CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP052135	Bacillus sp. L13 (2020) chromosome, complete genome	1 crisprs	csa3,cas3,DEDDh	1	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP052135_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP052135_1

2983132-2983262

Orphan

Consensus_repeat	Method
TGTTCCTTCAACGTTCGACCTTGTTCCTGCAACAGTTGACCATGTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP052135_1

>merge|NZ_CP052135|1|2983132-2983262|CRISPRCasFinder
TGTTCTTTTAATGTTTCTCCATGTTCTTTCAACAAACGGTCTTGTTCTTGCAGCAGTTGACCATGTTCCTTCAACGTTCGACCTTGTTCCTGCAACAGTTGACCATGTTCCTTCAACGTTCGACCTTGTTC

>NZ_CP052135|1|1|2983132-2983262|CRISPRCasFinder
TGTTCTTTTAATGTTTCTCCATGTTCTTTCAACAAACGGTCTTGTTC	TTGCAGCAGTTGACCATGTTCCTTCAACGTTCGACCT
TGTTCCTGCAACAGTTGACCATGTTCCTTCAACGTTCGACCTTGTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP052135.1\|WP_170008451.1\|2976548_2977610_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187575
NZ_CP052135.1\|WP_170008458.1\|2984528_2985416_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|366120
NZ_CP052135.1\|WP_170008453.1\|2978514_2978817_+\|DUF3817-domain-containing-protein	unknown	unknown	gnl\|CDD\|378962
NZ_CP052135.1\|WP_170008447.1\|2971612_2972608_+\|UDP-glucose-4-epimerase-GalE	unknown	unknown	gnl\|CDD\|224012
NZ_CP052135.1\|WP_170008464.1\|2988932_2989493_-\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|224766
NZ_CP052135.1\|WP_170008455.1\|2981305_2982721_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|119353
NZ_CP052135.1\|WP_170008461.1\|2987147_2987687_-\|family-1-glycosylhydrolase	unknown	unknown	gnl\|CDD\|225343
NZ_CP052135.1\|WP_170008459.1\|2985687_2986680_-\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NZ_CP052135.1\|WP_170008463.1\|2988356_2988908_+\|short-chain-dehydrogenase	unknown	unknown	gnl\|CDD\|236232
NZ_CP052135.1\|WP_170008454.1\|2980240_2981149_+\|PhzF-family-phenazine-biosynthesis-protein	unknown	unknown	gnl\|CDD\|223461
NZ_CP052135.1\|WP_170008452.1\|2977785_2978220_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372807
NZ_CP052135.1\|WP_170008449.1\|2974097_2975129_+\|galactose-mutarotase	unknown	unknown	gnl\|CDD\|185696
NZ_CP052135.1\|WP_170008832.1\|2990583_2992473_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP052135.1\|WP_170008450.1\|2975174_2976341_-\|ROK-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224851
NZ_CP052135.1\|WP_170008460.1\|2986710_2986899_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225099
NZ_CP052135.1\|WP_170008462.1\|2988014_2988269_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052135.1\|WP_170008457.1\|2983646_2984420_+\|3-hydroxybutyrate-dehydrogenase	unknown	unknown	gnl\|CDD\|237100
NZ_CP052135.1\|WP_170008465.1\|2992533_2992725_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP052135.1\|WP_170008448.1\|2972610_2974101_+\|UDP-glucose--hexose-1-phosphate-uridylyltransferase	unknown	unknown	gnl\|CDD\|235382
NZ_CP052135.1\|WP_170008831.1\|2978851_2979763_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235853

Protein	Function_ID	Function_description	E-value
NZ_CP052135.1\|WP_170008451.1\|2976548_2977610_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187575	cd05265, SDR_a1, atypical (a) SDRs, subgroup 1. Atypical SDRs in this subgroup are poorly defined and have been identified putatively as isoflavones reductase, sugar dehydratase, mRNA binding protein etc. Atypical SDRs are distinct from classical SDRs. Members of this subgroup retain the canonical active site triad (though not the upstream Asn found in most SDRs) but have an unusual putative glycine-rich NAD(P)-binding motif, GGXXXXG, in the usual location. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.78556e-62
NZ_CP052135.1\|WP_170008458.1\|2984528_2985416_-\|ROK-family-protein	gnl\|CDD\|366120	pfam00480, ROK, ROK family.	1.2217e-73
NZ_CP052135.1\|WP_170008453.1\|2978514_2978817_+\|DUF3817-domain-containing-protein	gnl\|CDD\|378962	pfam12823, DUF3817, Domain of unknown function (DUF3817). This domain is of unknown function. It is sometimes found adjacent to pfam07690 and pfam03176 which are both transporter domains.	1.56526e-26
NZ_CP052135.1\|WP_170008447.1\|2971612_2972608_+\|UDP-glucose-4-epimerase-GalE	gnl\|CDD\|224012	COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane].	0
NZ_CP052135.1\|WP_170008464.1\|2988932_2989493_-\|flavin-reductase-family-protein	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	2.91254e-36
NZ_CP052135.1\|WP_170008455.1\|2981305_2982721_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|119353	cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.	4.63096e-140
NZ_CP052135.1\|WP_170008461.1\|2987147_2987687_-\|family-1-glycosylhydrolase	gnl\|CDD\|225343	COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].	9.75843e-12
NZ_CP052135.1\|WP_170008459.1\|2985687_2986680_-\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	9.69604e-60
NZ_CP052135.1\|WP_170008463.1\|2988356_2988908_+\|short-chain-dehydrogenase	gnl\|CDD\|236232	PRK08309, PRK08309, short chain dehydrogenase; Provisional.	6.86663e-67
NZ_CP052135.1\|WP_170008454.1\|2980240_2981149_+\|PhzF-family-phenazine-biosynthesis-protein	gnl\|CDD\|223461	COG0384, COG0384, Predicted epimerase, PhzC/PhzF homolog [General function prediction only].	1.43694e-73
NZ_CP052135.1\|WP_170008452.1\|2977785_2978220_-\|hypothetical-protein	gnl\|CDD\|372807	pfam13911, AhpC-TSA_2, AhpC/TSA antioxidant enzyme. This family contains proteins related to alkyl hydro-peroxide reductase (AhpC) and thiol specific antioxidant (TSA).	9.792e-07
NZ_CP052135.1\|WP_170008449.1\|2974097_2975129_+\|galactose-mutarotase	gnl\|CDD\|185696	cd09019, galactose_mutarotase_like, galactose mutarotase_like. Galactose mutarotase catalyzes the conversion of beta-D-galactose to alpha-D-galactose. Beta-D-galactose is produced by the degradation of lactose, a disaccharide composed of beta-D-glucose and beta-D-galactose. This epimerization reaction is the first step in the four-step Leloir pathway, which converts galactose into metabolically important glucose. This epimerization step is followed by the phosophorylation of alpha-D-galactose by galactokinase, an enzyme which can only act on the alpha anomer. A glutamate and a histidine residue of the galactose mutarotase have been shown to be critical for catalysis, the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen. Galactose mutarotase is a member of the aldose-1-epimerase superfamily.	1.57417e-150
NZ_CP052135.1\|WP_170008832.1\|2990583_2992473_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	0
NZ_CP052135.1\|WP_170008450.1\|2975174_2976341_-\|ROK-family-transcriptional-regulator	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	9.29157e-78
NZ_CP052135.1\|WP_170008460.1\|2986710_2986899_-\|hypothetical-protein	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	1.48665e-05
NZ_CP052135.1\|WP_170008457.1\|2983646_2984420_+\|3-hydroxybutyrate-dehydrogenase	gnl\|CDD\|237100	PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional.	3.4402e-144
NZ_CP052135.1\|WP_170008465.1\|2992533_2992725_-\|hypothetical-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	9.07064e-16
NZ_CP052135.1\|WP_170008448.1\|2972610_2974101_+\|UDP-glucose--hexose-1-phosphate-uridylyltransferase	gnl\|CDD\|235382	PRK05270, PRK05270, UDP-glucose--hexose-1-phosphate uridylyltransferase.	0
NZ_CP052135.1\|WP_170008831.1\|2978851_2979763_-\|SDR-family-oxidoreductase	gnl\|CDD\|235853	PRK06701, PRK06701, short chain dehydrogenase; Provisional.	1.12455e-149

>NZ_CP052135.1|WP_170008455.1|2981305_2982721_+|LysM-peptidoglycan-binding-domain-containing-protein
MSIHVVKQGESLYSISRRYDVSIDQIAAVNSLPANNLGRIVPGLALVIPLAEWAYTVQPGDSLYRIANRHGTTVARIIARNNIANPDRIQVGDSLVIPVRLYRVEAGDSLWSIAQRTDTSVDRIQALNNVQANRLQIGQRLLLPQPRKPITEVNAYSTELTEEGAQEIRELGNLLTYASPFAYVFNEQGKLNSINDEPLLRAIRETNTVPMMSITNFTASNPGTEVASTILGSPEKQQTLIQSIRDVARRKRYAGVNVDFENVAPADKENYNDFLRRLQEATANDDFFVSTAVAPKTSAEQKGVLYEAIDYPAHGEITDFVVLMTYEWGYRLGPPRAISPVDQIRRVLDYAVSVMPPEKLFLGFQIYARDWTLPFQKGDEAETFSVEEAVHRAIQYGVPIQYDEKAQSPYYRYRDEQGVEHEVWFEDARSAKAKFDLVTEYGLKGVSYWVLGYPFPENWELLDQMFRVRKK
>NZ_CP052135.1|WP_170008454.1|2980240_2981149_+|PhzF-family-phenazine-biosynthesis-protein
MRRYSMVTFDVFSPRAFGGNQLAIFPEADELSTDDMQTLAKEINLSETVFCFPPHSEKNTAKLRIFTPGKELPVAGHPTIGTAVYFAELHGIQEGESIEFIFEEGVGPIHVDVNRQHGKLIARMHQPIPHRTNLTPIGEEAALLGLDAGQLHPSIPPTGLSAGVPFLYIPLLDREALASIQFRRDVWESRYAKFEETSHIFAFAMDEKEPTRIHSRMFAPAMGISEDPATGIASGPLGVFVAENFFAETASSVHLVSIQGADLGRRSVIQIDLKREGGTWTDVSIAGTAVQVGEGAFFWEKK
>NZ_CP052135.1|WP_170008831.1|2978851_2979763_-|SDR-family-oxidoreductase
MKPTEQDYPMYPNYGKVTQYEDVPLTVPEQRQLRQPGVEKLMVPRPIIENPNYKGSGKLKGKVALITGGDSGMGAAAAIAFAKEGANVAIAYLDEHEDANRTKNRIEELGQRCLVLPGDLREKQQCIHIVEETIRTFGGLNILCNHVGIQFQQLSLLDITDEQFDDTFKVNIYSHFYTTRAALPYLEAGSSIINTASVVTYDGNKQLIDYTATKGANVGFTRALANNLVDKGIRVNAIAPGRIWTPLIPASFSADQVALAGNPMQRQGQPFEVAPTFVYLASDDSRFVTGQTLHVNGGQWTSS
>NZ_CP052135.1|WP_170008453.1|2978514_2978817_+|DUF3817-domain-containing-protein
MALMKHPVGRLRILGILEGISYLLLLFIAMPLKYMADISEAVLITGATHGFLFILFVFAVINVFFSKKWTVRWAIGAVIASLLPFGTFVLDRQLRKHSAE
>NZ_CP052135.1|WP_170008452.1|2977785_2978220_-|hypothetical-protein
MREHAKEIEQAGFQIVTVAPAKHEHISPFVEEYGPFPFVVVGDPEKEAYKGLGHPSITKAKLALQLGAGFVTGKTKHLKPYTPKTKHQRDMMLTAVKEQDYLIQGGTWIVSGLGDVLWKHIDKEPGDHARIEVVVDEVKKLSDN
>NZ_CP052135.1|WP_170008451.1|2976548_2977610_+|NAD-dependent-epimerase/dehydratase-family-protein
MNILLLGGTRFLGKAIAEAFVANGDNVTLLHRGKSTTLPEGVTSVIGDRHDVHTFDSLQEEWDMVIDTCGYHPDAVRTSVNALQKASKQYLFISTISVYEEFAIANNLEEDDAALLTISDAQMEQEGLSNDKFGKFYGHLKTRCEEVVREGFPNNHLILRPGLLVGPYDVTDRFTYWAWRVQQEAEMLAPGRPDKQVQFIDVRDIADWLVRLSRNDVKAATMNVIGPTKGITMEQLIEKAKQATGSSTPVTWVEETFLKEQGVHPWLEMPLWLPESFSLREDGRLPEGEIVFSLDRAIEYGLQTRPVEDTIRDLVTWWDTLGKSEPGAGIALSKETLVLQEWHAKQEATEQPS
>NZ_CP052135.1|WP_170008450.1|2975174_2976341_-|ROK-family-transcriptional-regulator
MQRGTFRLMKSVNKSIILNKIRISEPISRAQIAKETSLTPPTVSSIVKELIEQGLVRESVLGQSSGGRKPTMLHIDSNAFYVIGVDAGPETVECILTDLTGEILQRTSSVLKKPLTNAQLISTLKENIQTILKQSKINQDKMIGIGVAMHGVVDVETGTSLVAPNLNLRNTPIKEVLEREFNLTVKVENDARAMALGESWFGGHGDVDSMVAVNIGRGVGAGVVISGKLYHGAQGIAGELGHMTIDLNGDICECGNQGCLQTFVSGAAIAERAEKQIKETVGNLTGKEVFELARNGSQPHIDLLRETGRMIGIGLTNLIHLINPGKIVLGGGVMKSEKVIMPTIHETIQKRALTPEAKQTKVVVTQLGDDATLLGAVSLLLVELFNPM
>NZ_CP052135.1|WP_170008449.1|2974097_2975129_+|galactose-mutarotase
MNLNIKEISGEWKEYTLVNDSGMSVSVLDYGGIMTKIMVPDRNGNLENVVLGYKDYLDYESNSNYFGALIGRVAGRIQGASFELDGKTIQLAANNGNNHLHGGPSGFHRVIWDVKPFQTDDTVGLELIHRSVDGAGGYPGNVDITVTYSLNNKNQLILNYMASSDQTTPITLTNHSYFNLSGNLTNTVQDHHVTLDSSQFVELDNDLIPTGKLIHVAGSSFDFRSGRVLGDGFSSDSYQNKVAGSGYDHYFIFENTMENQAIIHDPASGRVMSIKTNQPGMVMYTANSLNEELQLAEGSSRKYLGVCFETQASPASLHHEGFPSVMLNAGENYVKQTVFSFRV
>NZ_CP052135.1|WP_170008448.1|2972610_2974101_+|UDP-glucose--hexose-1-phosphate-uridylyltransferase
MIYHDIEGLIQKAIDVGLIELADKDYVRNQVMSLLRIEVLPENENQKTDDTIPNIVENLVAYAIEQDIIQDVFDDKEILSANIMNCFVARPSTVNATFNEKYKESPTAATDYFYRLSKKSNYIQMNRIKKNISYKVYTLYGEMDITINLSKPEKDPEQIKRERAIKQAGNYPKCLLCKENEGYTGRTGHPARANHRIIKIPLVGENWYLQYSPYVYYNEHSILLSEQHRDMKIEGATFNRLLTFTAKFPHYFIGSNADLPIVGGSILSHDHYQGGRYEFAMTRAKDAFVFELHAYPDIKASILKWPMSVIRLRGTSIHTLVSAADTILKTWRDYSDELADVFAFTGDTPHNTITPIARNRYGVFELDLVLRNNRTTEEHPLGIFHPHDDVHHIKKENIGLIEVMGLAVLPPRLKGELNELKKFLLGESNHVEAYHHKWANQLKGEYGILSDSEQAEAILQKELGKKFVKVLRDAGVFKEREAFDRFIGTLNKVRKL
>NZ_CP052135.1|WP_170008447.1|2971612_2972608_+|UDP-glucose-4-epimerase-GalE
MSVLVLGGAGYIGSHSVYQLIEQGENVIIVDNLETGHKEAVHPKALFYEGDIRNIDFLRSVFESESIDAVIHFAAHSLVGESMEKPLKYFDNNVYGTQVLLQVMVEHDVKHIIFSSTAATYGEPESVPITETTPTNPTNAYGETKLTMEKLIKWTEQAHGIHYVSLRYFNVAGARATAEIGEDHRPETHLVPIILKTALQQRSNITIFGDDYDTVDGTCIRDYVHVEDLINAHLLALHYLREGGKSDVFNLGSNQGFSVKEMIDTARVVTGKEIPSEIGERRAGDPSILIASSDKAKQVLGWNPTRTSVTKIMEDAWNWHSSHPKGYREEV
>NZ_CP052135.1|WP_170008457.1|2983646_2984420_+|3-hydroxybutyrate-dehydrogenase
MHKKILFITGAAQGIGFEVAKDFATRGATVVLTDLQEEAVKKAANTLVSSGHEAIGLRCDVTSETDIEQALHTTVEKYGRIDYLINNAGLQHVSHLEEFPTAKFEQMIQIMLTAPFIAIKHVLPIMRKQKFGRILNMASINGLVGFAGKAAYNSAKHGVIGLTKVAALETATDGITVNAICPGYVDTPLVRNQLQSLADTRGIPLERVLEDVIYPLVPQKRLLDVSEIASYAAYICSEEAKGITGQAVVLDGGYTVQ
>NZ_CP052135.1|WP_170008458.1|2984528_2985416_-|ROK-family-protein
MRLGAIEAGGTKFVCAIGDVDGKIEKRMQFPTTTPEETLLAVREFFANETVDAVGIGSFGPIDVNRTSKTYGYVTTTPKAGWSNFPFLQAVKEIVGAPVGFTTDVNAAALGELTLGAAQGAGSCLYVTVGTGIGGGAVMKGELLEGITHPEMGHIRVRRHEQDTYAGNCPYHSDCLEGLAAGPAIEKRWGQKGSQLVDRPEVWETEAHYLGEAVATWILTLSPERIVLGGGVMKQRQLLPLIHKHVKEALNGYVSFEAYTSKIEETIVSPGLGDDAGITGCLLLAERARKKGRSS
>NZ_CP052135.1|WP_170008459.1|2985687_2986680_-|Gfo/Idh/MocA-family-oxidoreductase
MNFGIIGTNWITERFIEAGRTVKDFRVQAVYSRKMERAKEFASQVGAPDAYDSLQEMASSALIDAVYIASPNVFHAEQTIRAMEAGKHVLCEKPACSTVKEWTAMEEAARSNDVVLMEALKSIYLPNFLVLQGQLDRVGQIRRVFASYCQYSSRYDAFKQGTILNAFDPSLSNGALMDLGVYVLHPVIKLFGAPTAIRAQGTMLSNGVDGMGSILLQYEDMEATLMYSKISDSYLPAEIQGEEGTLHVDTIHTPASIQFQARGGQPEDVSVPQTRPPMSYEIEAFFERVASSSPMKRWESLEASRQTMSALEEIRRQIGIRFPADEISGS
>NZ_CP052135.1|WP_170008460.1|2986710_2986899_-|hypothetical-protein
MKISQVMRQRVKDRMYSVDEPDEISLTKEFSFSRMTMKRALDVSIRIVNDEPFVLINLSFPL
>NZ_CP052135.1|WP_170008461.1|2987147_2987687_-|family-1-glycosylhydrolase
MSVFKYPRTGEYIRGQEPISANRGIYPRSGEYIRDQEQISAVRRIYPRTGADIREQGNISAVRSRYPRTGEYIRDQGQISAVRGRYPRTGADIRGQGNISAVRSRYPRTGEYIRGQEPISAVRGRYPRSGDQDNWSWLNAYKNRYGFVSIDLRNGHQASSIKKSGYWFRELSEQNGFID
>NZ_CP052135.1|WP_170008462.1|2988014_2988269_-|hypothetical-protein
MMWKKLISKLYPEVSSVFVTEDAGEMRKAKQILKQNQVPIYKVDIQSPKYMNSSRTKVVHILQVRIEHEKVSQELLREAGFSLK
>NZ_CP052135.1|WP_170008463.1|2988356_2988908_+|short-chain-dehydrogenase
MAHILVVGGTGMLSGVSRLLASDGHTVSVVGRSITKMNSLQSSLPPQVHIHPLLVDYNHVSKFREQIRLAIQLYGPIDCAIVWVHSYAKHTLPVLIEEVAVSSVDWELFHVVGSSTDLPSIKDELPLPTSCSYYQIKLGFIVEEKRSRWLTHAEISSGVLQSIAEKEPSYIVGTVQPWDARPQ
>NZ_CP052135.1|WP_170008464.1|2988932_2989493_-|flavin-reductase-family-protein
MRTFTEKTVMHSYPGMVALVTVSHKGETNIMAAGWHSYISYAPPMYGVAIGRERHTYSLVKEAESFAINFLPFDKAEAIQQSGVSSGRDGNKLERTGLTYDLGRHVKAPILHDAYVAYECKTIDRQSYGDHDWFVAEMVGFYRDEELFLANGLPDPNKLHIPLYLGRSSYARFDDQTVQVQKGIEE
>NZ_CP052135.1|WP_170008832.1|2990583_2992473_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSLVVADGLRKSYGEKVLLDGVVFTVEPRERIGLIGVNGTGKSTLLKVLAGVESTEEGSITHANDFTLTYLRQEPVFSEDRTVLEEVFAGEAQLMRTLLQYEEAQYKLEADPANERLLEQYTRVQQQMDAQQAWDAGTQAKTILTRLGVSDFHKRTSTLSGGQKKRVALAKALIQPADLLLLDEPTNHLDHETIEWLEKHLATYTGSLIMVTHDRYFLNRVTNRIFELDQGQLYTYKGNYELFLEKKAERVAEAQQQEQKLQNTLRRELAWLRRGAKARTTKQKARIGRVESLQEQSTEQVQENLEFAIGSKRLGNDVIEAKGITKAFDGRTVVPQLDYLITKGERLGITGPNGSGKTTLLNMLAGRIEPDAGEVLVGQTVRIGYYTQEHEEMDESLRVIEYITEVAEIVHTVDGQIITAEQMLERFLFPRSHQWTYIHRLSGGERRRLYLLRVLMSEPNVLFLDEPTNDLDTETLSVLEDYLDQFPGVVLTVSHDRYFLDRTVDHLLAFESGEIHRFQGHYTDYLEQRRQQLANAQAQETVQTKTDSRPEKRKKKLSYNEQKEWDGLEDRIEKLEEAIKTLEAEIQAAGSDAGKATELFRKQQEAETELEQAMERWEELSELIESFES
>NZ_CP052135.1|WP_170008465.1|2992533_2992725_-|hypothetical-protein
MIYCIRHGETDWNRTMRIQGASNIPLNSLGRQQAVAVAEIVSLNDCEHLYKPVSVPRPGNTLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP052135_1	1.1\|2983179\|37\|NZ_CP052135\|CRISPRCasFinder	2983179-2983215	37	NZ_CP052135.1	2983263-2983299	2	0.946

1. spacer 1.1|2983179|37|NZ_CP052135|CRISPRCasFinder matches to position: 2983263-2983299, mismatch: 2, identity: 0.946

ttgcagcagttgaccatgttccttcaacgttcgacct	CRISPR spacer
ttgcaacagttgaccgtgttccttcaacgttcgacct	Protospacer
*****.*********.*********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

587947 : 596283

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_170006335.1\|587947_589246_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	3.2e-17	31.6
WP_170006336.1\|589333_590056_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3HI61	Synechococcus_phage	3.2e-46	42.8
WP_170006337.1\|590056_590314_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_170006338.1\|590310_590991_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_170006339.1\|590977_593188_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	5.3e-153	43.5
WP_170006340.1\|593172_594630_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	1.1e-50	32.0
WP_170006341.1\|594593_595649_+	phosphoribosylformylglycinamidine cyclo-ligase	R9TMC7	Synechococcus_phage	3.2e-63	43.6
WP_170008631.1\|595641_596283_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	8.5e-27	41.1

DBSCAN-SWA_2

3106142 : 3148006

Pithovirus(10.0%)

transposase,integrase,protease

attL 3110395:3110416|attR 3156288:3156309

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_170007902.1\|3106142_3107252_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_170008548.1\|3107443_3107659_+	hypothetical protein	NA	NA	NA	NA
WP_170007902.1\|3107809_3108919_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_170008549.1\|3109089_3109353_-	hypothetical protein	NA	NA	NA	NA
WP_170008550.1\|3109581_3110061_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_170008551.1\|3110130_3110310_-	CxxH/CxxC protein	NA	NA	NA	NA
3110395:3110416	attL	NA	NA	NA	NA
WP_170008552.1\|3111081_3112290_-	PDZ domain-containing protein	W5SAB9	Pithovirus	2.7e-10	34.2
WP_170008553.1\|3112619_3113414_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.0e-42	35.7
WP_170008554.1\|3113419_3114220_-	transcriptional regulator	NA	NA	NA	NA
WP_170008555.1\|3114206_3115553_-	hypothetical protein	NA	NA	NA	NA
WP_170008844.1\|3115549_3117382_-	cell wall metabolism sensor histidine kinase WalK	A0A1V0SGX0	Hokovirus	2.4e-26	27.1
WP_170008556.1\|3117391_3118096_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.8e-45	41.8
WP_170008557.1\|3118344_3119805_-	M23 family metallopeptidase	G9BW84	Planktothrix_phage	2.2e-14	37.1
WP_170008558.1\|3120204_3121494_-	adenylosuccinate synthase	G5CQQ4	Megavirus	3.4e-67	35.7
WP_170008559.1\|3121735_3122122_+	VOC family protein	NA	NA	NA	NA
WP_170008560.1\|3122169_3123537_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	2.9e-125	52.8
WP_170008561.1\|3125892_3126879_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_170008562.1\|3126900_3128223_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_170008845.1\|3128329_3129607_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_170008563.1\|3129619_3130441_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_170008564.1\|3130454_3131183_+	trehalose utilization protein ThuA	NA	NA	NA	NA
WP_170008565.1\|3131189_3132215_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_170008566.1\|3132229_3133270_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_170008567.1\|3133282_3134251_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_170008568.1\|3134337_3134784_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_170008569.1\|3134780_3136754_-	DHH family phosphoesterase	NA	NA	NA	NA
WP_170008570.1\|3136774_3137713_-	YybS family protein	NA	NA	NA	NA
WP_170008571.1\|3137876_3138110_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_170008572.1\|3138143_3138677_-	single-stranded DNA-binding protein	A0A290GHL8	Caldibacillus_phage	1.3e-49	57.6
WP_170008573.1\|3138737_3139025_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_170008724.1\|3139486_3139684_-\|transposase	transposase	NA	NA	NA	NA
WP_170007902.1\|3140038_3141148_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_170008574.1\|3141260_3141986_-	hypothetical protein	NA	NA	NA	NA
WP_170008575.1\|3142675_3143776_-	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_170008576.1\|3143964_3144537_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	4.7e-21	36.8
WP_170008577.1\|3144549_3146055_+	potassium/proton antiporter	NA	NA	NA	NA
WP_170008578.1\|3146101_3146299_-	DUF951 domain-containing protein	NA	NA	NA	NA
WP_170008579.1\|3146310_3147213_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_170008580.1\|3147364_3148006_+\|protease	spore protease YyaC	G3M9W0	Bacillus_virus	2.9e-19	37.7
3156288:3156309	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage