CRISPR spacer
tcggtccactgaagcacctctcgaaagaggca	Protospacer
*********************.******.**.

61. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MK972693 (Salmonella phage SI23, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

62. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MG969415 (UNVERIFIED: Salmonella phage GE_vB_TR, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

63. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MK770415 (Salmonella phage SF11, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

64. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MK972694 (Salmonella phage SE22, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

65. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MK770414 (Salmonella phage SE16, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

66. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MH370364 (Salmonella phage S107, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

67. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MK972686 (Salmonella phage SF3, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

68. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MK972685 (Salmonella phage SE10, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

69. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MK972687 (Salmonella phage SE1 (in:P22virus), complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

70. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MH370382 (Salmonella phage S135, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

71. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MH370383 (Salmonella phage S137, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

72. spacer 2.38|3154939|32|NZ_CP053582|PILER-CR matches to MK972692 (Salmonella phage SE21, complete genome) position: , mismatch: 3, identity: 0.906

caaccggatagacagcatttttcgttgagact	CRISPR spacer
caaccggatggacagcattttccgttgagaat	Protospacer
*********.***********.******** *

73. spacer 1.3|1964172|30|NZ_CP053582|CRT matches to MN693215 (Marine virus AFVG_25M456, complete genome) position: , mismatch: 6, identity: 0.8

gagctggttattaaagacagacagct-taca	CRISPR spacer
ttactggttatcaaagacaaacagctgtac-	Protospacer
  .********.*******.****** ***

74. spacer 1.1|1964052|30|NZ_CP053582|CRT matches to KC182543 (Lactococcus lactis phage 645, complete genome) position: , mismatch: 7, identity: 0.767

aagcgggttatcagatatcgacagctccct	CRISPR spacer
aactgggttatcagtaatcgacagctctaa	Protospacer
** .**********  ***********.

75. spacer 1.1|1964052|30|NZ_CP053582|CRT matches to KC182542 (Lactococcus phage 340, complete genome) position: , mismatch: 7, identity: 0.767

aagcgggttatcagatatcgacagctccct	CRISPR spacer
aactgggttatcagtaatcgacagctctaa	Protospacer
** .**********  ***********.

76. spacer 2.8|3154449|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK387337 (Vibrio phage ValB1MD, complete genome) position: , mismatch: 7, identity: 0.781

ccagtgtatgaatcagaaaatgaagtataaaa	CRISPR spacer
tcagtgaatgaatcagaaaacgaagttaagat	Protospacer
.***** *************.*****  *.*

77. spacer 2.17|3154998|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_010371 (Finegoldia magna ATCC 29328 plasmid pFMC, complete sequence) position: , mismatch: 7, identity: 0.781

ttattaaataaccaaaatatggttatattcga	CRISPR spacer
ataaaaaataaccaaaatatgattatttttta	Protospacer
 **  ****************.**** **. *

78. spacer 2.17|3154998|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MH051913 (Enterobacteria phage vB_EcoM_IME281, complete genome) position: , mismatch: 7, identity: 0.781

ttattaaataaccaaaatatggttat--attcga	CRISPR spacer
gcatgaaatagccaaaatatggttatcaattt--	Protospacer
 .** *****.***************  ***.

79. spacer 2.17|3154998|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MT611523 (Escherichia phage DK-13, complete genome) position: , mismatch: 7, identity: 0.781

ttattaaataaccaaaatatggttat--attcga	CRISPR spacer
gcatgaaatagccaaaatatggttatcaattt--	Protospacer
 .** *****.***************  ***.

80. spacer 2.17|3154998|32|NZ_CP053582|CRISPRCasFinder,CRT matches to AP014358 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C94, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.781

ttattaaataaccaaaatatggttatattcga	CRISPR spacer
tttgttaataacctaaaaatggttatattagc	Protospacer
**  * ******* *** *********** *

81. spacer 2.18|3155059|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN813684 (Microbacterium phage Terij, complete genome) position: , mismatch: 7, identity: 0.781

ctgatactcatgcccaggtcggaacggatcac	CRISPR spacer
cggaggtccatgccgaggtcggcacggatcac	Protospacer
* ** ...****** ******* *********

82. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
aggctgcggccagccatgcgatcactgtgcag	Protospacer
** .*** ****.***************  *.

83. spacer 2.30|3154451|32|NZ_CP053582|PILER-CR matches to MK387337 (Vibrio phage ValB1MD, complete genome) position: , mismatch: 7, identity: 0.781

ccagtgtatgaatcagaaaatgaagtataaaa	CRISPR spacer
tcagtgaatgaatcagaaaacgaagttaagat	Protospacer
.***** *************.*****  *.*

84. spacer 2.39|3155000|32|NZ_CP053582|PILER-CR matches to NC_010371 (Finegoldia magna ATCC 29328 plasmid pFMC, complete sequence) position: , mismatch: 7, identity: 0.781

ttattaaataaccaaaatatggttatattcga	CRISPR spacer
ataaaaaataaccaaaatatgattatttttta	Protospacer
 **  ****************.**** **. *

85. spacer 2.39|3155000|32|NZ_CP053582|PILER-CR matches to MH051913 (Enterobacteria phage vB_EcoM_IME281, complete genome) position: , mismatch: 7, identity: 0.781

ttattaaataaccaaaatatggttat--attcga	CRISPR spacer
gcatgaaatagccaaaatatggttatcaattt--	Protospacer
 .** *****.***************  ***.

86. spacer 2.39|3155000|32|NZ_CP053582|PILER-CR matches to MT611523 (Escherichia phage DK-13, complete genome) position: , mismatch: 7, identity: 0.781

ttattaaataaccaaaatatggttat--attcga	CRISPR spacer
gcatgaaatagccaaaatatggttatcaattt--	Protospacer
 .** *****.***************  ***.

87. spacer 2.39|3155000|32|NZ_CP053582|PILER-CR matches to AP014358 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C94, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.781

ttattaaataaccaaaatatggttatattcga	CRISPR spacer
tttgttaataacctaaaaatggttatattagc	Protospacer
**  * ******* *** *********** *

88. spacer 2.40|3155061|32|NZ_CP053582|PILER-CR matches to MN813684 (Microbacterium phage Terij, complete genome) position: , mismatch: 7, identity: 0.781

ctgatactcatgcccaggtcggaacggatcac	CRISPR spacer
cggaggtccatgccgaggtcggcacggatcac	Protospacer
* ** ...****** ******* *********

89. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
aggctgcggccagccatgcgatcactgtgcag	Protospacer
** .*** ****.***************  *.

90. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

91. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

92. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

93. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

94. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

95. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

96. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

97. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

98. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

99. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

100. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

101. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

102. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

103. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

104. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

105. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

106. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

107. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

108. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

109. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

110. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

111. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

112. spacer 2.6|3154327|32|NZ_CP053582|CRISPRCasFinder,CRT matches to AF242738 (Bacteriophage phi LC3, complete genome) position: , mismatch: 8, identity: 0.75

tgtagcaccagcaataacagtcggtagatggg	CRISPR spacer
taaagcaccagcaataacagttgctaaaggct	Protospacer
*. ******************.* **.* *

113. spacer 2.6|3154327|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_005822 (Lactococcus phage phiLC3, complete genome) position: , mismatch: 8, identity: 0.75

tgtagcaccagcaataacagtcggtagatggg	CRISPR spacer
taaagcaccagcaataacagttgctaaaggct	Protospacer
*. ******************.* **.* *

114. spacer 2.6|3154327|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KX160220 (Lactococcus phage Dub35A, complete genome) position: , mismatch: 8, identity: 0.75

tgtagcaccagcaataacagtcggtagatggg	CRISPR spacer
taaagcaccagcaataacagttgctaaaggtt	Protospacer
*. ******************.* **.* *

115. spacer 2.8|3154449|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_018686 (Bacillus thuringiensis MC28 plasmid pMC183, complete sequence) position: , mismatch: 8, identity: 0.75

ccagtgtatgaatcagaaaatgaagtataaaa	CRISPR spacer
aaagtgtatgaatcagaacttgaagaacgtaa	Protospacer
  ****************  ***** *.. **

116. spacer 2.14|3154815|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP047432 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-4, complete sequence) position: , mismatch: 8, identity: 0.75

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
atagaaaaaataatccacatcaatttcagaat	Protospacer
 * ************* **** ****** .

117. spacer 2.14|3154815|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP046370 (Spiroplasma citri strain BR12 plasmid pScpBR12-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
atagaaaaaataatccacatcaatttcagaat	Protospacer
 * ************* **** ****** .

118. spacer 2.14|3154815|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP047441 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-4, complete sequence) position: , mismatch: 8, identity: 0.75

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
atagaaaaaataatccacatcaatttcagaat	Protospacer
 * ************* **** ****** .

119. spacer 2.14|3154815|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP053311 (Spiroplasma citri strain C5 plasmid pScpC5-7, complete sequence) position: , mismatch: 8, identity: 0.75

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
atagaaaaaataatccacatcaatttcagaat	Protospacer
 * ************* **** ****** .

120. spacer 2.17|3154998|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN693026 (Marine virus AFVG_117M72, complete genome) position: , mismatch: 8, identity: 0.75

ttattaaataaccaaaatatggttatattcga	CRISPR spacer
gtattatataaccaaaatatggttttaaagct	Protospacer
 ***** ***************** **

121. spacer 2.17|3154998|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP028244 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttattaaataaccaaaatatggttatattcga	CRISPR spacer
gtaagaattcaccaaaatatggttatataaca	Protospacer
 **  ** * ******************   *

122. spacer 2.17|3154998|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP054261 (Lactobacillus plantarum strain TCI507 plasmid unnamed2) position: , mismatch: 8, identity: 0.75

ttattaaataaccaaaatatggttatattcga	CRISPR spacer
gtaagaattcaccaaaatatggttatataaca	Protospacer
 **  ** * ******************   *

123. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to CP007642 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttcccgccgccaaccatgcgatcaaggtcgcc	Protospacer
  *..*******************  ****

124. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_014312 (Klebsiella pneumoniae plasmid pKP048, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

125. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KX147633 (Citrobacter freundii strain AMA332 plasmid pT1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

126. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KX709966 (Pseudomonas aeruginosa strain IP40a plasmid pIP40a, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

127. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KX786648 (Enterobacter cloacae strain B557 plasmid pB557-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

128. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KX869741 (Enterobacter cloacae strain 20130723 plasmid R222, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

129. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KY399978 (Vibrio cholerae O139 strain ICDC-211 plasmid pVC211, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

130. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KY986974 (Citrobacter freundii strain 112298 plasmid p112298-tetA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

131. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KY887592 (Citrobacter freundii strain Cf52 plasmid pCf52, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

132. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KY887593 (Citrobacter freundii strain Cf53 plasmid pCf53, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

133. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KY887594 (Klebsiella pneumoniae strain Kp55 plasmid pKp55, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

134. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_AP023051 (Citrobacter portucalensis strain IOMTU157 plasmid pIOMTU157, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

135. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_022652 (Klebsiella pneumoniae strain CRE114 plasmid pIMP-PH114, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

136. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP033514 (Vibrio cholerae strain E4 plasmid pVCR94, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

137. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP009414 (Salmonella enterica strain CFSAN007428 isolate N11150 plasmid pCFSAN007428_01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

138. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KU726616 (Salmonella enterica subsp. enterica serovar Stanley strain LS001 plasmid pHS36-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

139. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KX458222 (Klebsiella pneumoniae strain B2 plasmid pB2-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

140. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KX636095 (Klebsiella pneumoniae strain RJ119 plasmid pRJ119-NDM1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

141. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KX815983 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

142. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KT997783 (Escherichia coli strain Y5 plasmid pECY53, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

143. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KX156772 (Escherichia coli strain K-12 plasmid IP40a, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

144. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KU302802 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

145. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KT935446 (Klebsiella pneumoniae strain Kp2964 plasmid 2964TF, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

146. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KX156773 (Escherichia coli strain K-12 plasmid R16a, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

147. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KX029331 (Klebsiella pneumoniae strain K-109-R plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

148. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KU302801 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

149. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP035548 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

150. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP009412 (Salmonella enterica strain CFSAN007426 isolate N19767 plasmid pCFSAN007426_01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

151. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP009411 (Salmonella enterica strain CFSAN007425 isolate 22697 plasmid pCFSAN007425_01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

152. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP009413 (Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

153. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KJ588779 (Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pNDM-US-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

154. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KJ909290 (Aeromonas salmonicida subsp. salmonicida strain 2004-05MF26 plasmid pSN254b, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

155. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KM083064 (Vibrio cholerae strain ICDC-1447 plasmid pVC1447, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

156. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KR559888 (Klebsiella pneumoniae strain Kpn642 plasmid pKP-Gr642, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

157. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KR559889 (Klebsiella pneumoniae strain Kpn8143 plasmid pKP-Gr8143, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

158. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KJ802405 (Providencia stuartii isolate GN576 plasmid pNDM-PstGN576, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

159. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KP742988 (Salmonella enterica subsp. enterica serovar Senftenberg strain BCH02406 plasmid pNDM-SAL, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

160. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KM670336 (Salmonella enterica subsp. enterica serovar Senftenberg strain SRC119 plasmid pSRC119-A/C, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

161. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KR091911 (Salmonella enterica subsp. enterica serovar Corvallis strain RH-1238 plasmid pRH-1238, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

162. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KP975074 (Citrobacter freundii strain MRSN11938 plasmid pMRVIM0912, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

163. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KR559890 (Enterobacter cloacae strain Ecl4873 plasmid pEcl-Gr4873, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

164. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KJ802404 (Escherichia coli isolate GN568 plasmid pNDM-EcoGN568, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

165. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KP056256 (Escherichia coli strain YDC637 plasmid pYDC637, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

166. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KP345882 (Escherichia coli strain BK32533 plasmid pBK32533, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

167. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to AP014611 (Serratia marcescens plasmid p11663 DNA, complete sequence, strain: 11663) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

168. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP028197 (Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

169. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP041027 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

170. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP025141 (Klebsiella pneumoniae strain KP1768 plasmid KP1768_p1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

171. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP032391 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

172. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP017987 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

173. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP022126 (Klebsiella pneumoniae strain DHQP1605752_NV plasmid p1605752AC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

174. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP017387 (Klebsiella pneumoniae strain KP36 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

175. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP047308 (Citrobacter freundii strain L75 plasmid pCf75, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

176. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP045742 (Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

177. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP013324 (Klebsiella pneumoniae strain CAV1193 plasmid pCAV1193-166, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

178. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP034402 (Escherichia coli strain CRE10 plasmid pCRE10.2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

179. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP010373 (Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

180. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP048305 (Escherichia coli strain 9 plasmid p009_A, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

181. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP025240 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE3-1928, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

182. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP025242 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1929 plasmid pSNE1-1929, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

183. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to LC055503 (Klebsiella pneumoniae plasmid pHM881QN DNA, complete sequence, strain: Y881) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

184. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP024192 (Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

185. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN477204 (Escherichia coli strain S15FP06257 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

186. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP027679 (Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

187. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP017058 (Citrobacter freundii strain SL151 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

188. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP020513 (Escherichia coli strain 165 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

189. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP029730 (Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

190. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LS992184 (Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

191. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KC999035 (Escherichia coli strain EC2 plasmid pEC2-NDM-3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

192. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP018716 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

193. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP018722 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

194. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP018704 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

195. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP029249 (Salmonella enterica subsp. enterica serovar Thompson strain HFCDC-SM-846 plasmid p846, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

196. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_008612 (Photobacterium damselae subsp. piscicida plasmid pP99-018, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

197. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP025470 (Klebsiella pneumoniae strain JS187 plasmid p187-4, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

198. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP020524 (Escherichia coli strain 190 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

199. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_AP022377 (Providencia stuartii strain BML2537 plasmid pBML2537, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

200. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP022359 (Shewanella bicestrii strain JAB-1 plasmid pSHE-CTX-M, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

201. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT904892 (Salmonella enterica subsp. enterica serovar Typhi strain 80-2002 plasmid 2) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

202. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP029802 (Salmonella enterica subsp. enterica serovar Anatum strain R16.0676 plasmid pR16.0676_90k, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

203. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP008790 (Klebsiella oxytoca KONIH1 plasmid pKOX-86d, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

204. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP027038 (Klebsiella pneumoniae strain 16_GR_13 plasmid IncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

205. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP028316 (Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067217 plasmid pSC-31-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

206. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to CP009868 (Pantoea sp. PSNIH2 plasmid pPSP-100, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

207. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP012682 (Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

208. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP042646 (Escherichia coli strain NCYU-21-79 plasmid pNCYU-21-79-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

209. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP031549 (Escherichia coli strain cq9 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

210. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP032385 (Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

211. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to LC556210 (Enterobacter cloacae CC23 plasmid pCC23 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

212. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to LC556211 (Enterobacter cloacae CC32 plasmid pCC32 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

213. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to LC556212 (Klebsiella pneumoniae CC37 plasmid pCC37 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

214. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to LC556213 (Escherichia coli S44 plasmid pS44 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

215. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_018994 (Escherichia coli plasmid pNDM-1_Dok01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

216. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP022063 (Salmonella enterica strain FDAARGOS_312 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

217. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN175387 (Klebsiella pneumoniae strain KP-14-6 plasmid pKP-14-6-NDM-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

218. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP014978 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1896 isolate ST03-F34 plasmid pSTY1-1896, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

219. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_008613 (Photobacterium damselae subsp. piscicida plasmid pP91278, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

220. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019045 (Escherichia coli strain N10-2337 plasmid pNDM102337, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

221. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP042479 (Citrobacter freundii strain C50 plasmid pC50_001, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
attttgcggccaaccaggcgatcactgcatca	Protospacer
* .**** ******** **********.   *

222. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP031570 (Enterobacter hormaechei strain 2013_1a plasmid pIncAC2-1301491, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

223. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP031564 (Klebsiella pneumoniae strain 2-1 plasmid pKP21AC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

224. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP032397 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

225. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP027055 (Klebsiella pneumoniae strain 2_GR_12 plasmid IncAC2) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

226. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN254970 (Escherichia coli strain EC009 plasmid pEC009.1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

227. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to CP052444 (Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

228. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP014658 (Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1736 plasmid pSAN1-1736, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

229. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019158 (Klebsiella pneumoniae plasmid pNDM10469, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

230. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019153 (Klebsiella pneumoniae plasmid pNDM-KN, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

231. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP043190 (Escherichia coli O16:H48 strain PG20180175 plasmid pPG20180175.1-IncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

232. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP044142 (Escherichia coli O157 strain AR-0429 plasmid pAR-0429-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

233. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN310375 (Klebsiella quasipneumoniae strain QD1501 plasmid pQD1501-Ct1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

234. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN310377 (Klebsiella pneumoniae strain 12085 plasmid p12085-Ct1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

235. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP047421 (Shewanella algae strain 18064-CSB-B-B plasmid p18064-65-CSB-B-B, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

236. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP025231 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1924 plasmid pSNE1-1924, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

237. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP026552 (Citrobacter sp. SL156 plasmid unnamed3) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

238. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP039562 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014847 plasmid p08-5333.1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

239. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP018817 (Klebsiella pneumoniae strain AR_0049 plasmid unitig_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

240. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP038330 (Escherichia coli O157:H7 strain NE 1092-2 plasmid pNE1092-3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

241. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP038326 (Escherichia coli O157:H7 strain NE 1169-1 plasmid pNE1169-3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

242. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP030077 (Enterobacter hormaechei strain 20710 plasmid p3-20710, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

243. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP041083 (Klebsiella pneumoniae strain Kp202 plasmid pKp202_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

244. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP043215 (Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.1-IncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

245. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP031362 (Salmonella enterica subsp. enterica serovar Heidelberg strain 5 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

246. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KU160531 (Vibrio alginolyticus strain VAS3-1 plasmid pVAS3-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

247. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP038322 (Escherichia coli O157:H7 strain NE1127 plasmid pNE1127-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

248. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP028170 (Salmonella enterica strain CFSAN064034 plasmid pGMI17-002_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

249. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_016974 (Providencia stuartii plasmid pMR0211, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

250. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP008824 (UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKEC-39c, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

251. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP041103 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

252. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN310369 (Klebsiella pneumoniae strain Kpn47 plasmid pKpn47-Ct1/2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

253. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN310370 (Klebsiella pneumoniae strain 11935 plasmid p11935-Ct1/2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

254. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN310378 (Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

255. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021835 (Klebsiella pneumoniae strain AR_0120 plasmid tig00000516_pilon, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

256. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021956 (Klebsiella pneumoniae strain AR_0107 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

257. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP009560 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22425 plasmid pCVM22425, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

258. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP045459 (Salmonella enterica subsp. enterica serovar Anatum strain M-3471 plasmid pM-3471_DHA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

259. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_022372 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT3 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

260. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP041641 (Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-MCR1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

261. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP026207 (Escherichia coli strain ECONIH5 plasmid pECO-dc1b, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

262. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP009562 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22513 plasmid pCVM22513, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

263. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP031802 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

264. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP036192 (Klebsiella pneumoniae strain BA34918 plasmid pIncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

265. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP040024 (Klebsiella pneumoniae strain KPC160132 plasmid pIncC-L132, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

266. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP045517 (Salmonella enterica subsp. enterica serovar Anatum strain Sal-4737 plasmid pSal-4737_DHA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

267. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP045520 (Salmonella enterica subsp. enterica serovar Anatum strain Sal-5091 plasmid pSal-5091_DHA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

268. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP045462 (Salmonella enterica subsp. enterica serovar Anatum strain M-3851 plasmid pM-3851_DHA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

269. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP045467 (Salmonella enterica subsp. enterica serovar Anatum strain Sal-3973 plasmid pSal-3973_DHA_CMY, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

270. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP045510 (Salmonella enterica subsp. enterica serovar Anatum strain M-5360 plasmid pM-5360_DHA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

271. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_023291 (Vibrio cholerae strain BI144 plasmid pVCR94deltaX, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

272. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP007732 (Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKEC-dc3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

273. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP028996 (Klebsiella pneumoniae strain AR_0079 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

274. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP006029 (Escherichia coli O145:H28 str. RM13514 plasmid pRM13514, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

275. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP040039 (Klebsiella pneumoniae strain KPC160125 plasmid pIncC-L125) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

276. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP040034 (Klebsiella pneumoniae strain KPC160117 plasmid pIncC-L117, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

277. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP038464 (Aeromonas hydrophila strain WCX23 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

278. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP031610 (Escherichia coli strain N3 plasmid pIncAC2-1502318, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

279. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP031584 (Klebsiella pneumoniae strain N4b plasmid pIncAC2-1502320, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

280. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP027043 (Klebsiella pneumoniae strain 1_GR_13 plasmid IncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

281. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP007137 (Escherichia coli O145:H28 str. RM12581 plasmid pRM12581, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

282. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP029123 (Escherichia coli strain AR434 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

283. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP047350 (Proteus cibarius strain ZN2 plasmid pZN2-tetX-171kb, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

284. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_009140 (Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

285. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021719 (Escherichia coli strain AR_0128 plasmid tig00000792, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

286. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP024824 (Escherichia coli strain CREC-591 plasmid pCREC-591_3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

287. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP031573 (Enterobacter hormaechei strain N1 plasmid pIncAC2-1502262, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

288. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021536 (Escherichia coli strain AR_0119 plasmid unitig_2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

289. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP038466 (Aeromonas hydrophila strain 23-C-23 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

290. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_AP019688 (Klebsiella quasipneumoniae strain SNI47 plasmid pTMSNI47-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

291. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_009139 (Yersinia ruckeri YR71 plasmid pYR1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

292. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_021667 (Klebsiella pneumoniae plasmid IncA/C-LS6, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

293. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP003998 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13e, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

294. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP047345 (Proteus vulgaris strain ZN3 plasmid pZN3-tetX-171kb, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

295. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP047353 (Proteus mirabilis strain ZA25 plasmid pZA25-tetX-168kb, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

296. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP006661 (Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pNDM-US, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

297. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP026405 (Escherichia coli strain ECONIH4 plasmid pECO-c85f, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

298. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_017645 (Escherichia coli UMNK88 plasmid pUMNK88, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

299. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP009567 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 plasmid pCFSAN000934_02, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

300. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP029118 (Escherichia coli strain AR435 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

301. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP007636 (Vibrio cholerae strain 2012EL-2176 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

302. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_012690 (Escherichia coli plasmid peH4H, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

303. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP041052 (Enterobacter hormaechei strain C126 plasmid pEnC126NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccgtgcgatcactgcatca	Protospacer
.*.**** *******.***********.   *

304. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP032238 (Escherichia coli strain ECCWS199 plasmid pTB221, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

305. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP031576 (Enterobacter hormaechei strain A1 plasmid pIncAC2-1502264, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

306. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP024557 (Klebsiella pneumoniae strain INF164 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

307. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to CP050164 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

308. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to CP050162 (Escherichia coli plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

309. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP035908 (Klebsiella pneumoniae strain BA4656 plasmid pIncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

310. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP041172 (Salmonella enterica subsp. enterica serovar Thompson strain SH11G0791 plasmid pSH11G0791, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

311. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP024529 (Klebsiella pneumoniae strain INF157 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

312. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP011429 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU39 isolate YUHS 05-78 plasmid pYU39_IncA/C, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

313. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP018457 (Shewanella algae strain CCU101 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

314. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MK638972 (Escherichia coli J53 plasmid pMG252, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

315. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP016013 (Salmonella enterica subsp. enterica serovar Newport strain CFSAN003890 plasmid pCFSAN003890, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

316. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP032491 (Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

317. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP032496 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

318. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP024522 (Klebsiella pneumoniae strain INF158 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

319. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP011540 (Klebsiella aerogenes strain G7 plasmid pGPN1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

320. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP015139 (Escherichia coli strain Ecol_732 plasmid pEC732_IMP14, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

321. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019065 (Escherichia coli plasmid pPG010208, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

322. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019066 (Escherichia coli plasmid pAPEC1990_61, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

323. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019069 (Escherichia coli plasmid pNDM10505, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

324. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to CP028804 (Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

325. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP017084 (Proteus mirabilis strain T21 plasmid pT212, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

326. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP040029 (Klebsiella pneumoniae strain KPC160121 plasmid pIncC-L121, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

327. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KY014464 (Vibrio parahaemolyticus plasmid pVPS129, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

328. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KY014465 (Vibrio parahaemolyticus plasmid pVPS114, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

329. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KY014466 (Vibrio vulnificus plasmid pVVS1-per1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

330. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP031122 (Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid pIMP69_000369, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

331. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP019001 (Escherichia coli strain Ecol_AZ155 plasmid pECAZ155_KPC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

332. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP023724 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

333. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_016976 (Klebsiella pneumoniae plasmid pR55, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

334. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP044075 (Providencia stuartii strain FDAARGOS_645 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

335. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP026225 (Aeromonas sp. ASNIH3 plasmid pKPC-8e09, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

336. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP034397 (Escherichia coli strain CRE1 plasmid pCRE1.2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

337. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP025275 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1923 plasmid pSNE2-1923) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

338. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to LC536681 (Klebsiella pneumoniae MyNCGM076 plasmid pMyNCGM076, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

339. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to LC536682 (Klebsiella pneumoniae MyNCGM079 plasmid pMyNCGM079, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

340. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KM506769 (Uncultured bacterium plasmid pKAZ1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

341. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP045016 (Klebsiella pneumoniae subsp. pneumoniae strain BK13048 plasmid pBK13048-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

342. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021853 (Proteus mirabilis strain AR_0156 plasmid unitig_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

343. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP017055 (Providencia stuartii strain BE2467 plasmid pPS1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

344. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to CP028419 (Aeromonas hydrophila strain WCX23 plasmid pWCX23_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

345. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP044962 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014881 plasmid pPNCS014881.1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

346. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP024550 (Klebsiella pneumoniae strain INF163 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

347. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP018318 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

348. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN823987 (Escherichia coli strain 2016061604 plasmid p6061604-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

349. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KR827391 (Uncultured bacterium plasmid pKAZ2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

350. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KR827392 (Uncultured bacterium plasmid pKAZ3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

351. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KR827393 (Uncultured bacterium plasmid pKAZ4, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

352. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to KR827394 (Uncultured bacterium plasmid pKAZ5, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

353. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP007558 (Citrobacter freundii CFNIH1 plasmid pKEC-a3c, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

354. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021709 (Klebsiella pneumoniae strain AR_0143 plasmid tig00000001_p1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

355. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021551 (Proteus mirabilis strain AR_0159 plasmid tig00000137, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

356. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP025236 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1926 plasmid pSNE2-1926, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

357. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP053365 (Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

358. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_AP018672 (Klebsiella pneumoniae strain GSU10-3 plasmid pGSU10-3-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

359. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP009570 (Salmonella enterica subsp. enterica serovar Newport str. CVM N1543 isolate CFSAN000926 plasmid pCVMN1543, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

360. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP009564 (Salmonella enterica subsp. enterica serovar Newport str. CVM 21550 plasmid pCVM21550, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

361. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP009563 (Salmonella enterica subsp. enterica serovar Newport str. CVM 21538 plasmid pCVM21538, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

362. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP011622 (Klebsiella pneumoniae strain CAV1344 plasmid pKPC_CAV1344, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

363. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_AP019818 (Enterobacter hormaechei subsp. hoffmannii strain OIPH-N069 plasmid pN069_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

364. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP041209 (Salmonella enterica subsp. enterica serovar Newport strain SAP18-8729 plasmid pCFSAN074384_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

365. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP014295 (Klebsiella pneumoniae strain KP38731 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

366. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021936 (Escherichia coli strain AR_0055 plasmid unitig_2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

367. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP031106 (Escherichia coli strain AMSCJX02 plasmid pAMSC1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

368. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP012902 (Escherichia coli strain N15-01078 plasmid pNDM15-1078, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

369. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP023948 (Klebsiella pneumoniae strain FDAARGOS_446 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

370. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP018689 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

371. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019107 (Salmonella enterica subsp. enterica serovar Dublin plasmid pSD_174, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

372. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019116 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH163_135, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

373. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019118 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH696_135, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

374. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019121 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_166, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

375. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP020049 (Escherichia coli strain AR_0118 plasmid unitig_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

376. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP019053 (Escherichia coli strain CRE1540 plasmid p1540-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

377. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP029743 (Escherichia coli strain AR_0085 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

378. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP020056 (Escherichia coli strain AR_0069 plasmid unitig_2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

379. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP032192 (Salmonella enterica subsp. enterica serovar Senftenberg strain AR_0127 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

380. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP026233 (Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-0b27, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

381. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_012692 (Escherichia coli plasmid pAR060302, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

382. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_012693 (Salmonella enterica plasmid pAM04528, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

383. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_016839 (Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

384. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP015835 (Escherichia coli strain MS6198 plasmid pMS6198A, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

385. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP024564 (Klebsiella pneumoniae strain INF278 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

386. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP046773 (Vibrio alginolyticus strain 2014V-1011 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

387. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP014775 (Aeromonas veronii strain AVNIH1 plasmid pASP-a58, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

388. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP025245 (Salmonella enterica subsp. enterica serovar Newport str. CDC 2012K-0663 isolate USDA-ARS-USMARC-1936 plasmid pSNE2-2012K-0663, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

389. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019375 (Providencia stuartii plasmid pTC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

390. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019380 (Aeromonas hydrophila plasmid pR148, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

391. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_023908 (Klebsiella pneumoniae strain KP1 plasmid pKP1-NDM-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

392. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_022377 (Escherichia coli strain SCEC2 plasmid pSCEC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

393. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021695 (Proteus mirabilis strain AR_0155 plasmid tig00000123, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

394. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021952 (Klebsiella pneumoniae strain AR_0148 plasmid tig00000169_pilon, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

395. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP032395 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

396. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP050732 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST101 plasmid pST101-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

397. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_023898 (Klebsiella pneumoniae plasmid pRMH760, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

398. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP040884 (Escherichia coli strain K71-77 plasmid pK71-77-1-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

399. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP025144 (Klebsiella pneumoniae strain NR5632 plasmid NR5632_p1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

400. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP025147 (Klebsiella pneumoniae strain KP1766 plasmid KP1766_p1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

401. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to LC225353 (Photobacterium damselae subsp. piscicida plasmid pP0855 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

402. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_AP018143 (Escherichia coli strain M214 isolate M214 plasmid pM214_AC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

403. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_AP018145 (Escherichia coli strain M216 isolate M216 plasmid pM216_AC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

404. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP029718 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

405. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LN831185 (Vibrio cholerae isolate V. cholerae 116-17a plasmid pNDM-116-17, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

406. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP031297 (Escherichia coli strain EC17GD31 plasmid pGD31-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

407. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP050727 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST113 plasmid pST-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

408. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP050740 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

409. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP048797 (Providencia vermicola strain P8538 plasmid p8538-NDM-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

410. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP015394 (Klebsiella pneumoniae strain CR14 plasmid pCR14_2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

411. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP018698 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

412. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP018220 (Salmonella enterica subsp. enterica strain LSP 389/97 plasmid pUO-STmRV1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

413. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP027695 (Klebsiella pneumoniae strain KP30835 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

414. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP045953 (Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00008979 plasmid pAUSMDU00008979_01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

415. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN550958 (Proteus mirabilis strain PRT-ndm plasmid pPM154, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

416. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN603981 (Klebsiella aerogenes strain 1564 plasmid p1564, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

417. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT882698 (Klebsiella pneumoniae strain Klebsiella pneumoniae KLPN57 isolate KLPN57 plasmid I, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

418. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT882699 (Enterobacter cloacae isolate Enterobacter cloacae ENCL58 plasmid I, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

419. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT985220 (Escherichia coli strain 83 plasmid RCS1TR83_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

420. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT985234 (Escherichia coli strain 557 plasmid RCS32TR557_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

421. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT985225 (Escherichia coli strain 89 plasmid RCS2TR89_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

422. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT985258 (Escherichia coli strain 726 plasmid RCS54TR726_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

423. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT985222 (Escherichia coli strain 548 plasmid RCS24TR548_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

424. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT985228 (Escherichia coli strain 552 plasmid RCS28TR552_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

425. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT985218 (Escherichia coli strain 541 plasmid RCS18TR541_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

426. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT985260 (Escherichia coli strain 724 plasmid RCS53TR724_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

427. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT985253 (Escherichia coli strain 660 plasmid RCS48TR660_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

428. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT985250 (Escherichia coli strain 170 plasmid RCS38_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

429. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT985224 (Escherichia coli strain 513 plasmid RCS30_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

430. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT985243 (Escherichia coli strain 722 plasmid RCS41_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

431. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_LT985244 (Escherichia coli strain 167 plasmid RCS39_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

432. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP018956 (Escherichia coli strain Ecol_316 plasmid pEC316_KPC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

433. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN604267 (Salmonella enterica subsp. enterica serovar London strain SAL-19-0623 plasmid pSAL-19-0623_NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

434. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN604268 (Escherichia coli strain J53 plasmid pJ53_SAL-19-0623_NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

435. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP018710 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

436. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MK733575 (Escherichia coli strain J53 plasmid pMG252A, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

437. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MK388209 (Escherichia coli strain Ec20-Lar plasmid pC-Ec20-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

438. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MK439959 (Escherichia coli strain Ec-2Lar plasmid pC-Ec2-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

439. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MN101850 (Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

440. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MN101853 (Escherichia coli strain 13ZX36 plasmid p13ZX36-200, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

441. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MK770642 (Klebsiella pneumoniae strain T38 plasmid pT38_MCR3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

442. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MK123268 (Serratia marcescens strain M17468 plasmid pSMA17468, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

443. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MN148427 (Proteus vulgaris strain PV835 plasmid pPV835TEM24, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

444. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_022522 (Salmonella enterica subsp. enterica serovar Kentucky strain 1643/10 plasmid p1643_10, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

445. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN657249 (Enterobacteriaceae bacterium strain 1086-16 plasmid pKP39-T3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

446. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN657250 (Enterobacteriaceae bacterium strain 1083-16 plasmid pKP39-T4, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

447. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN657252 (Enterobacteriaceae bacterium strain 21-16 plasmid pPS-T1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

448. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP032380 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69807 plasmid pSDU1-USMARC-69807, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

449. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP032448 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69840 plasmid pSDU2-USMARC-69840, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

450. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH995508 (Enterobacter cloacae strain ECL17464 plasmid pECL17464, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

451. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH995506 (Citrobacter freundii strain CFR17394 plasmid pCFR17394, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

452. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH105050 (Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncA/C-IncX3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

453. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH917285 (Klebsiella pneumoniae strain 427113 plasmid p427113-Ct1/2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

454. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH909327 (Klebsiella pneumoniae strain 526316 plasmid p526316-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

455. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH263652 (Providencia rettgeri strain QD51 plasmid pNDM-QD51, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

456. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH917284 (Klebsiella pneumoniae strain 397108 plasmid p397108-Ct2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

457. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH760469 (Salmonella enterica strain 2016K-0796 plasmid p2016K-0796, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

458. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MK205418 (Salmonella enterica subsp. enterica serovar Dublin strain 14-1360 plasmid p14-1360-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

459. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MK205416 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01070 plasmid pN13-01070-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

460. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MK205417 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01141 plasmid pN13-01141, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

461. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH061195 (Klebsiella pneumoniae strain AHM7C8I plasmid pHNAH8I-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

462. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MK033499 (Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

463. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH011352 (Klebsiella pneumoniae strain 185 plasmid pNDM-185, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

464. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH476540 (Klebsiella pneumoniae strain KP1276 plasmid pIA/C-KLUC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

465. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MK101346 (Citrobacter freundii strain CRE3 plasmid pCRE7-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

466. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN657241 (Enterobacteriaceae bacterium strain 20-16 plasmid pCF104a-T3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

467. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN657242 (Enterobacteriaceae bacterium strain 128-16 plasmid pEC405a-T3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

468. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN657243 (Enterobacteriaceae bacterium strain 24-16 plasmid pEC744-T5, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

469. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN657244 (Enterobacteriaceae bacterium strain 690-16 plasmid pEC6332-T3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

470. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MN657247 (Enterobacteriaceae bacterium strain 460-16 plasmid pECl-T3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

471. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP009410 (Salmonella enterica strain CFSAN007405 isolate 30034 plasmid pCFSAN007405_01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

472. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MG764534 (Klebsiella aerogenes strain EA409 plasmid pEA409TEM24, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

473. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MF627444 (Vibrio parahaemolyticus strain Vb0267 plasmid pVb0267, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

474. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH001166 (Escherichia coli strain TAEC1 plasmid pNDM-TAEC1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

475. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MF150121 (Klebsiella pneumoniae strain A64477 plasmid pKP64477c, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

476. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MF150123 (Klebsiella pneumoniae strain A64216 plasmid pKP64216b, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

477. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MF344573 (Klebsiella pneumoniae strain N201205880 plasmid p205880-Ct1/2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

478. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MF344572 (Enterobacter hormaechei strain 24845 plasmid p24845-Ct2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

479. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MF344574 (Enterobacter hormaechei strain T5282 plasmid pT5282-Ct2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

480. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MG450360 (Escherichia coli strain AMA566 plasmid pAMA566, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

481. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MG252895 (Escherichia coli strain Esco-36073cz plasmid pEsco-36073cz, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

482. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH113855 (Vibrio alginolyticus strain Vb1796 plasmid pVb1796, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

483. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH457126 (Vibrio alginolyticus strain Vb1394 plasmid pC1394, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

484. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH475146 (Citrobacter freundii strain 164 plasmid pCf164_LMB-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

485. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH763829 (Citrobacter freundii strain JY-17 plasmid pCFJY-17, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

486. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH892479 (Citrobacter freundii strain 2262 plasmid pNDM-2262, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

487. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MH844629 (Escherichia coli strain 2248 plasmid pNDM-2248, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

488. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP030132 (Klebsiella pneumoniae strain 160111 plasmid pIncAC2_L111, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

489. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MT219816 (Escherichia coli strain RF173-1 plasmid pRF173-1_87k_tetX, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

490. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KY887591 (Escherichia coli strain Ec19 plasmid pEc19, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

491. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KY887590 (Escherichia coli strain Ec9 plasmid pEc9, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

492. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_KY887595 (Escherichia coli strain Ec78 plasmid pEc78, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

493. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MF582638 (Klebsiella pneumoniae strain KKp4 plasmid pKKp4-VIM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

494. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MF072965 (Citrobacter freundii strain P10159 plasmid pP10159-5, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

495. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MG764552 (Klebsiella pneumoniae strain A1763 plasmid pA1763-Ct2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

496. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MF150118 (Proteus mirabilis strain A64421 plasmid pPM64421a, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

497. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MF627445 (Vibrio parahaemolyticus strain Vb0499 plasmid pVb0499, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

498. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_MF497432 (Vibrio alginolyticus strain Vb0506 plasmid pVb0506, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

499. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP040068 (Escherichia coli strain A1_181 plasmid p_unnamed1_KPC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

500. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP044189 (Salmonella enterica subsp. enterica strain AR-0401 plasmid pAR-0401-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

501. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP028814 (Edwardsiella ictaluri strain MS-17-156 plasmid pEI-MS-17-156-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

502. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP020913 (Salmonella enterica subsp. enterica serovar Montevideo str. CDC 2010K-0257 plasmid pSMO-2010K-0257, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

503. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP029737 (Providencia rettgeri strain AR_0082 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

504. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP048384 (Citrobacter freundii strain 62 plasmid p6_B, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

505. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP032168 (Klebsiella pneumoniae strain AR_0076 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

506. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP053192 (Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37b, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

507. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to MT151380 (Vibrio cholerae strain YA00120881 plasmid pYA00120881, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

508. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP054305 (Klebsiella pneumoniae strain MS14393 plasmid pMS14393B, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

509. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

510. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

511. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

512. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

513. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

514. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

515. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

516. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

517. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

518. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

519. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

520. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

521. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

522. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

523. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

524. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

525. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

526. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

527. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

528. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

529. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

530. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

531. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

532. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

533. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

534. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

535. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

536. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

537. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

538. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

539. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

540. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

541. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

542. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

543. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

544. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

545. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

546. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

547. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

548. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

549. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

550. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

551. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

552. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
ggttccccttcccgaaccgatcgttaccaacg	Protospacer
.*** . ** ***********.********

553. spacer 2.28|3154329|32|NZ_CP053582|PILER-CR matches to AF242738 (Bacteriophage phi LC3, complete genome) position: , mismatch: 8, identity: 0.75

tgtagcaccagcaataacagtcggtagatggg	CRISPR spacer
taaagcaccagcaataacagttgctaaaggct	Protospacer
*. ******************.* **.* *

554. spacer 2.28|3154329|32|NZ_CP053582|PILER-CR matches to NC_005822 (Lactococcus phage phiLC3, complete genome) position: , mismatch: 8, identity: 0.75

tgtagcaccagcaataacagtcggtagatggg	CRISPR spacer
taaagcaccagcaataacagttgctaaaggct	Protospacer
*. ******************.* **.* *

555. spacer 2.28|3154329|32|NZ_CP053582|PILER-CR matches to KX160220 (Lactococcus phage Dub35A, complete genome) position: , mismatch: 8, identity: 0.75

tgtagcaccagcaataacagtcggtagatggg	CRISPR spacer
taaagcaccagcaataacagttgctaaaggtt	Protospacer
*. ******************.* **.* *

556. spacer 2.30|3154451|32|NZ_CP053582|PILER-CR matches to NC_018686 (Bacillus thuringiensis MC28 plasmid pMC183, complete sequence) position: , mismatch: 8, identity: 0.75

ccagtgtatgaatcagaaaatgaagtataaaa	CRISPR spacer
aaagtgtatgaatcagaacttgaagaacgtaa	Protospacer
  ****************  ***** *.. **

557. spacer 2.36|3154817|32|NZ_CP053582|PILER-CR matches to NZ_CP047432 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-4, complete sequence) position: , mismatch: 8, identity: 0.75

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
atagaaaaaataatccacatcaatttcagaat	Protospacer
 * ************* **** ****** .

558. spacer 2.36|3154817|32|NZ_CP053582|PILER-CR matches to NZ_CP046370 (Spiroplasma citri strain BR12 plasmid pScpBR12-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
atagaaaaaataatccacatcaatttcagaat	Protospacer
 * ************* **** ****** .

559. spacer 2.36|3154817|32|NZ_CP053582|PILER-CR matches to NZ_CP047441 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-4, complete sequence) position: , mismatch: 8, identity: 0.75

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
atagaaaaaataatccacatcaatttcagaat	Protospacer
 * ************* **** ****** .

560. spacer 2.36|3154817|32|NZ_CP053582|PILER-CR matches to NZ_CP053311 (Spiroplasma citri strain C5 plasmid pScpC5-7, complete sequence) position: , mismatch: 8, identity: 0.75

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
atagaaaaaataatccacatcaatttcagaat	Protospacer
 * ************* **** ****** .

561. spacer 2.39|3155000|32|NZ_CP053582|PILER-CR matches to MN693026 (Marine virus AFVG_117M72, complete genome) position: , mismatch: 8, identity: 0.75

ttattaaataaccaaaatatggttatattcga	CRISPR spacer
gtattatataaccaaaatatggttttaaagct	Protospacer
 ***** ***************** **

562. spacer 2.39|3155000|32|NZ_CP053582|PILER-CR matches to NZ_CP028244 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttattaaataaccaaaatatggttatattcga	CRISPR spacer
gtaagaattcaccaaaatatggttatataaca	Protospacer
 **  ** * ******************   *

563. spacer 2.39|3155000|32|NZ_CP053582|PILER-CR matches to NZ_CP054261 (Lactobacillus plantarum strain TCI507 plasmid unnamed2) position: , mismatch: 8, identity: 0.75

ttattaaataaccaaaatatggttatattcga	CRISPR spacer
gtaagaattcaccaaaatatggttatataaca	Protospacer
 **  ** * ******************   *

564. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to CP007642 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttcccgccgccaaccatgcgatcaaggtcgcc	Protospacer
  *..*******************  ****

565. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_014312 (Klebsiella pneumoniae plasmid pKP048, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

566. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KX147633 (Citrobacter freundii strain AMA332 plasmid pT1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

567. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KX709966 (Pseudomonas aeruginosa strain IP40a plasmid pIP40a, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

568. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KX786648 (Enterobacter cloacae strain B557 plasmid pB557-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

569. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KX869741 (Enterobacter cloacae strain 20130723 plasmid R222, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

570. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KY399978 (Vibrio cholerae O139 strain ICDC-211 plasmid pVC211, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

571. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KY986974 (Citrobacter freundii strain 112298 plasmid p112298-tetA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

572. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KY887592 (Citrobacter freundii strain Cf52 plasmid pCf52, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

573. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KY887593 (Citrobacter freundii strain Cf53 plasmid pCf53, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

574. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KY887594 (Klebsiella pneumoniae strain Kp55 plasmid pKp55, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

575. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_AP023051 (Citrobacter portucalensis strain IOMTU157 plasmid pIOMTU157, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

576. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_022652 (Klebsiella pneumoniae strain CRE114 plasmid pIMP-PH114, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

577. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP033514 (Vibrio cholerae strain E4 plasmid pVCR94, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

578. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP009414 (Salmonella enterica strain CFSAN007428 isolate N11150 plasmid pCFSAN007428_01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

579. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KU726616 (Salmonella enterica subsp. enterica serovar Stanley strain LS001 plasmid pHS36-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

580. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KX458222 (Klebsiella pneumoniae strain B2 plasmid pB2-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

581. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KX636095 (Klebsiella pneumoniae strain RJ119 plasmid pRJ119-NDM1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

582. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KX815983 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

583. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KT997783 (Escherichia coli strain Y5 plasmid pECY53, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

584. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KX156772 (Escherichia coli strain K-12 plasmid IP40a, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

585. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KU302802 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

586. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KT935446 (Klebsiella pneumoniae strain Kp2964 plasmid 2964TF, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

587. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KX156773 (Escherichia coli strain K-12 plasmid R16a, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

588. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KX029331 (Klebsiella pneumoniae strain K-109-R plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

589. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KU302801 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

590. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP035548 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

591. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP009412 (Salmonella enterica strain CFSAN007426 isolate N19767 plasmid pCFSAN007426_01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

592. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP009411 (Salmonella enterica strain CFSAN007425 isolate 22697 plasmid pCFSAN007425_01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

593. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP009413 (Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

594. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KJ588779 (Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pNDM-US-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

595. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KJ909290 (Aeromonas salmonicida subsp. salmonicida strain 2004-05MF26 plasmid pSN254b, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

596. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KM083064 (Vibrio cholerae strain ICDC-1447 plasmid pVC1447, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

597. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KR559888 (Klebsiella pneumoniae strain Kpn642 plasmid pKP-Gr642, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

598. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KR559889 (Klebsiella pneumoniae strain Kpn8143 plasmid pKP-Gr8143, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

599. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KJ802405 (Providencia stuartii isolate GN576 plasmid pNDM-PstGN576, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

600. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KP742988 (Salmonella enterica subsp. enterica serovar Senftenberg strain BCH02406 plasmid pNDM-SAL, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

601. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KM670336 (Salmonella enterica subsp. enterica serovar Senftenberg strain SRC119 plasmid pSRC119-A/C, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

602. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KR091911 (Salmonella enterica subsp. enterica serovar Corvallis strain RH-1238 plasmid pRH-1238, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

603. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KP975074 (Citrobacter freundii strain MRSN11938 plasmid pMRVIM0912, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

604. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KR559890 (Enterobacter cloacae strain Ecl4873 plasmid pEcl-Gr4873, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

605. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KJ802404 (Escherichia coli isolate GN568 plasmid pNDM-EcoGN568, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

606. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KP056256 (Escherichia coli strain YDC637 plasmid pYDC637, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

607. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KP345882 (Escherichia coli strain BK32533 plasmid pBK32533, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

608. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to AP014611 (Serratia marcescens plasmid p11663 DNA, complete sequence, strain: 11663) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

609. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP028197 (Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

610. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP041027 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

611. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP025141 (Klebsiella pneumoniae strain KP1768 plasmid KP1768_p1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

612. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP032391 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

613. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP017987 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

614. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP022126 (Klebsiella pneumoniae strain DHQP1605752_NV plasmid p1605752AC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

615. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP017387 (Klebsiella pneumoniae strain KP36 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

616. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP047308 (Citrobacter freundii strain L75 plasmid pCf75, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

617. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP045742 (Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

618. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP013324 (Klebsiella pneumoniae strain CAV1193 plasmid pCAV1193-166, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

619. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP034402 (Escherichia coli strain CRE10 plasmid pCRE10.2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

620. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP010373 (Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

621. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP048305 (Escherichia coli strain 9 plasmid p009_A, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

622. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP025240 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE3-1928, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

623. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP025242 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1929 plasmid pSNE1-1929, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

624. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to LC055503 (Klebsiella pneumoniae plasmid pHM881QN DNA, complete sequence, strain: Y881) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

625. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP024192 (Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

626. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN477204 (Escherichia coli strain S15FP06257 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

627. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP027679 (Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

628. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP017058 (Citrobacter freundii strain SL151 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

629. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP020513 (Escherichia coli strain 165 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

630. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP029730 (Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

631. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LS992184 (Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

632. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KC999035 (Escherichia coli strain EC2 plasmid pEC2-NDM-3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

633. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP018716 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

634. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP018722 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

635. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP018704 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

636. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP029249 (Salmonella enterica subsp. enterica serovar Thompson strain HFCDC-SM-846 plasmid p846, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

637. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_008612 (Photobacterium damselae subsp. piscicida plasmid pP99-018, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

638. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP025470 (Klebsiella pneumoniae strain JS187 plasmid p187-4, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

639. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP020524 (Escherichia coli strain 190 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

640. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_AP022377 (Providencia stuartii strain BML2537 plasmid pBML2537, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

641. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP022359 (Shewanella bicestrii strain JAB-1 plasmid pSHE-CTX-M, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

642. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT904892 (Salmonella enterica subsp. enterica serovar Typhi strain 80-2002 plasmid 2) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

643. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP029802 (Salmonella enterica subsp. enterica serovar Anatum strain R16.0676 plasmid pR16.0676_90k, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

644. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP008790 (Klebsiella oxytoca KONIH1 plasmid pKOX-86d, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

645. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP027038 (Klebsiella pneumoniae strain 16_GR_13 plasmid IncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

646. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP028316 (Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067217 plasmid pSC-31-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

647. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to CP009868 (Pantoea sp. PSNIH2 plasmid pPSP-100, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

648. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP012682 (Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

649. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP042646 (Escherichia coli strain NCYU-21-79 plasmid pNCYU-21-79-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

650. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP031549 (Escherichia coli strain cq9 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

651. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP032385 (Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

652. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to LC556210 (Enterobacter cloacae CC23 plasmid pCC23 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

653. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to LC556211 (Enterobacter cloacae CC32 plasmid pCC32 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

654. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to LC556212 (Klebsiella pneumoniae CC37 plasmid pCC37 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

655. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to LC556213 (Escherichia coli S44 plasmid pS44 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

656. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_018994 (Escherichia coli plasmid pNDM-1_Dok01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

657. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP022063 (Salmonella enterica strain FDAARGOS_312 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

658. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN175387 (Klebsiella pneumoniae strain KP-14-6 plasmid pKP-14-6-NDM-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

659. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP014978 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1896 isolate ST03-F34 plasmid pSTY1-1896, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

660. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_008613 (Photobacterium damselae subsp. piscicida plasmid pP91278, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

661. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_019045 (Escherichia coli strain N10-2337 plasmid pNDM102337, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

662. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP042479 (Citrobacter freundii strain C50 plasmid pC50_001, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
attttgcggccaaccaggcgatcactgcatca	Protospacer
* .**** ******** **********.   *

663. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP031570 (Enterobacter hormaechei strain 2013_1a plasmid pIncAC2-1301491, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

664. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP031564 (Klebsiella pneumoniae strain 2-1 plasmid pKP21AC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

665. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP032397 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

666. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP027055 (Klebsiella pneumoniae strain 2_GR_12 plasmid IncAC2) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

667. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN254970 (Escherichia coli strain EC009 plasmid pEC009.1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

668. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to CP052444 (Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

669. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP014658 (Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1736 plasmid pSAN1-1736, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

670. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_019158 (Klebsiella pneumoniae plasmid pNDM10469, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

671. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_019153 (Klebsiella pneumoniae plasmid pNDM-KN, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

672. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP043190 (Escherichia coli O16:H48 strain PG20180175 plasmid pPG20180175.1-IncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

673. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP044142 (Escherichia coli O157 strain AR-0429 plasmid pAR-0429-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

674. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN310375 (Klebsiella quasipneumoniae strain QD1501 plasmid pQD1501-Ct1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

675. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN310377 (Klebsiella pneumoniae strain 12085 plasmid p12085-Ct1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

676. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP047421 (Shewanella algae strain 18064-CSB-B-B plasmid p18064-65-CSB-B-B, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

677. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP025231 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1924 plasmid pSNE1-1924, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

678. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP026552 (Citrobacter sp. SL156 plasmid unnamed3) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

679. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP039562 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014847 plasmid p08-5333.1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

680. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP018817 (Klebsiella pneumoniae strain AR_0049 plasmid unitig_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

681. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP038330 (Escherichia coli O157:H7 strain NE 1092-2 plasmid pNE1092-3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

682. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP038326 (Escherichia coli O157:H7 strain NE 1169-1 plasmid pNE1169-3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

683. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP030077 (Enterobacter hormaechei strain 20710 plasmid p3-20710, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

684. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP041083 (Klebsiella pneumoniae strain Kp202 plasmid pKp202_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

685. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP043215 (Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.1-IncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

686. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP031362 (Salmonella enterica subsp. enterica serovar Heidelberg strain 5 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

687. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to KU160531 (Vibrio alginolyticus strain VAS3-1 plasmid pVAS3-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

688. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP038322 (Escherichia coli O157:H7 strain NE1127 plasmid pNE1127-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

689. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP028170 (Salmonella enterica strain CFSAN064034 plasmid pGMI17-002_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

690. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_016974 (Providencia stuartii plasmid pMR0211, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

691. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP008824 (UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKEC-39c, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

692. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP041103 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

693. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN310369 (Klebsiella pneumoniae strain Kpn47 plasmid pKpn47-Ct1/2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

694. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN310370 (Klebsiella pneumoniae strain 11935 plasmid p11935-Ct1/2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

695. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN310378 (Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

696. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021835 (Klebsiella pneumoniae strain AR_0120 plasmid tig00000516_pilon, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

697. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021956 (Klebsiella pneumoniae strain AR_0107 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

698. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP009560 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22425 plasmid pCVM22425, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

699. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP045459 (Salmonella enterica subsp. enterica serovar Anatum strain M-3471 plasmid pM-3471_DHA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

700. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_022372 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT3 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

701. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP041641 (Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-MCR1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

702. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP026207 (Escherichia coli strain ECONIH5 plasmid pECO-dc1b, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

703. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP009562 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22513 plasmid pCVM22513, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

704. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP031802 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

705. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP036192 (Klebsiella pneumoniae strain BA34918 plasmid pIncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

706. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP040024 (Klebsiella pneumoniae strain KPC160132 plasmid pIncC-L132, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

707. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP045517 (Salmonella enterica subsp. enterica serovar Anatum strain Sal-4737 plasmid pSal-4737_DHA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

708. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP045520 (Salmonella enterica subsp. enterica serovar Anatum strain Sal-5091 plasmid pSal-5091_DHA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

709. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP045462 (Salmonella enterica subsp. enterica serovar Anatum strain M-3851 plasmid pM-3851_DHA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

710. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP045467 (Salmonella enterica subsp. enterica serovar Anatum strain Sal-3973 plasmid pSal-3973_DHA_CMY, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

711. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP045510 (Salmonella enterica subsp. enterica serovar Anatum strain M-5360 plasmid pM-5360_DHA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

712. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_023291 (Vibrio cholerae strain BI144 plasmid pVCR94deltaX, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

713. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP007732 (Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKEC-dc3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

714. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP028996 (Klebsiella pneumoniae strain AR_0079 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

715. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP006029 (Escherichia coli O145:H28 str. RM13514 plasmid pRM13514, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

716. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP040039 (Klebsiella pneumoniae strain KPC160125 plasmid pIncC-L125) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

717. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP040034 (Klebsiella pneumoniae strain KPC160117 plasmid pIncC-L117, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

718. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP038464 (Aeromonas hydrophila strain WCX23 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

719. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP031610 (Escherichia coli strain N3 plasmid pIncAC2-1502318, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

720. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP031584 (Klebsiella pneumoniae strain N4b plasmid pIncAC2-1502320, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

721. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP027043 (Klebsiella pneumoniae strain 1_GR_13 plasmid IncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

722. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP007137 (Escherichia coli O145:H28 str. RM12581 plasmid pRM12581, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

723. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP029123 (Escherichia coli strain AR434 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

724. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP047350 (Proteus cibarius strain ZN2 plasmid pZN2-tetX-171kb, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

725. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_009140 (Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

726. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021719 (Escherichia coli strain AR_0128 plasmid tig00000792, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

727. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP024824 (Escherichia coli strain CREC-591 plasmid pCREC-591_3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

728. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP031573 (Enterobacter hormaechei strain N1 plasmid pIncAC2-1502262, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

729. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021536 (Escherichia coli strain AR_0119 plasmid unitig_2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

730. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP038466 (Aeromonas hydrophila strain 23-C-23 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

731. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_AP019688 (Klebsiella quasipneumoniae strain SNI47 plasmid pTMSNI47-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

732. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_009139 (Yersinia ruckeri YR71 plasmid pYR1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

733. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_021667 (Klebsiella pneumoniae plasmid IncA/C-LS6, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

734. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP003998 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13e, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

735. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP047345 (Proteus vulgaris strain ZN3 plasmid pZN3-tetX-171kb, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

736. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP047353 (Proteus mirabilis strain ZA25 plasmid pZA25-tetX-168kb, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

737. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP006661 (Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pNDM-US, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

738. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP026405 (Escherichia coli strain ECONIH4 plasmid pECO-c85f, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

739. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_017645 (Escherichia coli UMNK88 plasmid pUMNK88, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

740. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP009567 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 plasmid pCFSAN000934_02, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

741. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP029118 (Escherichia coli strain AR435 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

742. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP007636 (Vibrio cholerae strain 2012EL-2176 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

743. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_012690 (Escherichia coli plasmid peH4H, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

744. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP041052 (Enterobacter hormaechei strain C126 plasmid pEnC126NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccgtgcgatcactgcatca	Protospacer
.*.**** *******.***********.   *

745. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP032238 (Escherichia coli strain ECCWS199 plasmid pTB221, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

746. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP031576 (Enterobacter hormaechei strain A1 plasmid pIncAC2-1502264, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

747. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP024557 (Klebsiella pneumoniae strain INF164 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

748. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to CP050164 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

749. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to CP050162 (Escherichia coli plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

750. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP035908 (Klebsiella pneumoniae strain BA4656 plasmid pIncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

751. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP041172 (Salmonella enterica subsp. enterica serovar Thompson strain SH11G0791 plasmid pSH11G0791, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

752. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP024529 (Klebsiella pneumoniae strain INF157 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

753. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP011429 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU39 isolate YUHS 05-78 plasmid pYU39_IncA/C, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

754. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP018457 (Shewanella algae strain CCU101 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

755. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MK638972 (Escherichia coli J53 plasmid pMG252, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

756. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP016013 (Salmonella enterica subsp. enterica serovar Newport strain CFSAN003890 plasmid pCFSAN003890, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

757. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP032491 (Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

758. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP032496 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

759. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP024522 (Klebsiella pneumoniae strain INF158 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

760. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP011540 (Klebsiella aerogenes strain G7 plasmid pGPN1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

761. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP015139 (Escherichia coli strain Ecol_732 plasmid pEC732_IMP14, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

762. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_019065 (Escherichia coli plasmid pPG010208, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

763. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_019066 (Escherichia coli plasmid pAPEC1990_61, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

764. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_019069 (Escherichia coli plasmid pNDM10505, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

765. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to CP028804 (Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

766. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP017084 (Proteus mirabilis strain T21 plasmid pT212, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

767. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP040029 (Klebsiella pneumoniae strain KPC160121 plasmid pIncC-L121, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

768. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to KY014464 (Vibrio parahaemolyticus plasmid pVPS129, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

769. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to KY014465 (Vibrio parahaemolyticus plasmid pVPS114, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

770. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to KY014466 (Vibrio vulnificus plasmid pVVS1-per1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

771. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP031122 (Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid pIMP69_000369, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

772. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP019001 (Escherichia coli strain Ecol_AZ155 plasmid pECAZ155_KPC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

773. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP023724 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

774. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_016976 (Klebsiella pneumoniae plasmid pR55, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

775. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP044075 (Providencia stuartii strain FDAARGOS_645 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

776. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP026225 (Aeromonas sp. ASNIH3 plasmid pKPC-8e09, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

777. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP034397 (Escherichia coli strain CRE1 plasmid pCRE1.2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

778. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP025275 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1923 plasmid pSNE2-1923) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

779. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to LC536681 (Klebsiella pneumoniae MyNCGM076 plasmid pMyNCGM076, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

780. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to LC536682 (Klebsiella pneumoniae MyNCGM079 plasmid pMyNCGM079, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

781. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to KM506769 (Uncultured bacterium plasmid pKAZ1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

782. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP045016 (Klebsiella pneumoniae subsp. pneumoniae strain BK13048 plasmid pBK13048-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

783. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021853 (Proteus mirabilis strain AR_0156 plasmid unitig_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

784. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP017055 (Providencia stuartii strain BE2467 plasmid pPS1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

785. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to CP028419 (Aeromonas hydrophila strain WCX23 plasmid pWCX23_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

786. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP044962 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014881 plasmid pPNCS014881.1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

787. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP024550 (Klebsiella pneumoniae strain INF163 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

788. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP018318 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

789. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN823987 (Escherichia coli strain 2016061604 plasmid p6061604-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

790. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to KR827391 (Uncultured bacterium plasmid pKAZ2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

791. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to KR827392 (Uncultured bacterium plasmid pKAZ3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

792. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to KR827393 (Uncultured bacterium plasmid pKAZ4, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

793. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to KR827394 (Uncultured bacterium plasmid pKAZ5, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

794. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP007558 (Citrobacter freundii CFNIH1 plasmid pKEC-a3c, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

795. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021709 (Klebsiella pneumoniae strain AR_0143 plasmid tig00000001_p1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

796. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021551 (Proteus mirabilis strain AR_0159 plasmid tig00000137, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

797. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP025236 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1926 plasmid pSNE2-1926, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

798. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP053365 (Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

799. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_AP018672 (Klebsiella pneumoniae strain GSU10-3 plasmid pGSU10-3-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

800. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP009570 (Salmonella enterica subsp. enterica serovar Newport str. CVM N1543 isolate CFSAN000926 plasmid pCVMN1543, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

801. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP009564 (Salmonella enterica subsp. enterica serovar Newport str. CVM 21550 plasmid pCVM21550, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

802. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP009563 (Salmonella enterica subsp. enterica serovar Newport str. CVM 21538 plasmid pCVM21538, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

803. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP011622 (Klebsiella pneumoniae strain CAV1344 plasmid pKPC_CAV1344, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

804. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_AP019818 (Enterobacter hormaechei subsp. hoffmannii strain OIPH-N069 plasmid pN069_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

805. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP041209 (Salmonella enterica subsp. enterica serovar Newport strain SAP18-8729 plasmid pCFSAN074384_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

806. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP014295 (Klebsiella pneumoniae strain KP38731 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

807. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021936 (Escherichia coli strain AR_0055 plasmid unitig_2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

808. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP031106 (Escherichia coli strain AMSCJX02 plasmid pAMSC1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

809. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP012902 (Escherichia coli strain N15-01078 plasmid pNDM15-1078, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

810. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP023948 (Klebsiella pneumoniae strain FDAARGOS_446 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

811. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP018689 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

812. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_019107 (Salmonella enterica subsp. enterica serovar Dublin plasmid pSD_174, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

813. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_019116 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH163_135, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

814. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_019118 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH696_135, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

815. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_019121 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_166, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

816. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP020049 (Escherichia coli strain AR_0118 plasmid unitig_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

817. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP019053 (Escherichia coli strain CRE1540 plasmid p1540-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

818. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP029743 (Escherichia coli strain AR_0085 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

819. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP020056 (Escherichia coli strain AR_0069 plasmid unitig_2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

820. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP032192 (Salmonella enterica subsp. enterica serovar Senftenberg strain AR_0127 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

821. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP026233 (Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-0b27, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

822. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_012692 (Escherichia coli plasmid pAR060302, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

823. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_012693 (Salmonella enterica plasmid pAM04528, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

824. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_016839 (Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

825. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP015835 (Escherichia coli strain MS6198 plasmid pMS6198A, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

826. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP024564 (Klebsiella pneumoniae strain INF278 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

827. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP046773 (Vibrio alginolyticus strain 2014V-1011 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

828. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP014775 (Aeromonas veronii strain AVNIH1 plasmid pASP-a58, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

829. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP025245 (Salmonella enterica subsp. enterica serovar Newport str. CDC 2012K-0663 isolate USDA-ARS-USMARC-1936 plasmid pSNE2-2012K-0663, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

830. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_019375 (Providencia stuartii plasmid pTC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

831. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_019380 (Aeromonas hydrophila plasmid pR148, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

832. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_023908 (Klebsiella pneumoniae strain KP1 plasmid pKP1-NDM-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

833. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_022377 (Escherichia coli strain SCEC2 plasmid pSCEC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

834. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021695 (Proteus mirabilis strain AR_0155 plasmid tig00000123, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

835. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021952 (Klebsiella pneumoniae strain AR_0148 plasmid tig00000169_pilon, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

836. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP032395 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

837. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP050732 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST101 plasmid pST101-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

838. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_023898 (Klebsiella pneumoniae plasmid pRMH760, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

839. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP040884 (Escherichia coli strain K71-77 plasmid pK71-77-1-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

840. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP025144 (Klebsiella pneumoniae strain NR5632 plasmid NR5632_p1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

841. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP025147 (Klebsiella pneumoniae strain KP1766 plasmid KP1766_p1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

842. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to LC225353 (Photobacterium damselae subsp. piscicida plasmid pP0855 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

843. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_AP018143 (Escherichia coli strain M214 isolate M214 plasmid pM214_AC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

844. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_AP018145 (Escherichia coli strain M216 isolate M216 plasmid pM216_AC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

845. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP029718 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

846. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LN831185 (Vibrio cholerae isolate V. cholerae 116-17a plasmid pNDM-116-17, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

847. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP031297 (Escherichia coli strain EC17GD31 plasmid pGD31-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

848. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP050727 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST113 plasmid pST-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

849. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP050740 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

850. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP048797 (Providencia vermicola strain P8538 plasmid p8538-NDM-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

851. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP015394 (Klebsiella pneumoniae strain CR14 plasmid pCR14_2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

852. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP018698 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

853. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP018220 (Salmonella enterica subsp. enterica strain LSP 389/97 plasmid pUO-STmRV1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

854. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP027695 (Klebsiella pneumoniae strain KP30835 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

855. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP045953 (Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00008979 plasmid pAUSMDU00008979_01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

856. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN550958 (Proteus mirabilis strain PRT-ndm plasmid pPM154, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

857. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN603981 (Klebsiella aerogenes strain 1564 plasmid p1564, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

858. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT882698 (Klebsiella pneumoniae strain Klebsiella pneumoniae KLPN57 isolate KLPN57 plasmid I, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

859. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT882699 (Enterobacter cloacae isolate Enterobacter cloacae ENCL58 plasmid I, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

860. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT985220 (Escherichia coli strain 83 plasmid RCS1TR83_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

861. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT985234 (Escherichia coli strain 557 plasmid RCS32TR557_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

862. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT985225 (Escherichia coli strain 89 plasmid RCS2TR89_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

863. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT985258 (Escherichia coli strain 726 plasmid RCS54TR726_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

864. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT985222 (Escherichia coli strain 548 plasmid RCS24TR548_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

865. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT985228 (Escherichia coli strain 552 plasmid RCS28TR552_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

866. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT985218 (Escherichia coli strain 541 plasmid RCS18TR541_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

867. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT985260 (Escherichia coli strain 724 plasmid RCS53TR724_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

868. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT985253 (Escherichia coli strain 660 plasmid RCS48TR660_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

869. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT985250 (Escherichia coli strain 170 plasmid RCS38_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

870. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT985224 (Escherichia coli strain 513 plasmid RCS30_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

871. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT985243 (Escherichia coli strain 722 plasmid RCS41_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

872. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_LT985244 (Escherichia coli strain 167 plasmid RCS39_p, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

873. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP018956 (Escherichia coli strain Ecol_316 plasmid pEC316_KPC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

874. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN604267 (Salmonella enterica subsp. enterica serovar London strain SAL-19-0623 plasmid pSAL-19-0623_NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

875. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN604268 (Escherichia coli strain J53 plasmid pJ53_SAL-19-0623_NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

876. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP018710 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

877. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MK733575 (Escherichia coli strain J53 plasmid pMG252A, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

878. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MK388209 (Escherichia coli strain Ec20-Lar plasmid pC-Ec20-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

879. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MK439959 (Escherichia coli strain Ec-2Lar plasmid pC-Ec2-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

880. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MN101850 (Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

881. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MN101853 (Escherichia coli strain 13ZX36 plasmid p13ZX36-200, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

882. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MK770642 (Klebsiella pneumoniae strain T38 plasmid pT38_MCR3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

883. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MK123268 (Serratia marcescens strain M17468 plasmid pSMA17468, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

884. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MN148427 (Proteus vulgaris strain PV835 plasmid pPV835TEM24, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

885. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_022522 (Salmonella enterica subsp. enterica serovar Kentucky strain 1643/10 plasmid p1643_10, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

886. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN657249 (Enterobacteriaceae bacterium strain 1086-16 plasmid pKP39-T3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

887. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN657250 (Enterobacteriaceae bacterium strain 1083-16 plasmid pKP39-T4, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

888. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN657252 (Enterobacteriaceae bacterium strain 21-16 plasmid pPS-T1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

889. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP032380 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69807 plasmid pSDU1-USMARC-69807, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

890. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP032448 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69840 plasmid pSDU2-USMARC-69840, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

891. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH995508 (Enterobacter cloacae strain ECL17464 plasmid pECL17464, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

892. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH995506 (Citrobacter freundii strain CFR17394 plasmid pCFR17394, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

893. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH105050 (Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncA/C-IncX3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

894. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH917285 (Klebsiella pneumoniae strain 427113 plasmid p427113-Ct1/2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

895. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH909327 (Klebsiella pneumoniae strain 526316 plasmid p526316-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

896. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH263652 (Providencia rettgeri strain QD51 plasmid pNDM-QD51, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

897. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH917284 (Klebsiella pneumoniae strain 397108 plasmid p397108-Ct2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

898. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH760469 (Salmonella enterica strain 2016K-0796 plasmid p2016K-0796, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

899. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MK205418 (Salmonella enterica subsp. enterica serovar Dublin strain 14-1360 plasmid p14-1360-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

900. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MK205416 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01070 plasmid pN13-01070-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

901. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MK205417 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01141 plasmid pN13-01141, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

902. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH061195 (Klebsiella pneumoniae strain AHM7C8I plasmid pHNAH8I-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

903. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MK033499 (Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

904. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH011352 (Klebsiella pneumoniae strain 185 plasmid pNDM-185, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

905. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH476540 (Klebsiella pneumoniae strain KP1276 plasmid pIA/C-KLUC, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

906. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MK101346 (Citrobacter freundii strain CRE3 plasmid pCRE7-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

907. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN657241 (Enterobacteriaceae bacterium strain 20-16 plasmid pCF104a-T3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

908. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN657242 (Enterobacteriaceae bacterium strain 128-16 plasmid pEC405a-T3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

909. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN657243 (Enterobacteriaceae bacterium strain 24-16 plasmid pEC744-T5, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

910. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN657244 (Enterobacteriaceae bacterium strain 690-16 plasmid pEC6332-T3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

911. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MN657247 (Enterobacteriaceae bacterium strain 460-16 plasmid pECl-T3, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

912. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP009410 (Salmonella enterica strain CFSAN007405 isolate 30034 plasmid pCFSAN007405_01, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

913. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MG764534 (Klebsiella aerogenes strain EA409 plasmid pEA409TEM24, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

914. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MF627444 (Vibrio parahaemolyticus strain Vb0267 plasmid pVb0267, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

915. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH001166 (Escherichia coli strain TAEC1 plasmid pNDM-TAEC1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

916. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MF150121 (Klebsiella pneumoniae strain A64477 plasmid pKP64477c, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

917. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MF150123 (Klebsiella pneumoniae strain A64216 plasmid pKP64216b, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

918. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MF344573 (Klebsiella pneumoniae strain N201205880 plasmid p205880-Ct1/2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

919. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MF344572 (Enterobacter hormaechei strain 24845 plasmid p24845-Ct2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

920. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MF344574 (Enterobacter hormaechei strain T5282 plasmid pT5282-Ct2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

921. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MG450360 (Escherichia coli strain AMA566 plasmid pAMA566, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

922. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MG252895 (Escherichia coli strain Esco-36073cz plasmid pEsco-36073cz, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

923. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH113855 (Vibrio alginolyticus strain Vb1796 plasmid pVb1796, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

924. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH457126 (Vibrio alginolyticus strain Vb1394 plasmid pC1394, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

925. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH475146 (Citrobacter freundii strain 164 plasmid pCf164_LMB-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

926. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH763829 (Citrobacter freundii strain JY-17 plasmid pCFJY-17, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

927. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH892479 (Citrobacter freundii strain 2262 plasmid pNDM-2262, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

928. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MH844629 (Escherichia coli strain 2248 plasmid pNDM-2248, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

929. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP030132 (Klebsiella pneumoniae strain 160111 plasmid pIncAC2_L111, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

930. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MT219816 (Escherichia coli strain RF173-1 plasmid pRF173-1_87k_tetX, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

931. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KY887591 (Escherichia coli strain Ec19 plasmid pEc19, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

932. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KY887590 (Escherichia coli strain Ec9 plasmid pEc9, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

933. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_KY887595 (Escherichia coli strain Ec78 plasmid pEc78, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

934. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MF582638 (Klebsiella pneumoniae strain KKp4 plasmid pKKp4-VIM, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

935. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MF072965 (Citrobacter freundii strain P10159 plasmid pP10159-5, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

936. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MG764552 (Klebsiella pneumoniae strain A1763 plasmid pA1763-Ct2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

937. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MF150118 (Proteus mirabilis strain A64421 plasmid pPM64421a, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

938. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MF627445 (Vibrio parahaemolyticus strain Vb0499 plasmid pVb0499, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

939. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_MF497432 (Vibrio alginolyticus strain Vb0506 plasmid pVb0506, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

940. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP040068 (Escherichia coli strain A1_181 plasmid p_unnamed1_KPC2, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

941. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP044189 (Salmonella enterica subsp. enterica strain AR-0401 plasmid pAR-0401-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

942. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP028814 (Edwardsiella ictaluri strain MS-17-156 plasmid pEI-MS-17-156-1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

943. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP020913 (Salmonella enterica subsp. enterica serovar Montevideo str. CDC 2010K-0257 plasmid pSMO-2010K-0257, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

944. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP029737 (Providencia rettgeri strain AR_0082 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

945. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP048384 (Citrobacter freundii strain 62 plasmid p6_B, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

946. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP032168 (Klebsiella pneumoniae strain AR_0076 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

947. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP053192 (Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37b, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

948. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to MT151380 (Vibrio cholerae strain YA00120881 plasmid pYA00120881, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

949. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP054305 (Klebsiella pneumoniae strain MS14393 plasmid pMS14393B, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ggtttgcggccaaccaggcgatcactgcatca	Protospacer
.*.**** ******** **********.   *

950. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

951. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

952. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

953. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

954. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

955. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

956. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

957. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

958. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

959. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

960. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

961. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

962. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

963. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

964. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

965. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

966. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

967. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

968. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

969. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

970. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

971. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
ttccaggccccgaccatccgatcactgtcgaa	Protospacer
  *. * * **.***** **************

972. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 9, identity: 0.719

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
aatccccctccccgaaccgattgtcaccaacg	Protospacer
*.*. . ** **************.*****

973. spacer 2.4|3154205|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 9, identity: 0.719

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
aatccccctccccgaaccgattgtcaccaacg	Protospacer
*.*. . ** **************.*****

974. spacer 2.6|3154327|32|NZ_CP053582|CRISPRCasFinder,CRT matches to LC487410 (Vibrio phage KIT04 DNA, complete genome) position: , mismatch: 9, identity: 0.719

tgtagcaccagcaataacagtcggtagatggg	CRISPR spacer
tgtaccaccaacaataacagtcggactccagt	Protospacer
**** *****.*************    ..*

975. spacer 2.9|3154510|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

tcctgcgcgtatccagccgtccagatgtttcg	CRISPR spacer
gcctgcgcgtatccacccctccagcccgcccg	Protospacer
 ************** ** ***** .  ..**

976. spacer 2.14|3154815|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP020429 (Streptococcus sp. FDAARGOS_192 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
tattatcaaataatccccaaccatttgatggg	Protospacer
* . *  ************ ****** *** .

977. spacer 2.14|3154815|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP043831 (Bacillus sp. BS98 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
cacataaaaatgatccccatcgatttcaaaga	Protospacer
. *. ******.********* ****** . *

978. spacer 2.14|3154815|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP018188 (Streptococcus salivarius strain ICDC2 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
tattatcaaataatccccaaccatttgatgtg	Protospacer
* . *  ************ ****** ***..

979. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 9, identity: 0.719

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
agcttggcgccacccatgcgatcgatccggcc	Protospacer
****** ***** **********. * . *

980. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP049157 (Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence) position: , mismatch: 9, identity: 0.719

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
acactgccaccaagcatgcgatcactggcctg	Protospacer
*  .****.**** ************* *  .

981. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP049317 (Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence) position: , mismatch: 9, identity: 0.719

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
acactgccaccaagcatgcgatcactggcctg	Protospacer
*  .****.**** ************* *  .

982. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
cccttgccgccaaccatgcgctgacgctggcg	Protospacer
  ****************** * **  * * .

983. spacer 2.19|3155120|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 9, identity: 0.719

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
cccttgccgccaaccatgcgctgacgctggcg	Protospacer
  ****************** * **  * * .

984. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 9, identity: 0.719

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
aatccccctccccgaaccgattgtcaccaacg	Protospacer
*.*. . ** **************.*****

985. spacer 2.26|3154207|32|NZ_CP053582|PILER-CR matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 9, identity: 0.719

agttgtgctacccgaaccgattgttaccaaac	CRISPR spacer
aatccccctccccgaaccgattgtcaccaacg	Protospacer
*.*. . ** **************.*****

986. spacer 2.28|3154329|32|NZ_CP053582|PILER-CR matches to LC487410 (Vibrio phage KIT04 DNA, complete genome) position: , mismatch: 9, identity: 0.719

tgtagcaccagcaataacagtcggtagatggg	CRISPR spacer
tgtaccaccaacaataacagtcggactccagt	Protospacer
**** *****.*************    ..*

987. spacer 2.31|3154512|32|NZ_CP053582|PILER-CR matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

tcctgcgcgtatccagccgtccagatgtttcg	CRISPR spacer
gcctgcgcgtatccacccctccagcccgcccg	Protospacer
 ************** ** ***** .  ..**

988. spacer 2.36|3154817|32|NZ_CP053582|PILER-CR matches to NZ_CP020429 (Streptococcus sp. FDAARGOS_192 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
tattatcaaataatccccaaccatttgatggg	Protospacer
* . *  ************ ****** *** .

989. spacer 2.36|3154817|32|NZ_CP053582|PILER-CR matches to NZ_CP043831 (Bacillus sp. BS98 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
cacataaaaatgatccccatcgatttcaaaga	Protospacer
. *. ******.********* ****** . *

990. spacer 2.36|3154817|32|NZ_CP053582|PILER-CR matches to NZ_CP018188 (Streptococcus salivarius strain ICDC2 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

ttcgaaaaaataatccccatccatttcatgca	CRISPR spacer
tattatcaaataatccccaaccatttgatgtg	Protospacer
* . *  ************ ****** ***..

991. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 9, identity: 0.719

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
agcttggcgccacccatgcgatcgatccggcc	Protospacer
****** ***** **********. * . *

992. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP049157 (Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence) position: , mismatch: 9, identity: 0.719

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
acactgccaccaagcatgcgatcactggcctg	Protospacer
*  .****.**** ************* *  .

993. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP049317 (Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence) position: , mismatch: 9, identity: 0.719

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
acactgccaccaagcatgcgatcactggcctg	Protospacer
*  .****.**** ************* *  .

994. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
cccttgccgccaaccatgcgctgacgctggcg	Protospacer
  ****************** * **  * * .

995. spacer 2.41|3155122|32|NZ_CP053582|PILER-CR matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 9, identity: 0.719

agcttgccgccaaccatgcgatcactgtcgaa	CRISPR spacer
cccttgccgccaaccatgcgctgacgctggcg	Protospacer
  ****************** * **  * * .

996. spacer 2.3|3154144|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP012627 (Escherichia coli strain SF-468 plasmid pSF-468-2, complete sequence) position: , mismatch: 10, identity: 0.688

gatcgttctgcgtcactttccccgcatttaac	CRISPR spacer
cgtcgttctgcctcacgttccccgctggcggc	Protospacer
 .********* **** ********   ...*

997. spacer 2.7|3154388|32|NZ_CP053582|CRISPRCasFinder,CRT matches to CP034667 (Proteus vulgaris strain PvSC3 plasmid pPvSC3, complete sequence) position: , mismatch: 10, identity: 0.688

atccgtcgcggcgctggtaaaccatgaatttt	CRISPR spacer
tgaaattacgtcgctggtaaaccctgaattta	Protospacer
    .*..** ************ *******

998. spacer 2.25|3154146|32|NZ_CP053582|PILER-CR matches to NZ_CP012627 (Escherichia coli strain SF-468 plasmid pSF-468-2, complete sequence) position: , mismatch: 10, identity: 0.688

gatcgttctgcgtcactttccccgcatttaac	CRISPR spacer
cgtcgttctgcctcacgttccccgctggcggc	Protospacer
 .********* **** ********   ...*

999. spacer 2.29|3154390|32|NZ_CP053582|PILER-CR matches to CP034667 (Proteus vulgaris strain PvSC3 plasmid pPvSC3, complete sequence) position: , mismatch: 10, identity: 0.688

atccgtcgcggcgctggtaaaccatgaatttt	CRISPR spacer
tgaaattacgtcgctggtaaaccctgaattta	Protospacer
    .*..** ************ *******

1000. spacer 2.15|3154876|32|NZ_CP053582|CRISPRCasFinder,CRT matches to NZ_CP043437 (Enterobacter sp. LU1 plasmid unnamed) position: , mismatch: 11, identity: 0.656

gcgcgctcaataccgtcaggaataagccccag	CRISPR spacer
cggcactcaataccgtcagtaataatatttca	Protospacer
  **.************** *****  ... .

1001. spacer 2.37|3154878|32|NZ_CP053582|PILER-CR matches to NZ_CP043437 (Enterobacter sp. LU1 plasmid unnamed) position: , mismatch: 11, identity: 0.656

gcgcgctcaataccgtcaggaataagccccag	CRISPR spacer
cggcactcaataccgtcagtaataatatttca	Protospacer
  **.************** *****  ... .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

190926 : 199471

Enterobacteria_phage(66.67%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079823561.1\|190926_191874_+	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	1.1e-09	27.8
WP_079804824.1\|191857_192589_+	ABC transporter permease	NA	NA	NA	NA
WP_001234242.1\|192569_192677_-	protein YohO	NA	NA	NA	NA
WP_079823560.1\|192736_193468_-	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	1.6e-101	88.9
WP_079804830.1\|193690_195376_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	1.2e-274	90.2
WP_079804826.1\|195372_196092_+	two-component system response regulator BtsR	NA	NA	NA	NA
WP_079823559.1\|196143_196614_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	1.2e-70	85.3
WP_079804828.1\|196738_197197_-	YehR family lipoprotein	Q9EYF5	Enterobacteria_phage	1.9e-52	71.2
WP_079804690.1\|197437_199471_-\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	2.1e-55	27.6

DBSCAN-SWA_2

308610 : 341269

Enterobacteria_phage(33.33%)

integrase,plate

attL 321277:321291|attR 344443:344457

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079823528.1\|308610_310470_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_079823527.1\|310433_311486_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_079823526.1\|311570_311837_+	HigA family addiction module antidote protein	NA	NA	NA	NA
WP_079823525.1\|312668_313541_+\|integrase	integrase domain-containing protein	NA	NA	NA	NA
WP_079805423.1\|315158_316610_+	EmmdR/YeeO family multidrug/toxin efflux MATE transporter	NA	NA	NA	NA
WP_079805422.1\|317031_318486_-	AMP nucleosidase	NA	NA	NA	NA
WP_079805421.1\|319390_320857_-	C69 family dipeptidase	NA	NA	NA	NA
321277:321291	attL	NA	NA	NA	NA
WP_000661532.1\|321357_321564_+	hypothetical protein	NA	NA	NA	NA
WP_171775173.1\|321757_322024_-	hypothetical protein	NA	NA	NA	NA
WP_079805420.1\|322419_323034_-\|integrase	integrase arm-type DNA-binding domain-containing protein	Q7M297	Enterobacteria_phage	8.4e-24	37.9
WP_079805419.1\|323407_325156_+	hypothetical protein	NA	NA	NA	NA
WP_079823524.1\|325234_329299_+	hypothetical protein	NA	NA	NA	NA
WP_079823523.1\|329311_330913_+	hypothetical protein	NA	NA	NA	NA
WP_079804831.1\|331754_331976_+	helix-turn-helix domain-containing protein	A0A2I7S995	Vibrio_phage	3.2e-18	67.2
WP_003842123.1\|332473_332827_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_003842125.1\|332831_333134_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_079804832.1\|333639_334527_+\|integrase	integrase domain-containing protein	NA	NA	NA	NA
WP_079804833.1\|334872_335076_+	hypothetical protein	NA	NA	NA	NA
WP_079823522.1\|337184_338681_-	C69 family dipeptidase	NA	NA	NA	NA
WP_079804836.1\|339365_340163_-	DgsA anti-repressor MtfA	NA	NA	NA	NA
WP_079823521.1\|340885_341269_-\|integrase	tyrosine-type recombinase/integrase	A0A192Y7M7	Salmonella_phage	3.0e-40	63.8
344443:344457	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1965646 : 2023876

Stx2-converting_phage(25.0%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079824680.1\|1965646_1966768_-\|transposase	transposase	A0A0P0ZEB3	Stx2-converting_phage	1.4e-69	41.2
WP_079824681.1\|1966787_1967135_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	3.6e-40	66.4
WP_139386343.1\|1967131_1967548_-\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	1.0e-12	35.6
WP_079824683.1\|1969137_1972557_-	DUF4765 family protein	A0A0N7KZG3	Stx2-converting_phage	0.0e+00	50.9
WP_171804757.1\|1973223_1973448_+	hypothetical protein	NA	NA	NA	NA
WP_079824686.1\|1974092_1974902_-	CatB-related O-acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	2.9e-08	36.5
WP_079805044.1\|1975960_1977211_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	8.0e-98	47.5
WP_079805045.1\|1977222_1978326_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.4e-61	40.1
WP_079824687.1\|1978608_1979661_+	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	3.3e-113	59.0
WP_079805047.1\|1979712_1980114_-	sigma factor-binding protein Crl	NA	NA	NA	NA
WP_079805048.1\|1980171_1981416_-	esterase FrsA	NA	NA	NA	NA
WP_001292018.1\|1981504_1981963_-	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_079805049.1\|1982208_1983666_+	cytosol nonspecific dipeptidase	NA	NA	NA	NA
WP_079824688.1\|1983931_1984987_-	DNA polymerase IV	NA	NA	NA	NA
WP_079805051.1\|1985236_1985977_+	murein L,D-transpeptidase	NA	NA	NA	NA
WP_000333389.1\|1985947_1986715_-	class II glutamine amidotransferase	NA	NA	NA	NA
WP_079805052.1\|1986792_1987371_-	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	1.3e-13	30.8
WP_079805612.1\|1987611_1990056_+	acyl-CoA dehydrogenase FadE	NA	NA	NA	NA
WP_079805614.1\|1990165_1990933_+	amidohydrolase	NA	NA	NA	NA
WP_023186919.1\|1991094_1991502_+	Spy/CpxP family protein refolding chaperone	NA	NA	NA	NA
WP_079805623.1\|1993375_1994095_+	adhesin/invasin protein PagN	NA	NA	NA	NA
WP_079805625.1\|1994787_1995519_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	4.9e-39	39.9
WP_000917870.1\|1995582_1996050_+	ribonuclease HI	J9Q745	Salmonella_phage	8.0e-51	58.2
WP_079805616.1\|1996046_1996769_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_079805618.1\|1996803_1997559_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_079805620.1\|1997630_1998998_+	murein transglycosylase D	A0A2H4J9N7	uncultured_Caudovirales_phage	4.9e-08	34.2
WP_002947275.1\|1999451_2000249_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_079824689.1\|2000803_2001433_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000691257.1\|2001712_2002534_-	hypothetical protein	NA	NA	NA	NA
WP_079824690.1\|2002551_2005002_-	DUF4150 domain-containing protein	A0A077K801	Ralstonia_phage	1.6e-36	26.5
WP_079824691.1\|2005215_2005980_-	hypothetical protein	A0A077K9W3	Ralstonia_phage	2.2e-05	30.7
WP_079840737.1\|2005979_2008397_-	DUF4150 domain-containing protein	A0A077K801	Ralstonia_phage	1.9e-34	26.3
WP_079824780.1\|2008393_2009431_-	hypothetical protein	NA	NA	NA	NA
WP_079824779.1\|2009427_2010447_-	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_024134707.1\|2010513_2010750_-	hypothetical protein	NA	NA	NA	NA
WP_024134706.1\|2010774_2011995_-	hypothetical protein	NA	NA	NA	NA
WP_171804758.1\|2012012_2013977_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	7.3e-21	24.1
WP_001142965.1\|2014203_2014722_-	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_071651051.1\|2015401_2015902_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_171804810.1\|2015981_2017415_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_023186933.1\|2017417_2017846_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_079824739.1\|2017845_2019681_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_024139506.1\|2019647_2020694_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_079805525.1\|2020710_2022000_+	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_079824740.1\|2021996_2022530_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_079824741.1\|2022532_2023876_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_4

4450871 : 4459124

Salmonella_phage(50.0%)

head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079804132.1\|4450871_4451327_+	DUF2824 family protein	I6R0L6	Salmonella_phage	4.4e-86	98.7
WP_079823785.1\|4451329_4452019_+	DNA transfer protein	I1TEJ4	Salmonella_phage	8.1e-92	96.9
WP_079823824.1\|4452061_4453288_+	phage DNA ejection protein	E7C9U5	Salmonella_phage	1.1e-126	69.4
WP_079823786.1\|4453287_4455285_+	DNA transfer protein	Q716G2	Shigella_phage	0.0e+00	94.6
WP_000749288.1\|4455375_4455861_-	hypothetical protein	NA	NA	NA	NA
WP_079804129.1\|4455925_4456504_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_171804796.1\|4456532_4456820_-	Arc family DNA-binding protein	A0A088CPT2	Enterobacteria_phage	3.8e-27	67.4
WP_079823787.1\|4456922_4459124_+\|head	phage head-binding domain-containing protein	K4FBU1	Escherichia_phage	1.6e-109	37.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP053582

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection