CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP051869	Acinetobacter baumannii strain Ab-D10a-a chromosome, complete genome	4 crisprs	RT,csa3,WYL,DEDDh,cas3	1	1	17
NZ_CP051873	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_4, complete sequence	0 crisprs	NA	0	0	0
NZ_CP051874	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_5, complete sequence	0 crisprs	NA	0	0	0
NZ_CP051872	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_3, complete sequence	0 crisprs	NA	0	0	0
NZ_CP051870	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_1, complete sequence	1 crisprs	NA	1	1	0
NZ_CP051871	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence	1 crisprs	NA	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP051869_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051869_1

2031217-2031290

Orphan

Consensus_repeat	Method
CTTAGGATGTCTCCATCACCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051869_1

>merge|NZ_CP051869|1|2031217-2031290|CRISPRCasFinder
CTTAGGATGTCTCCATCACCGCCGATACCACCGATGATTCCAGTAATTGGACTTAGGATATCTCCATCACCGCC

>NZ_CP051869|1|1|2031217-2031290|CRISPRCasFinder
CTTAGGATGTCTCCATCACCGCC	GATACCACCGATGATTCCAGTAATTGGA
CTTAGGATATCTCCATCACCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051869.1\|WP_057048876.1\|2034488_2037860_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_000735351.1\|2022339_2023383_+\|methionine-synthase	unknown	unknown	gnl\|CDD\|181659
NZ_CP051869.1\|WP_000031355.1\|2021331_2022318_+\|DUF1852-domain-containing-protein	unknown	unknown	gnl\|CDD\|370181
NZ_CP051869.1\|WP_057048887.1\|2047305_2049183_-\|DDE-type-integrase/transposase/recombinase	unknown	unknown	gnl\|CDD\|366234
NZ_CP051869.1\|WP_085943420.1\|2019959_2020985_+\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|366126
NZ_CP051869.1\|WP_031999817.1\|2017310_2018678_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|349914
NZ_CP051869.1\|WP_031999819.1\|2025053_2025713_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP051869.1\|WP_057048888.1\|2046371_2047316_-\|TniB-family-NTP-binding-protein	unknown	unknown	gnl\|CDD\|377533
NZ_CP051869.1\|WP_079283091.1\|2030181_2030406_-\|Darcynin-1	unknown	unknown	gnl\|CDD\|293679
NZ_CP051869.1\|WP_032000870.1\|2029401_2029995_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_001136631.1\|2018736_2019744_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890
NZ_CP051869.1\|WP_004710411.1\|2040390_2041167_+\|DUF4145-domain-containing-protein	unknown	unknown	gnl\|CDD\|372658
NZ_CP051869.1\|WP_057048890.1\|2043863_2044166_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775
NZ_CP051869.1\|WP_169031054.1\|2042611_2043760_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_057048889.1\|2044383_2046369_-\|TniQ-family-protein	unknown	unknown	gnl\|CDD\|377670
NZ_CP051869.1\|WP_057048875.1\|2038119_2038680_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_057048698.1\|2025980_2029172_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_000249481.1\|2023568_2024060_+\|flavin-reductase	unknown	unknown	gnl\|CDD\|132654
NZ_CP051869.1\|WP_057048701.1\|2041466_2042015_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_163072036.1\|2038731_2039793_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP051869.1\|WP_000735351.1\|2022339_2023383_+\|methionine-synthase	gnl\|CDD\|181659	PRK09121, PRK09121, methionine synthase.	0
NZ_CP051869.1\|WP_000031355.1\|2021331_2022318_+\|DUF1852-domain-containing-protein	gnl\|CDD\|370181	pfam08908, DUF1852, Domain of unknown function (DUF1852). This family of proteins are functionally uncharacterized.	0
NZ_CP051869.1\|WP_085943420.1\|2019959_2020985_+\|fatty-acid-desaturase	gnl\|CDD\|366126	pfam00487, FA_desaturase, Fatty acid desaturase.	1.37243e-08
NZ_CP051869.1\|WP_031999817.1\|2017310_2018678_+\|amidohydrolase	gnl\|CDD\|349914	cd05664, M20_Acy1-like, M20 Peptidase aminoacylase 1 subfamily. Peptidase M20 family, Uncharacterized subfamily of proteins predicted as putative amidohydrolases or hippurate hydrolases. These are a class of zinc binding homodimeric enzymes involved in the hydrolysis of N-acetylated proteins. N-terminal acetylation of proteins is a widespread and highly conserved process that is involved in the protection and stability of proteins. Several types of aminoacylases can be distinguished on the basis of substrate specificity. Aminoacylase 1 (ACY1) breaks down cytosolic aliphatic N-acyl-alpha-amino acids (except L-aspartate), especially N-acetyl-methionine and acetyl-glutamate into L-amino acids and an acyl group. However, ACY1 can also catalyze the reverse reaction, the synthesis of acetylated amino acids. ACY1 may also play a role in xenobiotic bioactivation as well as in the inter-organ processing of amino acid-conjugated xenobiotic derivatives (S-substituted-N-acetyl-L-cysteine).	0
NZ_CP051869.1\|WP_031999819.1\|2025053_2025713_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.137e-11
NZ_CP051869.1\|WP_057048888.1\|2046371_2047316_-\|TniB-family-NTP-binding-protein	gnl\|CDD\|377533	pfam05621, TniB, Bacterial TniB protein. This family consists of several bacterial TniB NTP-binding proteins. TniB is a probable ATP-binding protein which is involved in Tn5053 mercury resistance transposition.	1.22086e-16
NZ_CP051869.1\|WP_079283091.1\|2030181_2030406_-\|Darcynin-1	gnl\|CDD\|293679	pfam17074, Darcynin, Darcynin, domain of unknown function. Darcynin is a bacterial protein family. Its function is unknown.	5.93158e-07
NZ_CP051869.1\|WP_057048889.1\|2044383_2046369_-\|TniQ-family-protein	gnl\|CDD\|377670	pfam06527, TniQ, TniQ. This family consists of several bacterial TniQ proteins. TniQ along with TniA and B is involved in the transposition of the mercury-resistance transposon Tn5053 which carries the mer operon. It has been suggested that the tni genes are involved in the dissemination of integrons.	5.77504e-14
NZ_CP051869.1\|WP_057048887.1\|2047305_2049183_-\|DDE-type-integrase/transposase/recombinase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	5.84739e-15
NZ_CP051869.1\|WP_057048890.1\|2043863_2044166_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	8.61126e-09
NZ_CP051869.1\|WP_001136631.1\|2018736_2019744_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	3.83108e-37
NZ_CP051869.1\|WP_004710411.1\|2040390_2041167_+\|DUF4145-domain-containing-protein	gnl\|CDD\|372658	pfam13643, DUF4145, Domain of unknown function (DUF4145). This domain is found in a variety of restriction endonuclease enzymes. The exact function of this domain is uncertain.	2.35561e-11
NZ_CP051869.1\|WP_000249481.1\|2023568_2024060_+\|flavin-reductase	gnl\|CDD\|132654	TIGR03615, flavoprotein_oxidoreductase, pyrimidine utilization flavin reductase protein F. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the flavin reductase family defined by pfam01613. Presumably, this protein recycles the flavin of the RutA luciferase-like oxidoreductase.	1.2694e-70

>NZ_CP051869.1|WP_079283091.1|2030181_2030406_-|Darcynin-1
MFEKCPTAKVRWYDVEAFSTKASGIAMFETISLQDYYFVIDAIRDSEFCTVPYFEFVEIIPAIEDGYVEYESSL
>NZ_CP051869.1|WP_032000870.1|2029401_2029995_+|hypothetical-protein
MGLFEIGFVVWVYSFFKKYINFKYVKFFWFFFHLAVLWLAAVYASKIVSKGLELPSSDYSYTVSFFTFFCYLPAFLYIATAIGLLFYIVFIFAYSILSIFKREILSDGFPILHFVGFVITIFLFSLGHDKLMSFYYYKAPKYVRTIAYETDYQYIPKYLDNFPEMNKQVKIKLHENGVYSILTKKENEYILEVGKFK
>NZ_CP051869.1|WP_057048698.1|2025980_2029172_+|hypothetical-protein
MDNLSAKDFLKNRRPEEFSSSTIVEVGTLDRVQLEYYLSTLNIRSQELEFETFAKKLCEKVVCPNLLEQTGPVAGGDGKTDTQTFPVSSQNQLLWLEGVNEQSHNERWAFAVSTQKDWKTKCKKDVKKIVETGRGYVKVFCITNQSIKADQRSKLEDELTKQYSIDVRILDLSWILDQIYKNQLEFLAINTLSIPTLYKREIELSADDYQKQKELDRLNKLITEKIDASRITTQQVDYFLEVAILSKELEKPIIDTQSLFDRAIRVAKKFGTSQQLLEASYQYAWAAHWWFEDYSLFESNLELTFENLAENTNSESWEKIVNLLTIYYGRYRYLKDIHPSVDIDHIYNNTIDVLDRLSKDLSRPSNSLMASIHLDLLQLIVKFPDEKYCIELLKKTLETCRLGSNLIGFPFEKFYNLFQELDIIFDKYEEYEELLDYFTEQSGLRDSEIKTAKLQLERGLKRLADNKPYQAIKLLGKSVSGLNKKETYDEMTYANLLLSEAYSRVGLRWASRGSLLFSASLLANYFHKEKLILPSAIRVYWQLAWKELELGRIPQSLRWAELALLSLNAIKDDYIDEEELIRFDGCLAHLLLNCRFDQLAELEYLPDFLEKLQLFFSNSALIYILGYEDKLKEEFQQTSLDEFVKTLFLCRDTDTRHPTSQILPTLGKSITYTTRVSGCEFKIQFPNRSPYIELSESILTTIENFFSTNPIDKVFTKISSLEINIIGDDDENSTISHEFSKSSKGIYVDIFCSNFTWEHLDQNSQKIVFEWFVQFVIECLIKVYHVLDIDKFVEASFITDLSITRSIAFSTCFGATYNVMGRDSHKNVLDILNGNKGTKFELIRKLSWDQGSPKVLQNKTEKIQMGDHKKTPDFGNLESISHDQIAVTTLIKPELWDEAAWHGLAFMFFENKPPVILLIFKKEGGEDVFMDLYENLGQVDSLERLRFSIIRGVSKEEPYNYRVLLTENIMANDQHKLITMCSRIHEMTPPTDRNWSNFEKEYKKYGSYSLSFGTFFNGQFYPYPEFEKYLIKKKELVIKNAWEVGINDIEKIVLRAEDDPIVP
>NZ_CP051869.1|WP_031999819.1|2025053_2025713_+|TetR/AcrR-family-transcriptional-regulator
MCQAPSYGFAVPFFSQKGTGFLSHLETTRIYNGKTMPTLEISSRKLQVIQTAIQLFTTYGFHNAGVDLIVEKAQITKTTFYKYFGSKERLIEMCIAFQKSLLREEVLSIIYSSRYYTQKDKIKEIIILHTNLNSLYHLLLKAVFEIKRLYPQAYRMAVEYRKWLHRELFDLIFSCETRAFKFDADMVLNLIDGLLLQVLSSNSLDERDVVLERFWGRGK
>NZ_CP051869.1|WP_000249481.1|2023568_2024060_+|flavin-reductase
MVQATDFRNAMSLLTSAVSVVTTAGMSGRFGFTASAVCSVTDTPPTLLVCMNQAASSHAHFLDNKILTVNVLGAHHEHISKAFSSKLTPEERFKHGEWIELETGAPVLEDALVSFDCEIEQIQQVGTHTIFICPIVAIKQSQHDQSLVYFNRAYHQVGQTEIV
>NZ_CP051869.1|WP_000735351.1|2022339_2023383_+|methionine-synthase
MKKLLPTSTAGSLPKPSWLAEPEKLWSPWKLENEGLIEGKKDALRLALHEQKLAGIDIVSDGEQTRQHFVTTFIEHLNGVDFEKRETVRIRDRYDASVPSVVGAVSRQKPVFVEDAKFLRQQTDQPIKWALPGPMTMIDTLYDGHYKSREKLAWEFAKILNQEAKELEAAGVDIIQFDEPAFNVFFDEVNDWGIATLERAIEGLKCETAVHICYGYGIKANTDWKKTLGSEWRQYEEAFPKLQTSNIDIISLECHNSRVPIDLLELIRGKKVMVGAIDVATNQIETPEEVANTLRKALQFVDSDKLYPCTNCGMAPLSREVARGKLNALSAGAEIVRRELTGYDLTA
>NZ_CP051869.1|WP_000031355.1|2021331_2022318_+|DUF1852-domain-containing-protein
MSKEFTFTIKSICFDENYRPADNTRITTNFANLARGMSREENLRNTLRMIDNRFNALAHWDNPKGDRYGVELEIISVEMNIDAENRTSGLPLIEILKTNIVDKKTNERIEGIVGNNFSSYVRDYDFSVLLLDHNKNKSTFSTPEKFGELHGNLFKSFINSETYKANFKKAPVICLSVSTSKVYHRTENEHPVLGVEYKQEDYSLTDEYFQKMGLKVRYFMPPHSVAPLAFYFTGDLLSDYTNLELISTISTMETFQKIYRPEIYNANSVAGKSYQPSLKHQDYSLTRIVYDREERSRLAIEQGKFVEEQFIKPYQAILEQWSANYAPN
>NZ_CP051869.1|WP_085943420.1|2019959_2020985_+|fatty-acid-desaturase
MTDSEKTEHIKKVVTAEGVALRKRHPILNHQNAIGAMILFISLVGMIATALLYINHQLSAWFAIPIIAFFASLTHELEHDLIHWMYFRKKPWAHHLMMGLVWLARPSTINPWKRRELHFNHHKNSGTEVDLEERALTNGEQWSIRRLIAIGDNGLAVLFRIISASNWTVRKVIFKRAFMAYFPLGIIHWSLWYIFLGFHAVDAVLSWANAPIAWSATTLNIMHVVNILTVVWVAPNVLRTFCLHFVTSNMHYYGDVELGNVIQQTQVLKPWWMMPFQLFCFNFGSTHAIHHFVVKEPFYIRQMTAPVAHKVMRDMGVRFNDVGTFKRANRWNINNLSESKS
>NZ_CP051869.1|WP_001136631.1|2018736_2019744_-|AraC-family-transcriptional-regulator
MPQTATALASWVKAIQKALEKAGVDSQPLLEQAGLDIQALSNPDARYSLKQTANLWKLAVQKTQDSCFGLKVASQVNQNTFHVLGHSLITSTTLKEMFLRIIRYFRVVTDIPELEFYGQGNNHYFVIHVPDEVQPESIDAFISVFIRSSRALQGSVFSPLRIELRRSEPEDLETFQSILKAPIVFNAPKDMIVFDTATIEQPLEGANPTLTQEYDEIINRYLARFDKENILARVKVKLIEKLSTGDFQQQDVAKSLGLSIRSLQRKLSAENTSYSELLDQTRHELALSYIKNSSHNITEIAYILGFTDVSSFTRAFRRWTDLSPIHYREKYLACS
>NZ_CP051869.1|WP_031999817.1|2017310_2018678_+|amidohydrolase
MNKIIKNGMFLGLSTLISGYGTLLHAEASPTNLPAVSQKALTIIDGQTEWLNKVYKDIHEHPELGFMEKRTSAIVAKELKSLGFDVKTGIAKTGVVGILKNGEGPTVMYRADMDANTVEEATGLPYASKVRVKLDDGTETPVAHMCGHDAHVTWMLSMAKTLVALKKEWSGTIILVAQPAEEPITGAKAMVTDGLWTKYNLPKPDYFFAVHTTPAPVGVVINAPGPRMAGTDQLDVLFKGVGGHGSLPMLTKNPISMAANALNQYQTIMGNAVDPQQAAVLSIGSIQAGNSNNVIPSTALVKMNLRWFDPKVRETMLNNIKSMSEGAAQMQGMGKDQMPTFTFKGSSTPVINNKEFSARLNGPLKALLGDKHVLTEYPAVMGSEDVHHLLGEQKDIPFNFMFIGVADPVVFANAVKQGKPVPYIPHSPNYIVDLKALPVGAKVTTVSMLELLTKK
>NZ_CP051869.1|WP_057048876.1|2034488_2037860_-|hypothetical-protein
MHQHAQEKLKSPTLDDLINDSRLERLFSKNVKPCVLQLWVLQIKCGQLSENRIVYGRLLPYSHCNNTWNFSHNNKFITINSQTKARVAKLTLYLQSIHCADLLRLLNDRQTITLISKELRFTIPERLEEEFGKTSLSPTDLAYRPVAYLINRDAYHHSLSSPHEGAGAFSASITQTDKDALFQLGSLYSPTLTKMVVKTLNEDTGMDFSLTDTSRFGDIELLVFPTLDDQERNLLEINWINSPHTLIARFNPSQVPYYNSFQFRLNVENNSQITYSVLALAEKNEDGLFECRFELDDQISACIDSTELEIFGFRDSAYKQGTLCSRWQISYIREMHFQSHVVGHGIGRSFKFDWLEKTAQPADKLRVEAALTINNNNQGFAGHVGGREVDSWVPANREIATLFKRLHPQKSNGLFCPRWSQGNDNGRLQLVEWFKALLTQYQQHQIVIFDPYFEDAGLGLLLLYSVQKSDYIVFRSLPKTPPKDKPQRRQSDNTAQNGINNLLANCEQSHHKLRNLKLRIYGLKEGRLHDRYIIIMGRDGLPITGFHLSNSFQRAAENHPLLITPIPSDTLLEVEEYVLSLIQEAKVSQNQENIENTNIRLLFDSTALPPSTPKRYEPLLFLNKPFAGEVLSLWCSEPTLHGLKSNVLKEQMTTIGLLEGESLNLSTRVTNFHNFLDQQADNFNNFGPIWEILGDILAHSHTNDYYMEELESENNFLKFLAHFLKLSFNREYTEIDKNLTVVESQFFTRTIEELLYSSYQPHHLFHTTKYSALTWSEYFAIKFLWQFNPDVLLEIAEKQILNIPIDSQSSKIIRLSLLSQIVSEISLSVQIRITEIQLERLLSSSSTLLYWMGLHAIQIQLEKPNGLSKAISLITNFTTANQIQALGWMINHAAKKSDNTETYKGLIIALHKILPSKISKDELKSLIDSMRGHMKKLAWAEPWLFNDIIFPLLENDRINVDNACEIWTQELISMLEPEGPNTSLLFDQAREGQTTNICAFLMAHSSPEQQQSSLQLINKILHQQKRIIQQPLASTSNWSRWDKALKISLWILAFCKWCEYYLSKSHLKNNELDKLSEDALKLAEAKPIKEWRTETSDQSSGVIAFLNQGESLLASIDETENIS
>NZ_CP051869.1|WP_057048875.1|2038119_2038680_-|hypothetical-protein
MIKDLHFSFPGFSATTGYCHLRVAMKSTESKMVIVCSQYKNYYGTSVTNAVETIAEKFFYDVANKNIVNIEIPNLSEYKIFSNDRNLLTRFLIKLKLLNDKSQLKNIYLNIPELFNNILWIERYPLDTGLREFEDDCRLVKMDEQFNPQWCQKISDEFVKQETGFSLSELLIDNEKLDLKNLQNFK
>NZ_CP051869.1|WP_163072036.1|2038731_2039793_-|hypothetical-protein
MIADAWKSIVRFYRNEQKNESSYDLSDPLTVRLPLNLLEEVTNQSKAIGGDRYRSKHLVNLIDLGAKFYRINSDFISTLPIEHINLITRLHYVFNELKLQTEKVAFELGHDNTLKVSSWLNGSQIPSFEDLNRFSDIYFINSDWIKFGNSSPYMPELTPFLIERKSFHYWTESLQDILQEYKGHQPHSIKLIRGEEGSLLVSIGYGSNRNDWKVRSIYYSNLKLQSMDDIGNSGFHYLVELAILCMVFYKYIRKPSLIISYNIKKDEINALIEGEKLPIHFNIWGQTKANFWYESIFDKTDTNNHNDSSYWIGATELFNAIQDSPKFKKYYEDLQNEPLEQIGKILNKSPYSL
>NZ_CP051869.1|WP_004710411.1|2040390_2041167_+|DUF4145-domain-containing-protein
MDRQLFKRPFKKTDDVIFPCPACGNHSLKLDETKFHSEDTAQSKKIQESDYWEPEWLTSVFTTVFACNNSNCGETVICSGTGYVDWEPEENEHGEFEQEYYCFHTPKIFIPAIHFFKIPEKCPDSVKNSLLEAFSLTLYSPSSAANKVRAAVENLLTEFGIPRITRKPGKNIRLPLDARIAKAKHHKAILGELENILYALKWLGNAGSHANSEISVDDVFDSYEFMNHILNEIYQPKQKLEKLAKEIRKRKGPVKSKS
>NZ_CP051869.1|WP_057048701.1|2041466_2042015_-|hypothetical-protein
MKWSNLQNNFWNIVVHLFAIIGATYFWTTEIGNNLIEIIERNNPPPKGLSGTSALDGWFEGAFTANTPVLVTFVFYFAIFLLIAAFVKRKRIDVKENSKTASIIRSIANLASNILSLILIFSCISISLASIAFSYGAFTNTNIVVFIGGWLFLIIYFFLACFHRFVLDDLESYINSKQRIGR
>NZ_CP051869.1|WP_169031054.1|2042611_2043760_+|hypothetical-protein
MMEKINKYKTDDGDKLKLCFDETHAIVDGIAFSLVGMPLLWDSKNKIFYKTQFTDVFLNILAERAKKLGETQVTGVTPPDTIKNKRYGNFCESINFEYSNIEYLSVPGLAHSMSNDGFLMPIYFNLEVLNKYSQNPKYKLNVLSSTYGDLRCGDEWHLSFGVNSNKQVIMWLGDIHTLPIKEQQYLLSENIPSSFDLHSDFYDAQIDCEWSQGSIESQCLSLRTELSDKIKKKYQGDLYKLPNEIGKTITDLQKPIFWEERHVVPIVESLNRIFVESIDESFLKSFLISQNVELPSGIRALKLMGKFITFLSNSNKSDEIMLPFFVLYDYRVNVCHLQSEATITTKIQSINERLDLAISNTSHEKIYDKLFEKIYDSLNAFK
>NZ_CP051869.1|WP_057048890.1|2043863_2044166_-|helix-turn-helix-transcriptional-regulator
MAKTLQELLASRSPESQTRIKQMADELLIKNQLYLIREELEISQKELAETLGIKQSSLSAIENHGNDLKISTIKKYVEAMGGKLRIDIELPTGKHIGFNV
>NZ_CP051869.1|WP_057048889.1|2044383_2046369_-|TniQ-family-protein
MNNNENLLIQPIPYEGESAASYLLRAAQLNMHSSVYNLFGKAHFKFLVKQAPNCDITDLPRFQYALQLLNINTAYKWLAFEKISLTGRSARMWGNIEINNKLLKSSPQSYCPLCLEEQPFFRKIWLLKPIYACPIHSIFLIDHCPQCKSPIDLKSGTILTCASCTYQLKDSPVIECSSIPYIQWFIDILNTGSNDIFKHFTAFWSALNKFSQLDMKDPLTIEKQLEITYEYFHDQRQSSIRFSAWINSRIHLAHPRIQLLPFLEHKRIFNNYIQLIESGCYQYYPTPKTQLIYLLPEEVRLVLDICRKTLKNWIRKDFLKLDKERYHYHSLPSPLIERFLLSYNYEHSDSIETLQTKTSAPQHLTLKEVAKILETNYETARKLANTHWLKYQICPKNKVTKNISRFQVEKFHRHYITASTLAKRFNVNPTNLVEKLASIGIMPISGPYIDATPINIYARSFINNLKRSDIEAIKKYPTNTGRYNNSQKPPTISKDFVSLAKVAEQLEITPHKVAILAQRGILRKDLTNPFLIMIEKKSLRNLKDKLESQEFISAKDAARQLNCAPTWLNKYWCKSGFLRIENLVYWKLVRQEDVYTVLQIKETYITGAEANKLLGMHHSYITNLQAQGLINAYYMGKTDKKIRLFKREDVLKLKSLNLIES
>NZ_CP051869.1|WP_057048888.1|2046371_2047316_-|TniB-family-NTP-binding-protein
MENNNNFESVSYLKDLVITSDEFMNAYIGIQQCAERSIAYNEPIGSMLLSEGGLGKTTLCRAVIAQMPNSVKIEYDRKKSIIPAFYVEVPSPATVKSLAITMLNKLGDPSYNTGTTKYLTSRLTYLLIQCETKLVFLDEFHHLFDRKLNSTRMNITVGNWIKTLVNETGISFCLVGLPQFAELIQIDTQIARRFPFHYKLSPLTLGTKDTYGTIYLFLHEIANKVFEHNTSFSPELDSYLLGMQIYAATKGNHYYVMSLIRESIVIALDDGRSIVTQNDFSHAWALGITLFISDFKQDPFVMNLAQLISGIKGV
>NZ_CP051869.1|WP_057048887.1|2047305_2049183_-|DDE-type-integrase/transposase/recombinase
MPSSLFIPQPGFRFTFSNQEDYVFEITNVTYGQIRYAAVIGGKSFTLSSEAFEQYYTNDEIKCIFAPEKLIINPEKCSEIQRKERYVISALYKLYEPTALIPLKKLIAEIATELGDQIPPSPRTVARWINKYRSSCHNNLSLSNSYKGNQSLRFPPEIYQIMSQGINEIYLKPEYRTSKDVQAYILGKLIEQSISTKYLPSRRTIQRYIEKLDPYLVTKIKKGSRIARKAFQASGKGSPSPFALYMVEIDTHYLDIIVIDPLTHQVLGRPYLACAIDVYSRAIVGTYISMFPPSAMTTLAVIKDMITRPNNGLPGGIASIIIPDNGIEFKNNSLARVCEQLKITLTPSQIGTPNNKPHIERFFSTLTKGIIQKLSGTTFSNPIERGLYNSGKNAGYSLLQVKEYVNEWINGTYQQSIHSQTGRTPILMWNDAIEQVKPSFLIESDAQIICRRPIERTINHGQVQIDGLAYYSHALKVLEAKRIKKVTVLVDDLDLNIVYILSPNDKQVVIQADSTNPEYTQNLSRIVHLEVQGRKKLMADSDRQRLGQFADLYNLYRLMQDIQIDLIRRKPKLRRIKIDIPKQMQQLEEKLGLNTPLNQIDHKIHKDHIVPPTKFGSMEVKKDGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051869_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051869_2

2890285-2890382

Orphan

Consensus_repeat	Method
CATGAATTTACTTCAGAAGAAGCTCGTGAAGCTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051869_2

>merge|NZ_CP051869|2|2890285-2890382|CRISPRCasFinder
CATGAATTTACTTCAGAAGAAGCTCGTGAAGCTGGCCGTGCTGCACATGCCAGTGGTAACGCACATGAATTTACCTCAGAAGAAGCTCGTGAAGCTGG

>NZ_CP051869|2|2|2890285-2890382|CRISPRCasFinder
CATGAATTTACTTCAGAAGAAGCTCGTGAAGCTGG	CCGTGCTGCACATGCCAGTGGTAACGCA
CATGAATTTACCTCAGAAGAAGCTCGTGAAGCTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051869.1\|WP_000795915.1\|2891445_2891682_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_000132045.1\|2882847_2883165_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_001124839.1\|2891964_2892576_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	unknown	unknown	gnl\|CDD\|182350
NZ_CP051869.1\|WP_096640910.1\|2893937_2895584_-\|allantoin-permease	unknown	unknown	gnl\|CDD\|224374
NZ_CP051869.1\|WP_000251635.1\|2881612_2881756_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_032000867.1\|2883773_2884253_-\|CinA-family-protein	unknown	unknown	gnl\|CDD\|224463
NZ_CP051869.1\|WP_000108361.1\|2883270_2883489_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237171
NZ_CP051869.1\|WP_001025680.1\|2900312_2900597_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|379642
NZ_CP051869.1\|WP_000983534.1\|2889251_2889665_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_000937468.1\|2900905_2901541_+\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP051869.1\|WP_000885235.1\|2892648_2893260_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP051869.1\|WP_169031072.1\|2895749_2899214_+\|response-regulator	unknown	unknown	gnl\|CDD\|274362
NZ_CP051869.1\|WP_057048702.1\|2893416_2893872_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|214628
NZ_CP051869.1\|WP_000432325.1\|2888231_2889110_-\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|187613
NZ_CP051869.1\|WP_085941183.1\|2886032_2888177_+\|catalase-HPII	unknown	unknown	gnl\|CDD\|236886
NZ_CP051869.1\|WP_104039585.1\|2900664_2900817_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_000498474.1\|2882541_2882763_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_031993588.1\|2899210_2900170_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|381147
NZ_CP051869.1\|WP_001136759.1\|2882025_2882454_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_001145672.1\|2884568_2885978_+\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634

Protein	Function_ID	Function_description	E-value
NZ_CP051869.1\|WP_001124839.1\|2891964_2892576_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	6.03039e-39
NZ_CP051869.1\|WP_032000867.1\|2883773_2884253_-\|CinA-family-protein	gnl\|CDD\|224463	COG1546, CinA, Uncharacterized protein (competence- and mitomycin-induced) [General function prediction only].	2.73731e-21
NZ_CP051869.1\|WP_000432325.1\|2888231_2889110_-\|glucose-1-dehydrogenase	gnl\|CDD\|187613	cd05355, SDR_c1, classical (c) SDR, subgroup 1. These proteins are members of the classical SDR family, with a canonical active site tetrad and a typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	5.33703e-161
NZ_CP051869.1\|WP_000108361.1\|2883270_2883489_-\|hypothetical-protein	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	8.56431e-06
NZ_CP051869.1\|WP_085941183.1\|2886032_2888177_+\|catalase-HPII	gnl\|CDD\|236886	PRK11249, katE, hydroperoxidase II; Provisional.	0
NZ_CP051869.1\|WP_000885235.1\|2892648_2893260_-\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	5.28002e-23
NZ_CP051869.1\|WP_169031072.1\|2895749_2899214_+\|response-regulator	gnl\|CDD\|274362	TIGR02956, sensor_protein_TorS, TMAO reductase sytem sensor TorS. This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems].	2.82636e-58
NZ_CP051869.1\|WP_057048702.1\|2893416_2893872_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|214628	smart00344, HTH_ASNC, helix_turn_helix ASNC type. AsnC: an autogenously regulated activator of asparagine synthetase A transcription in Escherichia coli).	2.39821e-39
NZ_CP051869.1\|WP_000937468.1\|2900905_2901541_+\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	4.89841e-64
NZ_CP051869.1\|WP_096640910.1\|2893937_2895584_-\|allantoin-permease	gnl\|CDD\|224374	COG1457, CodB, Purine-cytosine permease and related proteins [Nucleotide transport and metabolism].	9.32295e-23
NZ_CP051869.1\|WP_031993588.1\|2899210_2900170_+\|response-regulator-transcription-factor	gnl\|CDD\|381147	cd19920, REC_PA4781-like, phosphoacceptor receiver (REC) domain of cyclic di-GMP phosphodiesterase PA4781 and similar domains. Pseudomonas aeruginosa cyclic di-GMP phosphodiesterase PA4781 contains an N-terminal REC domain and a C-terminal catalytic HD-GYP domain, characteristics of RpfG family response regulators. PA4781 is involved in cyclic di-3',5'-GMP (c-di-GMP) hydrolysis/degradation in a two-step reaction via the linear intermediate pGpG to produce GMP. Its unphosphorylated REC domain prevents accessibility of c-di-GMP to the active site. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	5.28061e-55
NZ_CP051869.1\|WP_001025680.1\|2900312_2900597_+\|N-acetyltransferase	gnl\|CDD\|379642	pfam14542, Acetyltransf_CG, GCN5-related N-acetyl-transferase. This family of GCN5-related N-acetyl-transferases bind both CoA and acetyl-CoA. They are characterized by highly conserved glycine, a cysteine residue in the acetyl-CoA binding site near the acetyl group, their small size compared with other GNATs and a lack of of an obvious substrate-binding site. It is proposed that they transfer an acetyl group from acetyl-CoA to one or more unidentified aliphatic amines via an acetyl (cysteine) enzyme intermediate. The substrate might be another macromolecule.	1.0722e-24
NZ_CP051869.1\|WP_001145672.1\|2884568_2885978_+\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	1.79532e-18

>NZ_CP051869.1|WP_000983534.1|2889251_2889665_-|hypothetical-protein
MMQPIHTHSTLQYIHISVPEILLSNIQIKNSWQDYNQEWSYRLDPPHASHPFQRDLHIIKSKNIETEDIKKLLDNTVVKNSKNKDDLKNIVEAETVIKEILDLSNYIPIENWLNDTGNRSIVESMIDKNKVKLLDII
>NZ_CP051869.1|WP_000432325.1|2888231_2889110_-|glucose-1-dehydrogenase
MENTTNQYPSEVPAQVQPHQPGDQEKMHPEPEIIKASHKGSEKLKGKVAVISGGDSGIGRSVAVLFAREGADIAVLYLEEDQDAEITKQLIEKEGQQCLLLKGDISDPDLAKQNIDKVLQHFGKINILVNNAGVQYQQKEIESISNEQLEKTFKTNIFAMFYLTKEAIPYMEEGDSIINTTSITSYQGHDELIDYASTKGAITSFTRSLSNNLMKQKKGIRVNGVAPGPIWTPLIPSSFDAETVEKFGKDTPMGRMGQPSEVAPAYLFLASDDASYITGQVIHVNGGQIVNG
>NZ_CP051869.1|WP_085941183.1|2886032_2888177_+|catalase-HPII
MDMNDNTKSTNKTSEMAGADAANKANTTQKTEQLDTVRDDATNEALTTNQGVKIADNQNSLRAGIRGSTLLEDFILREKITHFDHERIPERIVHARGVGAHGYFQAYEGNERLTKAGFLTDPTIQTPIFVRFSTVQGPRGSADTVRDIRGFAIKFYTQEGNFDLVGNNAPVFFVQDGIKFPDFVHAVKPEPDTEIPTGATAHDTFWDFVSLVPESAHAVIWAMSDRAIPRNLRSIQGFGVHTFRLINAEGKSHFVKFHWTPKQGLSALVWDEAQKLAGKDPDFHRRDLYEAIEQGFYPEWELGVQIVEEEDEMNFDFDLLDPTKIIPEELVPVTPIGRFVLNRNVDNFFAETEQVAFCPGHVVPGIDFTDDPLLQARLFSYTDTQLSRLGGPNFHQIPINKPVCPFHNNQRDGIHQHTIHKGQAAYQPNSIDGNWPVETPPAASNGGFESYPEKISGHKLRQRSETFSDYFSQPRLYYKSLAPHEQKHVVDAYTFELSKVQRKHIRERQVQQILANIDLDLARQVGANLGIEVPDLTLNYKKTAVEKSAKLSFLAFPPEDIQGRKVAVLIHNLVKSDALEAIKNWAIKEGVILHLLAPSLAPVKDHKDNVIVADGMQMSEPSIAYDAVIIPDGDNLNTVMQDGVARHYLLEAYKHLKPIVFLGNKSDLLEPLGLVADEGTLIEDEFQHVAEKFKNLIKAHRVWSREQIAAHVPA
>NZ_CP051869.1|WP_001145672.1|2884568_2885978_+|iron-containing-redox-enzyme-family-protein
MPVVVKKRLLDLLQDNQQNYYELFVFFLDPDVSSFEKEKKARDFLAKEIDKLEMKEIDFPSDINLIKAWCENDNKKNCQEFQAYLNRRQSGQDREYFKNVAQAFEFLIKVSPTKKVDGAWLYSSVHYWNDPIFHELIITYLEELGLGEPKANHVCIYDDLLRSLGLDSFDLLLEDEYYHQAVVQLALGYAPPEFIPEIVGFNLGYEQLPLHLLISNYELAELGIDSKYFNLHITIDNIDNGHAYKAIKVIEDIYNKYRDKELFLTKLKHGFALNNHGVSSSNIIKNLNTEDFVHRIFKRKALVGQLIHNETRQFGCKTINQWLSNPDDIAGLITHLTDHKWIKFNTDPEQSVFWRMINEENGKMFGVFNPVERQIIHDWIAGSDHSSNFLAYSRELKNSQRIQDYLFSYISDGELDALQERVQQSNDLAIKICKLTPFLAPDSHHKSIGLWSTRKYVELLFPYLGTFKN
>NZ_CP051869.1|WP_032000867.1|2883773_2884253_-|CinA-family-protein
MFNKCCELLAKEKIKIAFFESASAGYLAYRFSLSPYSGNILIGSLVSYDLRVKENTLHISEELIEKYTAESMQVTVEMINKGKELLHADLYVACTGLLKKGGSETPEKPVGTFFYSIYYKNNFYNFRRVLKGPAFLKLRKLIYYVTQDIKLIILEDKRR
>NZ_CP051869.1|WP_000108361.1|2883270_2883489_-|hypothetical-protein
MSTTNNQANQRNNQQQQQQNDNRNQQQHGNQQQNDQQQQNNQQQQQNDNRGQQQGSNQKDSGQQNSNNNQQR
>NZ_CP051869.1|WP_000132045.1|2882847_2883165_-|hypothetical-protein
MTDQNTDHAQLVAGDHNYSDSRWRESYLTRPYYQEAQLTTPDLDYDRDFSAAYELGHRARSESKEGTQFEDMEGSLQQKWEELKAESRLKWEHAKQAIKDAWDDM
>NZ_CP051869.1|WP_000498474.1|2882541_2882763_+|hypothetical-protein
MFVYFTDGTCINDSEIYGVKAKYEQNKYVVEVTIKPTHVLATTPSVQFKKEIFDDPILANQYLSHNFNMPPFF
>NZ_CP051869.1|WP_001136759.1|2882025_2882454_+|hypothetical-protein
MPQYLKIAEKIYQNVKEKKGFTDDPMEDLNNLMIELRQEIKGTKLKLLYNYIDFAEILIKPLQESKIKLDLSLIPKSKNTQEFVLWLAGFIERITTGGQEKLPPIRAKITLPAYAYEETYPSQKKPVNNGEEIIEYFKKNQS
>NZ_CP051869.1|WP_000251635.1|2881612_2881756_+|hypothetical-protein
MVRIFCAVSMVLAIAMGMSACQDRNSKNDGMHEASDPATSHDMNKNS
>NZ_CP051869.1|WP_000795915.1|2891445_2891682_-|hypothetical-protein
MKNQRDAVLGYADEQHAYYIRLIENDAVLGESYGIFCENPESEAAESIMTTLFLKKSFWLNGSEFTDIVKGLHPLTHS
>NZ_CP051869.1|WP_001124839.1|2891964_2892576_+|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit
MPKKKEFEHGGARENAGRKAQFNEPTKVIRVPESQVNFIKNWLLNNVKTDNQTDFTSKLKIQQVHPNNDKIYHIPLATERVAAGFPSPAQDDIEQALDLNEYLIRNENATFIVKANSLSMLDAGIDIDDPLIVDRSIPAKSGDIVIALIDNDFTVKRLMIDTQFQPPKVWLKAENPDYQNIYIEEGQELVIWGVVTYNLKRMR
>NZ_CP051869.1|WP_000885235.1|2892648_2893260_-|LysE-family-translocator
MAFNIFIAFWSVSILFIITPGADWAYAISAGIKGKVVVPAVAGMLFGHFITILLVAAGVGLLVANNPTALMILTVAGSAYLLWMGINLLLTPPTPNQSGSEKAQSWLRWATKGVYVSGLNPKVFLLFLALLPQFIDTTASWSVTTQILAFGVVHIISCAIIYLMVGYGSEAILKTRPQAAQLVGRFSGGLMVVIATCLLIGQI
>NZ_CP051869.1|WP_057048702.1|2893416_2893872_+|Lrp/AsnC-family-transcriptional-regulator
MDRIDKKILAELQLNGRLSITELAEKVGLSISPCHRRVKALEESGAIKGYRAELDPNLVGFEFSAIVFITLKEGDKQAVEKFENAVIEIPQIIQAQRLFGEPDYLLHVVAKDLPAFQRLYDEKLSAIPSVQRLISTIVMKDAVPERLFPIS
>NZ_CP051869.1|WP_096640910.1|2893937_2895584_-|allantoin-permease
MTENDWEIDVMSVSEHPNLDTVQGADSQKAVNETLEDYTLRYAPHSFRRWSPKVVAITALGGIAYLADFSIGASIGMSYGTTNAIFSILFAAIIIFLTGIPLAYYAARYNIDLDLITRGAGFGYIGSVLTSIIFASFTFIFFALEGSIMAQGLLLGLGIPLWAGYLISTVMVIPLVIYGMKALSKLQVWTTPLWLVLMIGPVAYLIYQEPALVSQFATFTGHEGFAPVDMAAIMLGAGICLSLIMQIGEQIDYLRFMPAKTKENSKAWWAAVISAGPGWVILGAIKQIIGAFLGFYLLTKIPGVNSTEPVQQFNAAFHDMLPGWAALTLAVILVVISQIKINVTNAYSGSLAWTSAYTRISKHYPGRIVFVIVNLAIALALMEGNMFAVLGKILGFYSNFAIAWVVVVATDISINKYVLKLSPKEPEYRRDMLYNVNPVGMVAFLVSAGLSIAAFFGLLGSFLAPYSPIIALVLAFVLTPIMGLLTKGKYYIKSHDDGVKEPRYDAEGTPVATVYHCRVCEQGYERPDIMFSHKHNGTICSLCKTLDA
>NZ_CP051869.1|WP_169031072.1|2895749_2899214_+|response-regulator
MSVMPDSSRPQQAPQRVIKTRREYNIWVADESIEDYALRYAPTSVRKWSPWTVTNTAISTVSFLAMEAIGATMLWQYGFSNAVWAAIVVCTIIFLTSWPISYYAAKYNVDVDLLTRGAGFGYIGSTITSLIYASFTFILLAFEAAIMAMALELALGIPQVIGYLISALVILPLVVKGIGFINKVQAVTQPIWLLLLLLPWFFVLWKQPQILSSSLHFVGAVSNSTDFNLYYFGAACTLIFSFVIQIGEQADYLRFLPQKEKNRTAWRFAVFLGGPSWIIFGFLKVLMGMLLMVLAFQLFIPVSELDNPTYLYWVAYQQFIPNPQLALILTLALVCLAQIKINMTNAYAGSLAWSNFFARLTHSHPGRIVWLLFNVFIAIVLMEMGISHAVERILGLYSNIALAWIGAVVADLIICKPLGLSPKGIEFRRAYLYDINPVGVGALLIASVLSMLSYLGFFGLMAKGLASFIALGSAVLCVPIIAYLTKGKYYIARQPEKIQATSVANCVVCERDYELADMAGCPAYNGTICSLCCSLEARCHDLCKPDARWSVQLKKTIWHYLPERWASRLNSRVSLYLLLTLGLSIVLAVSLSLVYIQEKTYLETINAAAVPQLFTLFVKIYTILFLLMSVAAWWLVLNDESRRNAEIETHQQTALLIDEIAAHEVTSKDLQDARIAAERANDAKSRYVIGISHELRTPLNSILGYSQLLQKQEQLSEQGKMALGVISRSGQHLTSLIDGLLDLARIETGKISLNVVDVHFPNFIEQIIQMFQPQFEQKNLQFVYEIGENLPHYVRTDKKRLEQVLINLLGNALKFTTSGTITLKVEYRFQTAYFEIRDTGCGIAEADLERIFNPFERGSNVVQGGFTGTGLGLPIVKLLVDLLGGQLSVTSQLNQGSQFKIKFYLPSKEVVHPISNVYSNQITGYQGERKRILVVDNEAVDRGLVANFLKPLGFMIEEAESGIDCLRRVPIFQPNLILMDLNMPLMGGWETARLLRQNNITNVPILIISANAGEREVNPQDAVLSEDFMLKPIDLNLLLSKIGDKLGLVWIDSKSETLLENNEVQALDLNIYKQEQVAVHTLIQQPENNELLDFPQSLQQLNDLIGQGYIRGIQQTLTQCRQNFPKHNELWEQLEQAIQKFDLKHAQRLIQDKQ
>NZ_CP051869.1|WP_031993588.1|2899210_2900170_+|response-regulator-transcription-factor
MSTQHVSFQQASPNEQAVILIVDDVPENLGLLHESLDQAGYRVLVTTDGLSAIEIAHRCLPDMILLDGNMPHMDGFESCIQLKASPITQFIPVIFMTGLSETEHIVRGFQVGGVDYVTKPLNIEEVLARVKTHLAHAKLLQQQKQVIDATETAILALDVHGKIVWKTQKASDLLNQYLPELEVFEAGLKAWFSDLEQEKDSKKLTSCSYSTPSQQLQLLLLTPWQSETSVAKNYLIQIKTSTPALEMADILKYCPQLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHVFEKLCVENRTAAVAHINSLVQEFH
>NZ_CP051869.1|WP_001025680.1|2900312_2900597_+|N-acetyltransferase
MNIQQKDDTKHGSFSLLDGETVAGEMTYTWAGESMLIIDATDVNENYRGQGVGRQLLDALVAFVREKDVKVIPLCPYAKSVFDKDPSIGDVLRK
>NZ_CP051869.1|WP_104039585.1|2900664_2900817_-|hypothetical-protein
MCNKFIFFPIGLKLFLLDKLFYKFDKFDLAIENLQISWIQLLKTYSLKQR
>NZ_CP051869.1|WP_000937468.1|2900905_2901541_+|amino-acid-ABC-transporter-permease
MLPQFFSATLTTLKISIISIILAIIVGLICSILITYRVRVLNRIAQFYIELSRNTPLLIQLFFLYYGLPKLGIKIDGFTCGVIGLTFLGGSYMAEAFRAGLQSVAKGQIDSAKSIGLQPTQIFRYVIFPQALAISIPAIGANCLFLIKESSVVSAIAVVELLFVTKDLIGMDYKTTEALFLLIMAYLIILLPVSILTSYLEHRSRKVSHGT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051869_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051869_3

3571619-3571763

Orphan

Consensus_repeat	Method
CAAAGCTTTAGCCGCTTTGTCTTGCTCAGGTGGCGTTTTTTTATAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051869_3

>merge|NZ_CP051869|3|3571619-3571763|CRISPRCasFinder
CAAAGCTTTAGCCGCTTTGTCTTGCTCAGGTGGCGTTTTTTTATACCTGTAAAAAGTTCAATACAAATTAACCATAACTATGTTTATCTTGCGCTTCGCCAAAGCTTTAGCCGCTTTGTCTTGCTCAGGTGGCGTTTTTTTATAC

>NZ_CP051869|3|3|3571619-3571763|CRISPRCasFinder
CAAAGCTTTAGCCGCTTTGTCTTGCTCAGGTGGCGTTTTTTTATAC	CTGTAAAAAGTTCAATACAAATTAACCATAACTATGTTTATCTTGCGCTTCGC
CAAAGCTTTAGCCGCTTTGTCTTGCTCAGGTGGCGTTTTTTTATAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051869.1\|WP_000954523.1\|3575356_3576259_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176162
NZ_CP051869.1\|WP_000616034.1\|3571300_3571534_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_000102943.1\|3568298_3568895_-\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|226090
NZ_CP051869.1\|WP_000175347.1\|3567401_3568073_-\|DUF2057-domain-containing-protein	unknown	unknown	gnl\|CDD\|378258
NZ_CP051869.1\|WP_000838063.1\|3578951_3579371_+\|heme-binding-protein	unknown	unknown	gnl\|CDD\|225734
NZ_CP051869.1\|WP_000156920.1\|3572483_3572915_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341391
NZ_CP051869.1\|WP_000121846.1\|3574789_3575113_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_077163451.1\|3572010_3572343_+\|DUF2750-domain-containing-protein	unknown	unknown	gnl\|CDD\|378546
NZ_CP051869.1\|WP_000129945.1\|3572965_3574174_-\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|235056
NZ_CP051869.1\|WP_000949688.1\|3579630_3579876_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_002126108.1\|3566804_3567329_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP051869.1\|WP_000955082.1\|3570298_3570625_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_000138830.1\|3574401_3574743_+\|Grx4-family-monothiol-glutaredoxin	unknown	unknown	gnl\|CDD\|188046
NZ_CP051869.1\|WP_000185571.1\|3570725_3571085_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_085916945.1\|3566492_3566792_+\|cyd-operon-YbgE-family-protein	unknown	unknown	gnl\|CDD\|370577
NZ_CP051869.1\|WP_000270276.1\|3566390_3566492_+\|cytochrome-bd-I-oxidase-subunit-CydX	unknown	unknown	gnl\|CDD\|369733
NZ_CP051869.1\|WP_001202776.1\|3576310_3577105_-\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|235576
NZ_CP051869.1\|WP_001187341.1\|3569084_3570191_-\|signal-recognition-particle-docking-protein-FtsY	unknown	unknown	gnl\|CDD\|236686
NZ_CP051869.1\|WP_001186685.1\|3577457_3578759_+\|branched-chain-amino-acid-transport-system-II-carrier-protein	unknown	unknown	gnl\|CDD\|185331
NZ_CP051869.1\|WP_031999823.1\|3565231_3566377_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|129307

Protein	Function_ID	Function_description	E-value
NZ_CP051869.1\|WP_000954523.1\|3575356_3576259_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176162	cd08473, PBP2_CrgA_like_4, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 4. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.44498e-97
NZ_CP051869.1\|WP_000156920.1\|3572483_3572915_+\|CBS-domain-containing-protein	gnl\|CDD\|341391	cd04623, CBS_pair_bac_euk, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and eukaryotes. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	1.93176e-56
NZ_CP051869.1\|WP_000102943.1\|3568298_3568895_-\|nitroreductase-family-protein	gnl\|CDD\|226090	COG3560, FMR2, Predicted oxidoreductase related to nitroreductase [General function prediction only].	1.21707e-108
NZ_CP051869.1\|WP_000175347.1\|3567401_3568073_-\|DUF2057-domain-containing-protein	gnl\|CDD\|378258	pfam09829, DUF2057, Uncharacterized protein conserved in bacteria (DUF2057). This domain, found in various prokaryotic proteins, has no known function.	2.01647e-28
NZ_CP051869.1\|WP_000838063.1\|3578951_3579371_+\|heme-binding-protein	gnl\|CDD\|225734	COG3193, GlcG, Uncharacterized protein, possibly involved in utilization of glycolate and propanediol [General function prediction only].	5.66012e-31
NZ_CP051869.1\|WP_077163451.1\|3572010_3572343_+\|DUF2750-domain-containing-protein	gnl\|CDD\|378546	pfam11042, DUF2750, Protein of unknown function (DUF2750). This family is conserved in Proteobacteria. The function is not known.	1.42209e-20
NZ_CP051869.1\|WP_000129945.1\|3572965_3574174_-\|aspartate-aminotransferase-family-protein	gnl\|CDD\|235056	PRK02627, PRK02627, acetylornithine aminotransferase; Provisional.	0
NZ_CP051869.1\|WP_002126108.1\|3566804_3567329_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.63041e-06
NZ_CP051869.1\|WP_000138830.1\|3574401_3574743_+\|Grx4-family-monothiol-glutaredoxin	gnl\|CDD\|188046	TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 family. The gene for the member of this glutaredoxin family in E. coli, originally designated ydhD, is now designated grxD. Its protein, Grx4, is a monothiol glutaredoxin similar to Grx5 of yeast, which is involved in iron-sulfur cluster formation. [Energy metabolism, Electron transport].	2.75898e-66
NZ_CP051869.1\|WP_001186685.1\|3577457_3578759_+\|branched-chain-amino-acid-transport-system-II-carrier-protein	gnl\|CDD\|185331	PRK15433, PRK15433, branched-chain amino acid transporter carrier protein BrnQ.	7.47656e-171
NZ_CP051869.1\|WP_085916945.1\|3566492_3566792_+\|cyd-operon-YbgE-family-protein	gnl\|CDD\|370577	pfam09600, Cyd_oper_YbgE, Cyd operon protein YbgE (Cyd_oper_YbgE). This entry describes a small protein of unknown function, about 100 amino acids in length, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It appears to be an integral membrane protein. It is found so far only in the Proteobacteria.	3.65946e-19
NZ_CP051869.1\|WP_000270276.1\|3566390_3566492_+\|cytochrome-bd-I-oxidase-subunit-CydX	gnl\|CDD\|369733	pfam08173, YbgT_YccB, Membrane bound YbgT-like protein. This family contains a set of membrane proteins, typically 33 amino acids long. The family has no known function, but the protein is found in the operon CydAB in E. coli. Members have a consensus motif (MWYFXW) which is rich in aromatic residues. The protein forms a single membrane-spanning helix. This family seems to be restricted to Proteobacteria.	2.3152e-06
NZ_CP051869.1\|WP_001202776.1\|3576310_3577105_-\|type-I-methionyl-aminopeptidase	gnl\|CDD\|235576	PRK05716, PRK05716, methionine aminopeptidase; Validated.	7.03372e-151
NZ_CP051869.1\|WP_001187341.1\|3569084_3570191_-\|signal-recognition-particle-docking-protein-FtsY	gnl\|CDD\|236686	PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional.	1.74298e-179
NZ_CP051869.1\|WP_031999823.1\|3565231_3566377_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|129307	TIGR00203, ubiquinol_oxidase_subunit_2, cytochrome d oxidase, subunit II (cydB). part of a two component cytochrome D terminal complex. Terminal reaction in the aerobic respiratory chain. [Energy metabolism, Electron transport].	7.16428e-150

>NZ_CP051869.1|WP_000616034.1|3571300_3571534_+|hypothetical-protein
MIQRISHHDLEHVYATAVNTIQSQMNFQDAVAQLEEVARAGHGKAALFLAELYYQGFRVERDSMKAQYWQKLATMQA
>NZ_CP051869.1|WP_000185571.1|3570725_3571085_-|hypothetical-protein
MTNTIDGFVFDNPPKEEQIIELAHYHRKLLDEAIFHQEIHLGDYCLAQRKRVFDYARQLDPNQKAWFYQVYDGELRKIADEDELHPADAEEGLSIFAMLLVLVIIAAILYFSVIRSLMG
>NZ_CP051869.1|WP_000955082.1|3570298_3570625_-|hypothetical-protein
MLTFKENFLKLKSELKADQCFNLVVIIIIGCIFMLSYLALLRPVNSEQYQRIVQLSRQATYPRTQDMAELIMAQSEIHRAEYLKLMHAYQFEHDHIKQYPALAQEDTQ
>NZ_CP051869.1|WP_001187341.1|3569084_3570191_-|signal-recognition-particle-docking-protein-FtsY
MQQQSNMQNKFLIDAEIGDDDVTLPNLPAIDVPIVESPVKQEVKAEEVVEAAPSTEPEQPKSGFFGRMKEGLSKTRRNFTDGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTIITNLTERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTTTIGKLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIAVVAQGHGADSASVIFDAFESARAKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQEFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAALFETDK
>NZ_CP051869.1|WP_000102943.1|3568298_3568895_-|nitroreductase-family-protein
MSTFLDKIKNRRTIYAIGKNVALDRTKIEETIREAVKHSPSAFNSQSSRVVTLYGESHAKFWNLVREALRKIVPADAFAGTNAKIDSFVAGVGTVLFYEDQAVVKSLQEQFELYADNFPVWSEHSSAIAQFATWTALSELGLGASLQHYNPIVDADAAEAFDVPATWKLRAQLVFGSVEAPAGEKAFISDEDRFKTFN
>NZ_CP051869.1|WP_000175347.1|3567401_3568073_-|DUF2057-domain-containing-protein
MTLRLSVAAMGLLLSGSVFSAVTITAPEEIVILAVNGQEVNSGLFRSSKNNYKVDAGETSLSVRYQEYFEHLSGEHDIVKSGVVTIQTPALKDGQTYKLAMVDAPKQFEQAKKYAEQPTVALYNSNNELIVQQTGANNEARPWFASGLLGKVTDFTTKSSKQQPDAVYAAAKPTTTQANAPVATTMPATGVAQTNDQRLAEIWKKSSKAERQKFMAWLAEQSN
>NZ_CP051869.1|WP_002126108.1|3566804_3567329_-|GNAT-family-N-acetyltransferase
MIKLNFRLAEFSDIPTLVELINQSYREQQGRSWTTEVEYVKGQRINKEQLKHQLELPNSVLLIGEIDSSKVVTCIGLTFQSNTVEIGTFCTDPHVQNMKIGRSVLEYAEQFALHKVPELDSAIMYVLNVRSELIAYYERRGYIKTGYHEPYPLDANVGLPLIPIKLIEMKKDLK
>NZ_CP051869.1|WP_085916945.1|3566492_3566792_+|cyd-operon-YbgE-family-protein
MMATAMTASNQRKAQAFAMAISFLLALPLAVILLVHPSLMLDANGHYNHSQLMLVMVGISGGFIYGVGFVPHFWLWKWLFSPWIAWPLMLLGYYIWFLT
>NZ_CP051869.1|WP_000270276.1|3566390_3566492_+|cytochrome-bd-I-oxidase-subunit-CydX
MWYFAWILGILMACFAGVLSALYIEHHQNLDEE
>NZ_CP051869.1|WP_031999823.1|3565231_3566377_+|cytochrome-d-ubiquinol-oxidase-subunit-II
MIEYELLKIIWWVLVGVLLIGFALTDGFDMGSMALMPFVGKTDNERRAAINTIAPHWDGNQVWFITAGGALFAAWPMVYSVAFSGMYWALLLVLFALFLRPVGFDYRSKLENTQWRNSWDWGLCIGGAVPALVFGVAFGNLFLGIPFSLDSTLRSEYSGSFFALLNPFALICGIVSLSMLCAHGGAWLMLRTDGDLKQRSAKATQIMAAIFLVCFLVIGAWLYFGQVPGYSYAAAVDPNAALNPLAKEVVTNNNPGWMNNYSSYPITKVAPVLAILGAIIAFFTASKAKAGLSFAGTSLMIVGAILTAGFALFPFLLPSSVNPNSSLTMWDAVSSHRTLGVMTVAACIFVPIILIYTSWSYYKMWGVITNKHIESNSHSLY
>NZ_CP051869.1|WP_077163451.1|3572010_3572343_+|DUF2750-domain-containing-protein
MIKIYILRTMMYCGVLWGLFDEGWAIKSDQEDFIFPFWLNGVQAHRYAKTHWPNYKPRKITPKDFHESLLPTLTRLKVTPALFNSSHRKLKLSTQQMHHFFFNHPKWQVA
>NZ_CP051869.1|WP_000156920.1|3572483_3572915_+|CBS-domain-containing-protein
MTIVAQVIKNKSEQAIFTISPEATVLEAITIMAEKGIGALVVAEGEQVVGILSERDYTRKVTLMERSSYSTTVAEIMTAKVITVGLNNTVEECLQLMTDRHLRHLPVLDNGKLVGFISIGDLVKAAMEDQKVLIEQLKQYISG
>NZ_CP051869.1|WP_000129945.1|3572965_3574174_-|aspartate-aminotransferase-family-protein
MTDITLAPVQPDQPTHLMATYGRQAISFVRGRGAYLYTQDGTEYLDALTGIAVCGLGHAHPAIAEAIAEQAATLVHTSNLFEIPWQTAAAQKLAEVSGMEEIFFSNSGAESNEGAIKIARKFGTQQGISLPKIIVAEQSFHGRTLATLSATGNKKVQDGFAPLVEDFIRVPFGDIEAIQEAALQHPDIVAILIEPIQGEGGINTAPQGFSYLEEVRQICNQHNWLMMLDEIQTGNGRTGKYFAYQHTNIIPDVLTTAKGLGNGFPVGAVMTQGKAVGLLGPGSHGSTYGGTVLGSRVVYTVIDTIQKENAVENAAVVGNYIVDQLRAQLSDKNVQVRGFGMMIGIQLPKDCAELVAIARDEYKLIINVTAGSVVRLLPPINMTQAQADILLERLVALITNYL
>NZ_CP051869.1|WP_000138830.1|3574401_3574743_+|Grx4-family-monothiol-glutaredoxin
MTEQARDTEALIRDQIAKHPVLLYMKGTPQFPQCGFSARAVEALSQIGRPFAYVNILENPDIRATLPKIANWPTFPQLWVNGELIGGSDIMLEMFQNGELKPLIEQYSAAPEA
>NZ_CP051869.1|WP_000121846.1|3574789_3575113_-|hypothetical-protein
MSYQLVELENATANIICPICKLAVIDWTQEQYVQPCEHTVFIAMDLGFEFVADRFEEVMNQNVDELHEDPNMNIFDAITTTPYKNLTILKADLGVDGLFRYVGISDC
>NZ_CP051869.1|WP_000954523.1|3575356_3576259_+|LysR-family-transcriptional-regulator
MLTDLDDFYCFALVVEHGGFSAAERVTDIPKSKLSRRVYNLEENLGVRLIQRSSRHFAVTDIGMDIYRHAQVMMNAAQAAHDLVDHLSIQPRGVVKVSVPVDIAQNQLPKILPAFLKKYPEIRLQLIVSNRRVDVINEGIDIALRVRSKLDDDPSLVLRQFALIEQSLFASQAYLNEFGNIKSPDELSDHRILSLSEEHLDQQFILHGPDNQLKKVKVSPTIMGTNIYMLAQLASQNCGIALLPDTAAEDFVKSGQLVQILPDWKAAHGIFHAVYPSRRGLLPAVRVFIDYLVEHLSEHP
>NZ_CP051869.1|WP_001202776.1|3576310_3577105_-|type-I-methionyl-aminopeptidase
MRASTVTIKTEQDLEKLRVSGRLAAQVLEMIGEYVKPGVTTEYLDNICNDYIVNTLKVIPANVGYHGFTKTICTSVNEVVCHGIPSQNKILKDGDIINIDVAIIKDGYFGDTSRMYYVGNVNPHAKKLVETTYEAMVAGIHAVKPGATLGDIGYAIQSVAHREGYSIVREYCGHGIGKVYHEQPNILHYGQRGQGLVLKKGMVFTIEPMVNAGKPQVKELNDGWTVITQDHSLSAQWEHMVAVTDTGFELLTPWPEGVGNYPEI
>NZ_CP051869.1|WP_001186685.1|3577457_3578759_+|branched-chain-amino-acid-transport-system-II-carrier-protein
MQQLRTGDIIALGFMTFALFIGAGNIIFPPIVAQQAGDHVWLAAIGFLITAVGLPVITIMALSRMQGSIEIISSPLGRIASLILTVVCYLSVGPLFATPRTATVSYEIGFSSYFGTSSSSLLIYSAIYFAFVTVVSLYPNKLLDTVGHVLAPLKIIALAILGIAAVMIPAGYVPAPINHYVNSPVSEGFVNGYLTMDTLGALVFGIVIIQAIYSRGVTDNKLVTKYAIIASLISGVGLTLVYLSLFKLGLGSHEVAPNAANGAVILHAYVQHAFGNMGSLFLTGLIFLACMVTAIGLTCACAEYFAQLTKLPYKLLVFILVGFSFIISNLGLTKLIAVSVPVLSAIYPPAIVVIMLSFFWKFWHKPSFIVGSVTSIALIFGIIDGLKVAGFGDYLPNFLQHLPLNEQNLAWLIPSLVVLVVTTLIDKVKHKSI
>NZ_CP051869.1|WP_000838063.1|3578951_3579371_+|heme-binding-protein
MKSKYYLTLADAEFLMEEAQKYAIEHNFKVSIAIVDETSSLLLMKRLDGASPLTTHLCLEKAKCSSMSGRPSKFYEELLQNGRLGFLSMPSAKGMLEGGKAIIYEGQILGAIGVSGVQSFEDAEIAQHAIDVFLKKQSS
>NZ_CP051869.1|WP_000949688.1|3579630_3579876_+|hypothetical-protein
MLSLHFNKQVFINTLNSKDSVVYGVTTLALMLTLLFQGMIKGNLKPEYFMYAMVVSFVFCVWAFVDHKMRKLAKRRLSQQK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051869_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051869_4

3828888-3828976

Orphan

Consensus_repeat	Method
TCTTGCGAAAAAGTAAGAGATAATCAATCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051869_4

>merge|NZ_CP051869|4|3828888-3828976|CRISPRCasFinder
TCTTGCGAAAAAGTAAGAGATAATCAATCTCAACTATCTACTCACAACATGTTGTTCGTCTTGCGAAAAAGTAAGAGATAATCAATCTC

>NZ_CP051869|4|4|3828888-3828976|CRISPRCasFinder
TCTTGCGAAAAAGTAAGAGATAATCAATCTC	AACTATCTACTCACAACATGTTGTTCG
TCTTGCGAAAAAGTAAGAGATAATCAATCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051869.1\|WP_000494374.1\|3820872_3822063_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|183114
NZ_CP051869.1\|WP_000070779.1\|3834764_3835709_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP051869.1\|WP_031962564.1\|3832482_3833136_+\|oxygen-insensitive-NAD(P)H-nitroreductase	unknown	unknown	gnl\|CDD\|182929
NZ_CP051869.1\|WP_000009660.1\|3830872_3831382_+\|peptidyl-prolyl-cis-trans-isomerase	unknown	unknown	gnl\|CDD\|238901
NZ_CP051869.1\|WP_001269055.1\|3822206_3823718_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143434
NZ_CP051869.1\|WP_001098470.1\|3827768_3828491_+\|glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|235919
NZ_CP051869.1\|WP_000312014.1\|3815261_3816113_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225980
NZ_CP051869.1\|WP_111818374.1\|3838283_3839162_+\|pseudouridylate-synthase	unknown	unknown	gnl\|CDD\|211332
NZ_CP051869.1\|WP_000808299.1\|3816597_3818310_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|350795
NZ_CP051869.1\|WP_031380064.1\|3831397_3832117_+\|UDP-2,3-diacylglucosamine-diphosphatase	unknown	unknown	gnl\|CDD\|235420
NZ_CP051869.1\|WP_001983665.1\|3834163_3834682_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP051869.1\|WP_031945570.1\|3837660_3838134_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|376771
NZ_CP051869.1\|WP_038405656.1\|3835715_3837668_-\|DNA-mismatch-repair-endonuclease-MutL	unknown	unknown	gnl\|CDD\|234630
NZ_CP051869.1\|WP_000122149.1\|3825392_3826778_+\|ethanolamine-ammonia-lyase-subunit-EutB	unknown	unknown	gnl\|CDD\|237897
NZ_CP051869.1\|WP_032000610.1\|3823939_3825376_+\|ethanolamine-permease	unknown	unknown	gnl\|CDD\|129986
NZ_CP051869.1\|WP_000462401.1\|3832124_3832343_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051869.1\|WP_001098142.1\|3819907_3820876_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
NZ_CP051869.1\|WP_002055839.1\|3833174_3834032_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|274527
NZ_CP051869.1\|WP_000874704.1\|3818540_3819713_+\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341467
NZ_CP051869.1\|WP_001983672.1\|3816194_3816560_-\|5-carboxymethyl-2-hydroxymuconate-Delta-isomerase	unknown	unknown	gnl\|CDD\|238324

Protein	Function_ID	Function_description	E-value
NZ_CP051869.1\|WP_000494374.1\|3820872_3822063_-\|transcriptional-regulator	gnl\|CDD\|183114	PRK11388, PRK11388, DNA-binding transcriptional regulator DhaR; Provisional.	6.78635e-10
NZ_CP051869.1\|WP_000070779.1\|3834764_3835709_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	7.71297e-140
NZ_CP051869.1\|WP_031962564.1\|3832482_3833136_+\|oxygen-insensitive-NAD(P)H-nitroreductase	gnl\|CDD\|182929	PRK11053, PRK11053, oxygen-insensitive NAD(P)H nitroreductase.	5.66626e-145
NZ_CP051869.1\|WP_000009660.1\|3830872_3831382_+\|peptidyl-prolyl-cis-trans-isomerase	gnl\|CDD\|238901	cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E. coli cyclophilin A and Streptomyces antibioticus SanCyp18. Compared to the archetypal cyclophilin Human cyclophilin A, these have reduced affinity for cyclosporin A. E. coli cyclophilin A has a similar peptidylprolyl cis- trans isomerase activity to the human cyclophilin A. Most members of this subfamily contain a phenylalanine residue at the position equivalent to Human cyclophilin W121, where a tyrptophan has been shown to be important for cyclophilin binding.	1.99356e-78
NZ_CP051869.1\|WP_001269055.1\|3822206_3823718_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143434	cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like. Included in this CD is the NAD+-dependent, acetaldehyde dehydrogenase II (AcDHII, AcoD, EC=1.2.1.3) from Ralstonia (Alcaligenes) eutrophus H16 involved in the catabolism of acetoin and ethanol, and similar proteins, such as, the dimeric dihydrolipoamide dehydrogenase of the acetoin dehydrogenase enzyme system of Klebsiella pneumonia. Also included are sequences similar to the NAD+-dependent chloroacetaldehyde dehydrogenases (AldA and AldB) of Xanthobacter autotrophicus GJ10 which are involved in the degradation of 1,2-dichloroethane. These proteins apparently require RpoN factors for expression.	0
NZ_CP051869.1\|WP_001098470.1\|3827768_3828491_+\|glutamine-amidotransferase	gnl\|CDD\|235919	PRK07053, PRK07053, glutamine amidotransferase; Provisional.	8.11186e-142
NZ_CP051869.1\|WP_000312014.1\|3815261_3816113_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|225980	COG3449, COG3449, DNA gyrase inhibitor [DNA replication, recombination, and repair].	7.95793e-50
NZ_CP051869.1\|WP_000808299.1\|3816597_3818310_-\|AAA-family-ATPase	gnl\|CDD\|350795	cd18037, DEXSc_Pif1_like, DEAD-box helicase domain of Pif1. Pif1 and other members of this family are RecD-like helicases involved in maintaining genome stability through unwinding double-stranded DNAs (dsDNAs), DNA/RNA hybrids, and G quadruplex (G4) structures. The members of Pif1 helicase subfamily studied so far all appear to contribute to telomere maintenance. Pif1 is a member of the DEAD-like helicases superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	1.60601e-79
NZ_CP051869.1\|WP_031380064.1\|3831397_3832117_+\|UDP-2,3-diacylglucosamine-diphosphatase	gnl\|CDD\|235420	PRK05340, PRK05340, UDP-2,3-diacylglucosamine hydrolase; Provisional.	1.0989e-116
NZ_CP051869.1\|WP_001983665.1\|3834163_3834682_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	8.16909e-47
NZ_CP051869.1\|WP_031945570.1\|3837660_3838134_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|376771	pfam02367, TsaE, Threonylcarbamoyl adenosine biosynthesis protein TsaE. This family of proteins is involved in the synthesis of threonylcarbamoyl adenosine (t(6)A).	2.35768e-56
NZ_CP051869.1\|WP_038405656.1\|3835715_3837668_-\|DNA-mismatch-repair-endonuclease-MutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
NZ_CP051869.1\|WP_000122149.1\|3825392_3826778_+\|ethanolamine-ammonia-lyase-subunit-EutB	gnl\|CDD\|237897	PRK15067, PRK15067, ethanolamine ammonia-lyase subunit EutB.	0
NZ_CP051869.1\|WP_032000610.1\|3823939_3825376_+\|ethanolamine-permease	gnl\|CDD\|129986	TIGR00908, putative_ethanolamine_permease, ethanolamine permease. The three genes used as the seed for this model (from Burkholderia pseudomallei, Pseudomonas aeruginosa and Clostridium acetobutylicum are all adjacent to genes for the catabolism of ethanolamine. Most if not all of the hits to this model have a similar arrangement of genes. This group is a member of the Amino Acid-Polyamine-Organocation (APC) Superfamily. [Transport and binding proteins, Amino acids, peptides and amines].	4.30815e-170
NZ_CP051869.1\|WP_111818374.1\|3838283_3839162_+\|pseudouridylate-synthase	gnl\|CDD\|211332	cd02558, PSRA_1, Pseudouridine synthase, a subgroup of the RluA family. This group is comprised of bacterial proteins assigned to the RluA family of pseudouridine synthases. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. The RluA family is comprised of proteins related to Escherichia coli RluA.	2.66724e-123
NZ_CP051869.1\|WP_001098142.1\|3819907_3820876_+\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	8.5831e-34
NZ_CP051869.1\|WP_002055839.1\|3833174_3834032_-\|DMT-family-transporter	gnl\|CDD\|274527	TIGR03340, phn_DUF6, phosphonate utilization associated putative membrane protein. This family of hydrophobic proteins has some homology to families of integral membrane proteins such as (pfam00892) and may be a permease. It occurs in the vicinity of various types of operons for the catabolism of phosphonates in Vibrio, Pseudomonas, Polaromonas and Thiomicrospira.	5.27413e-06
NZ_CP051869.1\|WP_000874704.1\|3818540_3819713_+\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341467	cd08188, PDDH, 1,3-Propanediol (1,3-PD) dehydrogenase. This family includes 1,3-propanediol (1,3-PD) dehydrogenase, a key enzyme in the microbial production of 1,3-PD that has been previously characterized as the product of dhaT gene in Klebsiella pneumoniae. 1,3-PD dehydrogenase is a member of the family III metal-dependent polyol dehydrogenases, which are shown to require a divalent metal ion for catalysis. However, some members of this family showed a dependence on Fe(2+) or Zn(2+) for activity.	0
NZ_CP051869.1\|WP_001983672.1\|3816194_3816560_-\|5-carboxymethyl-2-hydroxymuconate-Delta-isomerase	gnl\|CDD\|238324	cd00580, CHMI, 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) is a trimeric enzyme catalyzing the isomerization of the unsaturated ketone 5-(carboxymethyl)-2-hydroxymuconate to 5-(carboxymethyl)-2-oxo-3-hexene-1,6-dionate. This is one step in the homoprotocatechuate pathway, one of the microbial meta-fission pathways that degrade aromatic carbon sources to citric acid cycle intermediates. Despite the structural similarity of CHMI with 4-oxalocrotonate tautomerase (4-OT) and macrophage migration inhibitory factor (MIF), there is no significant sequence similarity among these protein families, and therefore, they are not combined in one hierarchy.	7.85994e-36

>NZ_CP051869.1|WP_001098470.1|3827768_3828491_+|glutamine-amidotransferase
MNTTNAFPKTIYAIQHLAFEDLGSLEDVFYQLGFRVRYFEAGVDDLTPAFTHDGLTIILGGPIGVYETEDYPFLKDEIALLKQRLAADKPTLGICLGAQLIAHALGAKVYAGHQKEIGWGALSLSLRPNQVLSPLLNNVHVLHWHGDTFDLPENAVLLASSEIYTNQAFEVGNNILALQFHIETTEENFEKWLIGHTCELRHAGVSIPKLREQNIEYAPALEQAAFEIIQKFLKRIGYSA
>NZ_CP051869.1|WP_000122149.1|3825392_3826778_+|ethanolamine-ammonia-lyase-subunit-EutB
MSYRNIVANQQYHFADLKTLMAKATPLRSGDELAGVAARDATEHVAAQMTLADVPLKTFLNEVVIDYETDEITRLIIDEHDLAAFAPISHFTVGDFRNWLLGEDATAESLKALASGLTPEMVAAVSKIMRNQDLIYVASKCEVVTQFRNTIGLKGHLSTRLQPNHPTDDVLGISASILDGLMYGNGDAVIGINPATDNLHNLSELLKLLDHVIQEYQIPTQSCVLTHISSGIQLAEKNVPIDLMFQSIAGTQLANEGFGISLDLLQEGYEATLSLKRGTIGQNVMYFETGQGSALSSNAHHGVDQQTLETRAYAVARKYNPLLVNTVVGFIGPEYLFNGKQIIRAGLEDHFCGKLLGVPMGCDICYTNHADADQNDMDVLLTLFGAAGINFIMGIPGSDDVMLNYQTTSFHDALYLRQLLGLKPAPEFSAWLEQQGIFKQQNSQICWADHMPDQFSRLLMN
>NZ_CP051869.1|WP_032000610.1|3823939_3825376_+|ethanolamine-permease
MNQPETASVISSSAEVSSAEYFAQRQLKQGTVGWLLLIGLGVAYVISGDFAGWNFGIAQGGWGGMFIATALAALMYLCLCLSMSEMSTMMPTAGGGYSFARAAFGPFGGYLTGTAILIEYAIAPAAIAVFIGGYCESLFGINGWMIYLACYTIFMGIHLKGAGEALKIMFAITLVAAVALVVFIGAMIPHFNAQNLFDIPVSTGVGASLFLPHGYLGIWAAVPFAIWFFLAVEGVPLAAEEAKDPAKSLPRGLIGAMLILTAFAMLILFLGAGAAGASTLQNSGAPLVDALVKVYGTNTWLATFVNFVGLAGLIASFFSIIYAYSRQIFALSRAGYLPTSLSLTNKNKAPYLAIIIPGIIGFLLSLTKEGDSLILIAVFGATISYVLILLSHIKLRLSKPDMPRPYKTPGGIITSSIALVLAVAAVVAGFVVNPKVWFIAAGIYVVFIAYFLFYSRYHLVKGTPEEEFANIKAAEQEL
>NZ_CP051869.1|WP_001269055.1|3822206_3823718_+|aldehyde-dehydrogenase-family-protein
MRYIDPNQPGSKVQFKSQYENFIGGEWVAPLKGEYFDNVSPVDGKAFTRIPRSSAEDIELALDAAHKAKASWNKSSPTTRSNILLKIADRLEANLEMLAVAETWDNGKAVRETLAADLPLAIDHFRYFAGCIRAQEGGISEIDEDTIAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAAGNCVVIKPAEQTPVGILLVAELIQDILPPGVLNIVNGFGAEVGRPLATSPRIAKIAFTGSTQTGQMVMQYATENIIPVTLELGGKSPNLFFEDIMDKEDDFLEKTLEGFAMFALNQGEVCTCPSRALVQESIADQFLELAVERVKRIKTGHPLDTETMIGAQASLQQQEKILRCINTGREEGAELLLGGSGRKEVGDGFYVDPTIFKGHNSMQVFQEEIFGPVLAVTTFKDFDDAIKIANDTMYGLGAGVWSRSAHISYRAGRAIEAGRVWTNCYNIYPAHAAFGGYKKSGIGRENHKMMLDHYQQTKNLLVSYSTKPMGFF
>NZ_CP051869.1|WP_000494374.1|3820872_3822063_-|transcriptional-regulator
MFTKKDLLQQRMLIDQLRTQNSLSPQNAAKLGQSIASSWERSASAAIPKERFAAPLLERKSASQNALDLALSQCADDLRHIAEQSSMVIAVGDIGSTIIWTASSAQMQSAAERVHFVQGGQWREEFVGTNALALSLKTQQSSCVFSNEHYMESIHDWVCYAAPIIDPYSKQTLGVVDLSTTWKNHNTLGILAAERCASIIQSALLEQQRQHLHIRAFSTPQVKFNGKSLLLTPRQIEILTILALCPHGLTLEHLYQALYGERKVSMGTLKAEMSQLRDILGGLLGSRPYRLLVHVEADFLQAEQALDAGYVASALQLYTGVFLAKTESPFLCAWRDCLESRLSDAIFKTQETDLLLKHLAHFPEAIDAVERLMELLPSEHPAHQLLVKYIDSPKLS
>NZ_CP051869.1|WP_001098142.1|3819907_3820876_+|alpha/beta-hydrolase
MNTSTAKHNYAPDILGAGYEQLTLNFPDDYEGKVVATLVRKKATQPTQKAVLYIHGFLDYFFQTEMAEQFNAHGYDFYALDLRKYGRSKLPHQIFYNVLDLNEYDAEITQALEIIGQEKHTQVLLAGHSTGGLTATLYAAHHPDHPLIKALWANSPFYDFNLSLVEKKFGIPMLSRVGKYLPKVKFPSQLNKWYTTSLHKQLKGEWDFNLDWKPTSAPTVQLSFVHAIHTAQKEIHRGVKLNIPALIMHSHQTKNPRKWGPDATQSDVILDVKDIAKFGKKMKGDVSVVSIHNGLHDLVLSAQPVREQVYQQLFQWLDQKVT
>NZ_CP051869.1|WP_000874704.1|3818540_3819713_+|iron-containing-alcohol-dehydrogenase
MAFKNIADQTNGFYIPCVSLFGPGCAKEIGTKAQNLGAKKALIVTDEGLFKFGVADLIASYLTEAGVASHIFPGAEPNPTDINVHNGVNAYNENGCDFIVSLGGGSSHDCAKGIGLVTAGGGHIRDYEGIDKSKVPMTPLIAVNTTAGTASEMTRFCIITNTDTHVKMAIVDWRCTPLIAIDDPKLMIAKPAGLTAATGMDALTHAVEAYVSTAANPITDACAEKAITMISQWLQPAVANGENIEARDAMSYAQYLAGMAFNNASLGYVHAMAHQLGGFYNLPHGVCNAILLPHVCEFNLIACPDRYAKIAELMGVNTHGLTVTEAAYAAIDAIRKLSSSIGIPSGLTELGVKTEDLAVMAENAQKDACMLTNPRKANHAQVVEIFKAAL
>NZ_CP051869.1|WP_000808299.1|3816597_3818310_-|AAA-family-ATPase
MKQETALKLLKAGENVFLTGSAGAGKTYTLNQYIHYLKARKVPVAITASTGIAATHMNGMTIHTWAGIGIKDHLTDDDLKRMKERKYLKEHLENAQVLVIDEISMLHAKQLNLVNQVLKYFKESDEAFGGIQVIVAGDFFQLPPVGRNGEANRDKFCFMSDAWVEAKFRVCYLTEQHRQDDEILNQILNAIRAQSIQTEHLQALHQSRTHDIGETFTRLYTHNMDVDNINYQHLNEIDNEGHQFNAVLDGNEKLLETLKSSVRAPEELTLKKHAKVMFVKNNFDMGYINGSLGEVIGFEEDDENGLLPKVKLTDGTTLLVAPETWSIENEAGKVIASFQQIPLRLAWAITIHKSQGMTLEAAEINLMHTFEKGQGYVALSRLKSLTGLKLLGFNEQALELDSLAVKADRRFQELSTEAEDNFANVDLTAQHKAFIRHCGGTLNETEISRNEKKLARGEKQNYASATLDETRALFEEGYEIEDIAHERGLTPATIINHLARLHKEQKLDISVAHPGEEVVEEVRKIYKKLKKRQNPDHFSDDGSIKLRPIVEATSPRMGYDQVRLALLFIE
>NZ_CP051869.1|WP_001983672.1|3816194_3816560_-|5-carboxymethyl-2-hydroxymuconate-Delta-isomerase
MAMPHVVVDYSDNLTGLNAKQLLEEINTTLIETELFSPEDIKSRARRDEVFLIGLGVDQAYIHVKAYILSGRTAEQKQLVGEQLLAALSNKKYLPQEFNKEIQLCVELIDMPRDDYFKQVV
>NZ_CP051869.1|WP_000312014.1|3815261_3816113_-|AraC-family-transcriptional-regulator
MAVYIQKLQLVCDYIQRHLDEDLDVDRLSQIAALSKFHFHRIFAIHVGLNVMKFIQLSRLKRASFQLVFEPDLKIIEIALQAGFDSPEAFTRAFKRSFDQTPRAFRDKPDWESWHQKFVFTIPKSELKMNVNIVERPAEKIAYLSHLGSPDKVFETAARFIAWRKETGLSPVTKSRTYGIPFADPEQIPSDEFRFDIAGSIEKAVPQNSYGVQTGEIPAGCYASVRHFGSHDQIKDSVYYIFRNWLPEQPEEAGDFPVFFHYHNFVHEVKECDLVTDIYLLLK
>NZ_CP051869.1|WP_000009660.1|3830872_3831382_+|peptidyl-prolyl-cis-trans-isomerase
MSFPQVELNTNKGRIVLELNTEKAPKTAANFLEYVRDGFYDGVIFHRVIDGFMIQGGGFDENFKEKATRDAIENEADNGLSNDVGTIAMARTQAPHSASAQFFINVKNNSFLNHTSKTAQGWGYAVFGKVVEGMDVVEAIKGVRTGNRGYHADVPLENVVIESAKIISE
>NZ_CP051869.1|WP_031380064.1|3831397_3832117_+|UDP-2,3-diacylglucosamine-diphosphatase
MTYLFISDLHLSPEHPRLVRGFLDLLVHYQNKQTQLYILGDWFNAWIGDDYSAPWLDEIVEALKVFNQKGNRVYFQVGNRDFALNQVFLDKFNGVLLPDIYYLNIAGHQYRLEHGDALCTDDISYQRFKKIIRNPFLVAFLRRTPLSFRTKLVNGFRKRSHSDKQQKSYEIMDVNEQAVVSALTDVDILIHGHTHRPAIHQLQHKQRIVLGDWREDHAQILEIDPSSHLQQIKLTDWYY
>NZ_CP051869.1|WP_000462401.1|3832124_3832343_-|hypothetical-protein
MFELIPINRKSKLREIRIIKAFLIFAFVLCLLILYIEYQKYAHINWKFVFITCLCMIWGFDLNKQAKYLKNN
>NZ_CP051869.1|WP_031962564.1|3832482_3833136_+|oxygen-insensitive-NAD(P)H-nitroreductase
MDLLNTVKSRYTTKAYDPEKKIPQEKFNKLLEILRFTPSSVNIQPWHFLVADNPTAKERIAKALTGRYAYNAPKVLESSHTLVFCTRTDISPEYLNQLLEQDDLSGRFKDEKAKLGQKDTRHGYVEFYRNEQKNLFGWMENQTFIALGQLLFAAGLEGIDATPMGGFDENVLNEEFGLKERGLRSSVIVSLGYRSENDFNAKLPKSRLPDEVIFTHL
>NZ_CP051869.1|WP_002055839.1|3833174_3834032_-|DMT-family-transporter
MVLIFAAALCSVLVSVLLKNLKKKGYQPMQMIAWNYASASLLCYLWFKPDIQHISIQHTPWWLIVALGVILPSIFLCLAKSLEYAGIVKTEIAQRLSVVLSLLAAYFFFQEQFNSLKLLGIGLGIFAVLLILLGHFNESSGAQSKKAIFALMSVWFGYAAVDILLKYTSSLGLQFTLTLNLIFITAFVLSIIYLIFQKNSAWHFKNTFAGLMLGVLNFSNIALYVKAHILLKDSPAIVFASMNILVVLLGIVCGVVLYKEKLKLPTILGIILGISGLVSLALAMK
>NZ_CP051869.1|WP_001983665.1|3834163_3834682_-|RNA-chaperone-Hfq
MELKMSKGQTLQDPFLNSLRKERIPVSIFLVNGIKLQGHIESFDQYVVLLKNTVSQMVYKHAISTVVPARNPRPAGAQGAGFPAQGGSQGGFGGQGAGFGGAQGAGFGGQGGFGGQGGFGGQGGFGGQGGFGGQGGFGGQGGFGGQGGFGGHQGGFDNDSKFEDGQDDENNR
>NZ_CP051869.1|WP_000070779.1|3834764_3835709_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MSNQLPVINLMGPTASGKTALACELYERGNFELISVDSALVYKDMDIGTAKPTREEQELYPHHLIDIITPLEVYSAAQFVEDACALIDEMHSRGKTPILVGGTMLYFKALLEGLSSNLPSADANVRAAIEEKAANEGWQAVYDELVAVDPAAGVKFKVSDKQRIIRALEVYRITGQPITKLQAEQPKNVPYRYTFHNYALLPDRLELHQRIEQRLSKMWDIGFLSEVESLIEKYDLDENLPSMRSVGYRQALEFLLKSDMSLKKKQEMEDKALFATRQLAKRQYTWLRSLQEIHDFKTYLTIKQAKEDLRNSYG
>NZ_CP051869.1|WP_038405656.1|3835715_3837668_-|DNA-mismatch-repair-endonuclease-MutL
MTDEKLTQRRIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGSTLIEIIDNGHGIHPDDLPLAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTSSQDESGIGHQVEVNGTAFDHQQVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHIEEIVRRLALTHFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGQQFVQNAYWIDAESINMRLSGWLGHPSDARAQADLQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFLEVDPENIDVNVHPTKHEIRFLNQREVHEFVRHYAKETLAQFQTASADLAQAMKVDDTQNLSVQPQPKYQEQFTLHRTAQAADTAVDKPNGYQPSTELLTDFNNSRPQSVHYAEQTPKYNGSAQLNNALKTYLAPLRDQPANFSVDENIEPVAKVDEFPLGIAIAQLHGIYILAQNTEGLIIVDMHAAHERILLQQMKNAWDKPEFWTSQQLLIPKVISISRMQAVRVEDLKPQLERLGLEIDLYGDEQVIVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAVRAHRQLSLSEMNALLRQMEQTEFASQCSHGRPTWRAFPLSQLDKLFARGE
>NZ_CP051869.1|WP_031945570.1|3837660_3838134_-|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MSYSLKMVLNHEEDTQRLAQALAQHVQAGVIYLIGDLGAGKTTLTRYFLQALGHKGSVKSPTYTLVEPYKINNKEIFHFDLYRLNDPYELELMGIRDYLDIQDALFLFEWPSKGGDEIPEADIVIDIQKSNDELNRFVTLTLPTEHLYQTLQEQLHD
>NZ_CP051869.1|WP_111818374.1|3838283_3839162_+|pseudouridylate-synthase
MMDGVSASQVYLPPQTTAQTIYQFLCENFPHIKATEWQQRFQDGLIYAANGEKLTLNSSYIANTHIFYYRFLANEVHVPFEHQILFENDDLLVVDKPHFLTISPTGQYVQETLLVRLKKQTGNEFLTPIHRLDRETAGVVLFCKRPQSRGIYQQLFADRQVNKIYHAIAPYKAELKFPQSLKLYLDKGTPFYTMQVIAHTKTNTETKIELIEHNHSWAKYCLTPTTGKQHQLRVHLNHLGIPIKNDPFYPIVQHKADDDFSQPLQLLAKQISFIDPLTKQEMVFNSQLELTL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP051869_3	3.1\|3571665\|53\|NZ_CP051869\|CRISPRCasFinder	3571665-3571717	53	NZ_CP051869.1	3571567-3571619	2	0.962

1. spacer 3.1|3571665|53|NZ_CP051869|CRISPRCasFinder matches to position: 3571567-3571619, mismatch: 2, identity: 0.962

ctgtaaaaagttcaatacaaattaaccataactatgtttatcttgcgcttcgc	CRISPR spacer
ctgtaaaaagttcaatacaaattaatcataattatgtttatcttgcgcttcgc	Protospacer
*************************.*****.*********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP051869_1	1.1\|2031240\|28\|NZ_CP051869\|CRISPRCasFinder	2031240-2031267	28	NZ_CP040048	Acinetobacter baumannii strain VB1190 plasmid unnamed1, complete sequence	572713-572740	3	0.893

1. spacer 1.1|2031240|28|NZ_CP051869|CRISPRCasFinder matches to NZ_CP040048 (Acinetobacter baumannii strain VB1190 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

gataccaccgatgattccagtaattgga	CRISPR spacer
aataccaccgataatgccagtaattgga	Protospacer
.***********.** ************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

344 : 11522

Acinetobacter_phage(64.29%)

integrase

attL 769:782|attR 14793:14806

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_169030899.1\|344_1664_-	AAA family ATPase	A0A2H4J6D5	uncultured_Caudovirales_phage	1.4e-164	74.1
769:782	attL	NA	NA	NA	NA
WP_169030898.1\|1663_2500_-	hypothetical protein	NA	NA	NA	NA
WP_001109646.1\|2499_2658_-	hypothetical protein	A0A1B1P9H5	Acinetobacter_phage	7.9e-19	98.1
WP_049594661.1\|2685_2913_-	hypothetical protein	NA	NA	NA	NA
WP_169030897.1\|3037_3742_+	helix-turn-helix domain-containing protein	A0A2H4J6Q0	uncultured_Caudovirales_phage	1.1e-22	34.5
WP_169030896.1\|3933_4140_+	hypothetical protein	A0A1B1P9G9	Acinetobacter_phage	9.0e-23	80.3
WP_141991767.1\|4139_4367_+	hypothetical protein	NA	NA	NA	NA
WP_151002140.1\|5200_5410_+	hypothetical protein	A0A1B1P9G5	Acinetobacter_phage	1.9e-28	94.2
WP_151002142.1\|5417_5732_+	hypothetical protein	A0A1B1P9H1	Acinetobacter_phage	5.5e-56	95.2
WP_151002144.1\|5734_6394_+	hypothetical protein	M4QPI3	Sulfitobacter_phage	1.5e-31	47.9
WP_169030859.1\|6390_6771_+	hypothetical protein	A0A0P0I8H3	Acinetobacter_phage	2.6e-39	83.0
WP_169030895.1\|6767_6977_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	1.7e-29	88.4
WP_169030894.1\|6973_7456_+	methyltransferase domain-containing protein	A0A0N7IRF6	Acinetobacter_phage	5.1e-69	73.6
WP_000123991.1\|7457_7727_+	hypothetical protein	A0A1B1P9G0	Acinetobacter_phage	4.7e-48	100.0
WP_169030893.1\|7723_8710_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P9F9	Acinetobacter_phage	3.4e-184	98.5
WP_000128669.1\|9007_9943_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	8.3e-23	30.0
WP_001010536.1\|9939_10713_+	ABC transporter permease	NA	NA	NA	NA
WP_031999474.1\|10709_11522_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A126HHM5	Vibrio_phage	1.9e-39	37.2
14793:14806	attR	NA	NA	NA	NA

DBSCAN-SWA_2

52428 : 71174

Acinetobacter_phage(64.29%)

integrase,tail

attL 45335:45348|attR 66762:66775

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
45335:45348	attL	NA	NA	NA	NA
WP_000872622.1\|52428_53970_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	3.9e-288	100.0
WP_032000405.1\|53966_55769_+	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	0.0e+00	96.5
WP_000947611.1\|56254_57451_+\|integrase	tyrosine-type recombinase/integrase	A0A0D4DBR3	Acinetobacter_phage	2.5e-226	100.0
WP_000098296.1\|57447_57642_-	hypothetical protein	A0A0D4DBH0	Acinetobacter_phage	3.8e-31	100.0
WP_038405714.1\|58075_58618_-	N-acetylmuramidase	A0A0P0IW03	Acinetobacter_phage	1.1e-96	96.1
WP_001100986.1\|58679_58859_-	hypothetical protein	A0A0D4DCA7	Acinetobacter_phage	9.2e-24	100.0
WP_001021568.1\|58884_59427_-	hypothetical protein	A0A0D4DBW7	Acinetobacter_phage	5.7e-101	100.0
WP_000433923.1\|59538_59928_-	hypothetical protein	J7I481	Acinetobacter_phage	4.3e-66	99.2
WP_169030890.1\|59992_62482_-	hypothetical protein	A0A1I9L2F3	Xanthomonas_phage	9.0e-08	23.4
WP_038405716.1\|62482_62917_-	C40 family peptidase	A0A0B5A615	Paracoccus_phage	4.6e-08	33.3
WP_038405717.1\|62971_63625_-	metallophosphoesterase	K7PJZ5	Enterobacterial_phage	4.4e-39	42.0
WP_110138917.1\|63621_66684_-	CotH kinase family protein	H7BUR7	unidentified_phage	4.7e-06	33.8
WP_002126538.1\|66746_67604_-	DUF2163 domain-containing protein	A0A2D1GNT2	Pseudomonas_phage	1.2e-12	25.9
66762:66775	attR	NA	NA	NA	NA
WP_169030889.1\|67600_68386_-	DUF2460 domain-containing protein	NA	NA	NA	NA
WP_169031068.1\|68396_71174_-\|tail	phage tail protein	A0A1B1P9E6	Acinetobacter_phage	1.1e-54	30.8

DBSCAN-SWA_3

75424 : 111219

Acinetobacter_phage(84.62%)

terminase,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004834305.1\|75424_76399_-	DUF2184 domain-containing protein	M4SQD1	Psychrobacter_phage	1.2e-51	36.9
WP_169030888.1\|76404_76875_-	hypothetical protein	NA	NA	NA	NA
WP_169030887.1\|76888_78091_-	DUF2213 domain-containing protein	H9C194	Pectobacterium_phage	2.3e-25	34.8
WP_000823404.1\|78333_78633_-	hypothetical protein	NA	NA	NA	NA
WP_153309870.1\|78748_78979_+	hypothetical protein	NA	NA	NA	NA
WP_169030886.1\|78967_79780_-\|capsid	minor capsid protein	M4T3R2	Psychrobacter_phage	1.6e-51	41.4
WP_169030885.1\|79724_81059_-	DUF1073 domain-containing protein	M4SN90	Psychrobacter_phage	1.5e-86	39.0
WP_169030884.1\|81067_82594_-\|terminase	phage terminase large subunit	K4PAF0	Escherichia_phage	1.2e-90	41.4
WP_000729394.1\|82571_83048_-	DUF2280 domain-containing protein	A0A0P0HSK4	Acinetobacter_phage	4.5e-33	53.6
WP_002056383.1\|83107_83749_-	hypothetical protein	A0A0P0I8J9	Acinetobacter_phage	7.7e-113	87.8
WP_169030883.1\|83717_84185_-	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	1.6e-59	76.7
WP_005068132.1\|84197_84389_-	hypothetical protein	J7I0V8	Acinetobacter_phage	2.6e-24	85.7
WP_169030882.1\|84615_84834_-	hypothetical protein	NA	NA	NA	NA
WP_169030881.1\|84977_85730_-	hypothetical protein	A0A0P0J081	Acinetobacter_phage	2.6e-128	92.0
WP_169030880.1\|85740_86142_-	DUF559 domain-containing protein	A0A0P0IKL1	Acinetobacter_phage	9.8e-66	94.0
WP_043041592.1\|86141_86465_-	hypothetical protein	NA	NA	NA	NA
WP_045544370.1\|86454_86634_-	hypothetical protein	NA	NA	NA	NA
WP_169030879.1\|86630_87029_-	HNH endonuclease	A0A2R2Z2X9	Escherichia_phage	5.8e-26	48.5
WP_001031745.1\|87025_87151_-	putative phage replication protein	A0A0P0IR92	Acinetobacter_phage	4.8e-11	89.5
WP_000050656.1\|87147_88110_-	helix-turn-helix domain-containing protein	A0A0P0HSN8	Acinetobacter_phage	4.4e-19	54.4
WP_000102848.1\|88106_88400_-	hypothetical protein	NA	NA	NA	NA
WP_016803319.1\|88396_88669_-	hypothetical protein	A0A0D4DCC3	Acinetobacter_phage	9.7e-41	100.0
WP_000166124.1\|88716_88983_-	hypothetical protein	A0A0D4DBY7	Acinetobacter_phage	1.6e-43	100.0
WP_001068174.1\|89019_89250_-	hypothetical protein	A0A0D4DBS7	Acinetobacter_phage	6.1e-36	100.0
WP_000605245.1\|89376_90102_+	LexA family transcriptional regulator	A0A0D4DBI5	Acinetobacter_phage	1.8e-134	100.0
WP_169030878.1\|90141_90441_+	hypothetical protein	A0A0D4DCL0	Acinetobacter_phage	3.4e-47	99.0
WP_001037047.1\|90480_90771_+	hypothetical protein	A0A0D4DCB9	Acinetobacter_phage	7.9e-49	100.0
WP_001169164.1\|90828_91044_+	KTSC domain-containing protein	A0A0D4DBY2	Acinetobacter_phage	5.0e-32	100.0
WP_000276791.1\|91094_91385_+	hypothetical protein	A0A0D4DBS2	Acinetobacter_phage	1.5e-44	100.0
WP_169030877.1\|91876_92317_+	hypothetical protein	A0A0N7IRF7	Acinetobacter_phage	1.8e-73	95.9
WP_000064462.1\|92319_92643_+	hypothetical protein	A0A0D4DCB5	Acinetobacter_phage	9.7e-56	96.3
WP_000206152.1\|92654_93422_+	hypothetical protein	NA	NA	NA	NA
WP_169025029.1\|93436_94645_+	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	1.2e-93	50.5
WP_000654847.1\|94646_94892_+	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	1.5e-40	100.0
WP_038405739.1\|94895_95303_+	hypothetical protein	A0A0P0I8H3	Acinetobacter_phage	1.3e-12	97.0
WP_000004577.1\|95299_95695_+	hypothetical protein	NA	NA	NA	NA
WP_000877062.1\|95691_96027_+	hypothetical protein	A0A0P0HSE1	Acinetobacter_phage	3.7e-34	62.4
WP_000529848.1\|96027_96297_+	hypothetical protein	A0A0P0J067	Acinetobacter_phage	8.7e-42	100.0
WP_000566784.1\|96420_96996_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	3.2e-110	100.0
WP_111818271.1\|97092_99858_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	0.0e+00	98.3
WP_038405740.1\|99871_102604_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	0.0e+00	98.0
WP_079283078.1\|102960_104010_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	8.3e-189	99.4
WP_000608305.1\|104019_104826_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	6.7e-146	99.3
WP_000066126.1\|104835_105531_+	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	5.8e-122	100.0
WP_032000412.1\|105541_106525_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	3.3e-187	98.5
WP_038405742.1\|106531_108907_-	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	0.0e+00	98.4
WP_032000413.1\|108908_110408_-	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	1.0e-277	96.8
WP_001187844.1\|110670_111219_+	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	1.7e-97	100.0

DBSCAN-SWA_4

519694 : 529619

Acinetobacter_phage(42.86%)

terminase,integrase

attL 512580:512593|attR 523983:523996

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
512580:512593	attL	NA	NA	NA	NA
WP_163072084.1\|519694_520939_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.7e-79	41.5
WP_141991782.1\|520931_521129_-	hypothetical protein	A0A1B1P9F8	Acinetobacter_phage	1.5e-27	93.7
WP_104919046.1\|521255_521798_-	hypothetical protein	J7I0Y1	Acinetobacter_phage	2.6e-93	89.4
WP_163072106.1\|521800_522190_-	hypothetical protein	A0A0D4DBQ9	Acinetobacter_phage	1.9e-61	92.1
WP_163072107.1\|522271_524443_-	hypothetical protein	A0A2H4PIX9	Corynebacterium_phage	2.6e-11	34.3
523983:523996	attR	NA	NA	NA	NA
WP_169030871.1\|524452_526111_-\|terminase	phage terminase large subunit	A0A2H4JCA3	uncultured_Caudovirales_phage	5.8e-128	44.1
WP_017724836.1\|526113_526428_-	hypothetical protein	NA	NA	NA	NA
WP_169040853.1\|526523_527090_-	hypothetical protein	NA	NA	NA	NA
WP_163072101.1\|527090_529619_-	hypothetical protein	A0A0F7L5T6	uncultured_marine_virus	2.7e-52	25.4

DBSCAN-SWA_5

537775 : 553492

Acinetobacter_phage(61.11%)

head,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_169030868.1\|537775_538144_-	hypothetical protein	A0A0F6TJP2	Escherichia_coli_O157_typing_phage	9.1e-26	55.4
WP_114259557.1\|538210_539110_-	hypothetical protein	A0A1B1IRE8	uncultured_Mediterranean_phage	2.9e-17	28.1
WP_169030867.1\|539121_539745_-	hypothetical protein	NA	NA	NA	NA
WP_169030866.1\|539737_540223_-	hypothetical protein	NA	NA	NA	NA
WP_046023847.1\|540219_541863_-\|head,tail	head-tail connector protein	A0A2H4J3N6	uncultured_Caudovirales_phage	4.3e-123	44.2
WP_046023848.1\|541864_542095_-	hypothetical protein	NA	NA	NA	NA
WP_046023849.1\|542094_542436_-	hypothetical protein	NA	NA	NA	NA
WP_031966083.1\|542502_542682_-	hypothetical protein	NA	NA	NA	NA
WP_031966085.1\|542837_543017_-	hypothetical protein	NA	NA	NA	NA
WP_000651148.1\|543013_543217_-	hypothetical protein	NA	NA	NA	NA
WP_151002055.1\|543640_543916_-	hypothetical protein	A0A0D4DBT5	Acinetobacter_phage	7.8e-06	59.5
WP_151002057.1\|543908_544280_-	HNH endonuclease	S4TWR6	Salmonella_phage	7.5e-28	47.0
WP_057048735.1\|544266_544593_-	hypothetical protein	A0A0P0I8J0	Acinetobacter_phage	5.2e-25	58.1
WP_141991780.1\|544589_544994_-	hypothetical protein	NA	NA	NA	NA
WP_169030865.1\|545011_545431_-	hypothetical protein	H2DE79	Erwinia_phage	1.5e-27	51.6
WP_001106885.1\|545427_545580_-	hypothetical protein	NA	NA	NA	NA
WP_169030864.1\|545576_545765_-	hypothetical protein	NA	NA	NA	NA
WP_087451052.1\|545761_546496_-	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	1.4e-65	53.2
WP_169030863.1\|546492_547383_-	hypothetical protein	NA	NA	NA	NA
WP_001046534.1\|547379_547847_-	HNH endonuclease	NA	NA	NA	NA
WP_169030862.1\|547862_548189_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_001197739.1\|548197_548380_-	hypothetical protein	NA	NA	NA	NA
WP_032033629.1\|548491_549175_+	helix-turn-helix domain-containing protein	A0A1I9KG86	Aeromonas_phage	9.0e-27	37.9
WP_068550997.1\|549171_549813_+	hypothetical protein	NA	NA	NA	NA
WP_032008978.1\|550013_550205_+	hypothetical protein	A0A1B1P9G9	Acinetobacter_phage	1.3e-15	69.1
WP_169030861.1\|550204_550519_+	hypothetical protein	A0A1B1P9H2	Acinetobacter_phage	1.0e-46	88.5
WP_169030860.1\|550530_551307_+	hypothetical protein	E2GLY5	Acinetobacter_phage	1.1e-65	54.3
WP_151002140.1\|551371_551581_+	hypothetical protein	A0A1B1P9G5	Acinetobacter_phage	1.9e-28	94.2
WP_151002142.1\|551588_551903_+	hypothetical protein	A0A1B1P9H1	Acinetobacter_phage	5.5e-56	95.2
WP_169040855.1\|551905_552565_+	hypothetical protein	M4QPI3	Sulfitobacter_phage	1.2e-31	47.9
WP_169030859.1\|552561_552942_+	hypothetical protein	A0A0P0I8H3	Acinetobacter_phage	2.6e-39	83.0
WP_151002071.1\|552938_553148_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	3.1e-31	91.3
WP_031979886.1\|553144_553492_+	hypothetical protein	J7I0Y4	Acinetobacter_phage	1.7e-37	70.7

DBSCAN-SWA_6

1277927 : 1345930

Escherichia_phage(21.43%)

transposase,holin,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_169031064.1\|1277927_1279190_+\|transposase	IS1380-like element ISEc9 family transposase	A0A1B0VDR3	Salmonella_phage	3.8e-39	98.8
WP_000239590.1\|1279445_1280321_+	class A extended-spectrum beta-lactamase CTX-M-15	A0A1B0VBP7	Salmonella_phage	1.1e-125	82.4
WP_001393253.1\|1280367_1280700_-	cupin fold metalloprotein, WbuC family	NA	NA	NA	NA
WP_047389788.1\|1283021_1283726_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	4.0e-139	99.6
WP_002063889.1\|1284919_1285462_-	AAA family ATPase	NA	NA	NA	NA
WP_000557452.1\|1285474_1286335_-	aminoglycoside N-acetyltransferase AAC(3)-IIe	NA	NA	NA	NA
WP_001067855.1\|1286441_1287146_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000269732.1\|1287756_1288008_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_000214980.1\|1288180_1288708_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	3.6e-15	33.5
WP_032000401.1\|1288922_1290248_-	guanine deaminase	NA	NA	NA	NA
WP_038405403.1\|1290304_1291360_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_032000400.1\|1291650_1292811_-	glutathionylspermidine synthase family protein	E5E3Y5	Acinetobacter_phage	8.2e-97	45.0
WP_001256727.1\|1292832_1293198_-	hypothetical protein	NA	NA	NA	NA
WP_000447690.1\|1293386_1294343_-	TerC family protein	A0A1D7XFL1	Escherichia_phage	2.2e-31	32.5
WP_000051335.1\|1294661_1295258_-	undecaprenyl-diphosphatase	NA	NA	NA	NA
WP_169031063.1\|1295393_1296644_+	low temperature requirement protein A	NA	NA	NA	NA
WP_002061463.1\|1296713_1298087_-	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase	NA	NA	NA	NA
WP_085943970.1\|1298328_1298691_+	DMT family protein	NA	NA	NA	NA
WP_032000398.1\|1298874_1299387_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	4.4e-18	40.3
WP_000361788.1\|1299396_1300518_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_111818079.1\|1301289_1302498_+	lytic murein transglycosylase	NA	NA	NA	NA
WP_001985173.1\|1302547_1302934_-	hypothetical protein	NA	NA	NA	NA
WP_038405404.1\|1303035_1303941_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_038405405.1\|1304126_1305044_-\|protease	matrixin family metalloprotease	W6JIV8	Anomala_cuprea_entomopoxvirus	5.8e-05	46.9
WP_001062605.1\|1305374_1307315_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	2.2e-147	48.3
WP_057048784.1\|1307469_1308024_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_000765244.1\|1309188_1310055_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_000733015.1\|1310445_1310676_+	hypothetical protein	NA	NA	NA	NA
WP_032000782.1\|1310850_1311177_-	hypothetical protein	NA	NA	NA	NA
WP_000123590.1\|1311387_1312458_+	alpha/beta hydrolase	A0A2K9L3Q5	Tupanvirus	9.8e-12	27.3
WP_011860268.1\|1312673_1313159_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	2.5e-15	37.7
WP_002009323.1\|1319015_1319357_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_000964178.1\|1319402_1319945_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_000136002.1\|1320078_1320561_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_001133879.1\|1320562_1321093_-	signal peptidase II	NA	NA	NA	NA
WP_001281029.1\|1321085_1323923_-\|tRNA	isoleucine--tRNA ligase	A0A2K9L260	Tupanvirus	9.4e-78	27.0
WP_000771825.1\|1323984_1324986_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_032000160.1\|1325193_1326327_+	TDT family transporter	NA	NA	NA	NA
WP_001090744.1\|1326407_1326974_+	MTA/SAH nucleosidase	NA	NA	NA	NA
WP_001186827.1\|1327008_1327629_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000183286.1\|1327889_1328690_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	4.3e-28	36.9
WP_000031022.1\|1328703_1329501_-	aliphatic sulfonate ABC transporter permease SsuC	NA	NA	NA	NA
WP_032000158.1\|1329497_1330673_-	FMNH2-dependent alkanesulfonate monooxygenase	NA	NA	NA	NA
WP_002069754.1\|1330699_1331683_-	sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001173275.1\|1331754_1332723_-	sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001142457.1\|1333056_1334412_-	amino-acid N-acetyltransferase	NA	NA	NA	NA
WP_000724539.1\|1334532_1334853_-	RcnB family protein	NA	NA	NA	NA
WP_014462675.1\|1335075_1335432_-	RcnB family protein	NA	NA	NA	NA
WP_000877608.1\|1335703_1336450_-	YciK family oxidoreductase	NA	NA	NA	NA
WP_000973871.1\|1336515_1337217_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_000080757.1\|1337213_1337927_-	bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase	NA	NA	NA	NA
WP_000737567.1\|1338106_1338724_+	thiol:disulfide interchange protein DsbA/DsbL	NA	NA	NA	NA
WP_001047028.1\|1338802_1339450_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000027529.1\|1339586_1340225_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_032000154.1\|1340398_1341424_+	ferredoxin reductase	NA	NA	NA	NA
WP_111818219.1\|1341454_1342597_+	acyl-CoA desaturase	NA	NA	NA	NA
WP_001217232.1\|1342755_1343472_+	ribonuclease PH	NA	NA	NA	NA
WP_032000150.1\|1343761_1345930_+\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA

DBSCAN-SWA_7

1525540 : 1534783

uncultured_Caudovirales_phage(75.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000192758.1\|1525540_1526608_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	7.1e-95	58.7
WP_001172025.1\|1526709_1527663_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	2.4e-62	43.1
WP_000174605.1\|1527680_1528385_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-92	70.9
WP_000068656.1\|1528390_1529434_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_000670219.1\|1529441_1529915_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	3.9e-37	53.2
WP_169031061.1\|1529921_1530242_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	5.1e-25	62.6
WP_001275666.1\|1530299_1530734_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	2.9e-39	56.5
WP_169031060.1\|1530936_1531464_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	4.6e-39	45.7
WP_001219642.1\|1531556_1531964_-	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_000041516.1\|1532059_1532956_+	cation transporter	NA	NA	NA	NA
WP_005136949.1\|1532959_1533472_+	signal peptidase II	NA	NA	NA	NA
WP_000137809.1\|1533493_1534783_+\|transposase	ISL3-like element ISPpu12 family transposase	A0A2D1GQC1	Lysinibacillus_phage	9.5e-86	40.4

DBSCAN-SWA_8

2160020 : 2182787

Acinetobacter_phage(58.06%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001033994.1\|2160020_2160494_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	4.2e-23	42.3
WP_000401871.1\|2160595_2160796_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_169031048.1\|2160795_2161011_-	hypothetical protein	I2GUB6	Acinetobacter_phage	6.9e-34	94.4
WP_064191109.1\|2161007_2161220_-	hypothetical protein	NA	NA	NA	NA
WP_169031047.1\|2161216_2161426_-	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	5.3e-31	92.8
WP_169030859.1\|2161422_2161803_-	hypothetical protein	A0A0P0I8H3	Acinetobacter_phage	2.6e-39	83.0
WP_151002144.1\|2161799_2162459_-	hypothetical protein	M4QPI3	Sulfitobacter_phage	1.5e-31	47.9
WP_151002142.1\|2162461_2162776_-	hypothetical protein	A0A1B1P9H1	Acinetobacter_phage	5.5e-56	95.2
WP_151002140.1\|2162783_2162993_-	hypothetical protein	A0A1B1P9G5	Acinetobacter_phage	1.9e-28	94.2
WP_169031046.1\|2163057_2163858_-	hypothetical protein	I2GUJ1	Acinetobacter_phage	2.5e-60	51.4
WP_169031045.1\|2163850_2164078_-	hypothetical protein	NA	NA	NA	NA
WP_169031044.1\|2164077_2164278_-	hypothetical protein	NA	NA	NA	NA
WP_169031043.1\|2164280_2165315_-	hypothetical protein	A0A0U4B0I3	Pseudomonas_phage	1.6e-30	67.8
WP_025467970.1\|2165526_2166483_-	hypothetical protein	A0A1R3Y6Z6	Salmonella_virus	2.1e-53	36.5
WP_086227449.1\|2166531_2166753_-	hypothetical protein	A0A0P0I8I5	Acinetobacter_phage	3.7e-30	97.2
WP_031975139.1\|2166762_2167509_-	helix-turn-helix domain-containing protein	A0A1B1P9J5	Acinetobacter_phage	7.4e-107	79.3
WP_001100147.1\|2167614_2167803_+	hypothetical protein	NA	NA	NA	NA
WP_002052638.1\|2167811_2168087_+	hypothetical protein	NA	NA	NA	NA
WP_169031042.1\|2168128_2168284_+	hypothetical protein	A0A1B1P9H5	Acinetobacter_phage	3.4e-14	82.4
WP_114205038.1\|2168283_2169120_+	hypothetical protein	NA	NA	NA	NA
WP_031989348.1\|2169119_2170436_+	AAA family ATPase	A0A2H4J6D5	uncultured_Caudovirales_phage	1.2e-165	75.4
WP_114205037.1\|2170432_2170690_+	hypothetical protein	A0A2H4J6Z3	uncultured_Caudovirales_phage	1.6e-21	60.3
WP_169031041.1\|2170686_2170863_+	hypothetical protein	A0A1B1P9H7	Acinetobacter_phage	5.0e-22	94.8
WP_169031040.1\|2170859_2171327_+	hypothetical protein	A0A0A0RTI7	Acinetobacter_phage	4.0e-10	32.0
WP_141991932.1\|2171313_2171709_+	HNH endonuclease	Q3HQV7	Burkholderia_phage	8.0e-28	48.5
WP_169031039.1\|2171701_2171974_+	hypothetical protein	E2GLW0	Acinetobacter_phage	2.9e-13	50.0
WP_169031038.1\|2172451_2172814_+	hypothetical protein	A0A220NQK3	Acinetobacter_phage	2.1e-46	88.2
WP_169031037.1\|2172817_2173219_+	hypothetical protein	A0A1B1P9J0	Acinetobacter_phage	1.2e-71	99.2
WP_000990564.1\|2173389_2173869_+	hypothetical protein	A0A0P0I4C3	Acinetobacter_phage	8.2e-27	42.3
WP_169031036.1\|2174132_2174534_+	hypothetical protein	A0A0F6TJP2	Escherichia_coli_O157_typing_phage	6.5e-25	50.0
WP_169031035.1\|2174767_2174941_+	hypothetical protein	A0A0D4DBK3	Acinetobacter_phage	3.7e-22	92.7
WP_169031034.1\|2174933_2175215_+	hypothetical protein	A0A0D4DC07	Acinetobacter_phage	2.2e-35	76.3
WP_169031033.1\|2175269_2175734_+	hypothetical protein	NA	NA	NA	NA
WP_031975119.1\|2175779_2176049_+	hypothetical protein	NA	NA	NA	NA
WP_038405824.1\|2176207_2176690_+	hypothetical protein	A0A2H4JDI9	uncultured_Caudovirales_phage	1.1e-58	68.0
WP_153886525.1\|2176692_2176842_+	hypothetical protein	NA	NA	NA	NA
WP_057048730.1\|2176850_2177273_+\|terminase	terminase small subunit	A0A0D4DCN4	Acinetobacter_phage	3.8e-68	93.5
WP_169031032.1\|2177247_2178528_+\|terminase	PBSX family phage terminase large subunit	L7TP33	Pseudomonas_virus	6.1e-77	41.5
WP_057048728.1\|2178554_2180621_+	hypothetical protein	U6C855	Ralstonia_phage	7.9e-151	46.8
WP_169031031.1\|2180613_2181516_+	hypothetical protein	U6C6Y4	Ralstonia_phage	8.5e-33	37.2
WP_038405679.1\|2181530_2182787_+	hypothetical protein	U6C6F9	Ralstonia_phage	4.5e-141	61.2

DBSCAN-SWA_9

2190225 : 2199526

Acinetobacter_phage(37.5%)

holin,integrase

attL 2183603:2183615|attR 2200418:2200430

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2183603:2183615	attL	NA	NA	NA	NA
WP_151299206.1\|2190225_2191215_+	phage antirepressor N-terminal domain-containing protein	G9L6D8	Escherichia_phage	1.2e-43	43.7
WP_169031025.1\|2191511_2193992_+	hypothetical protein	A0A0F6WDD1	Pseudomonas_phage	6.9e-08	32.8
WP_169031024.1\|2194078_2196100_+	hypothetical protein	A0A2H4PIX9	Corynebacterium_phage	3.7e-12	34.3
WP_141991853.1\|2196173_2196464_+\|holin	holin	NA	NA	NA	NA
WP_057048716.1\|2196447_2196954_+	lysozyme	A0A0B5L5F7	Acinetobacter_phage	9.2e-69	75.9
WP_032031847.1\|2197042_2197237_+	hypothetical protein	A0A1B1P9F8	Acinetobacter_phage	3.7e-26	90.6
WP_032031848.1\|2197233_2198448_-\|integrase	tyrosine-type recombinase/integrase	A0A0P0IRB7	Acinetobacter_phage	7.7e-122	55.9
WP_000047853.1\|2198769_2199261_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	3.7e-30	44.3
WP_001979799.1\|2199262_2199526_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	2.4e-20	58.0
2200418:2200430	attR	NA	NA	NA	NA

DBSCAN-SWA_10

2268042 : 2276139

Acinetobacter_phage(57.14%)

integrase

attL 2262853:2262865|attR 2273035:2273047

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2262853:2262865	attL	NA	NA	NA	NA
WP_000947475.1\|2268042_2269200_+\|integrase	site-specific integrase	A0A2H4J339	uncultured_Caudovirales_phage	4.9e-134	63.0
WP_001076477.1\|2269196_2270081_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_000549863.1\|2270071_2270527_+	hypothetical protein	NA	NA	NA	NA
WP_000527288.1\|2270641_2271634_+	FRG domain-containing protein	NA	NA	NA	NA
WP_000119264.1\|2271640_2271811_-	hypothetical protein	A0A2H4JBW6	uncultured_Caudovirales_phage	2.4e-13	69.2
WP_001292077.1\|2271811_2272027_-	hypothetical protein	I2GUB6	Acinetobacter_phage	8.5e-32	92.9
WP_000028957.1\|2272023_2272233_-	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	6.3e-32	94.2
WP_000578497.1\|2272229_2272739_-	phage protein	A0A0P0I8H3	Acinetobacter_phage	1.6e-33	87.8
WP_032003041.1\|2272735_2273272_-	hypothetical protein	NA	NA	NA	NA
2273035:2273047	attR	NA	NA	NA	NA
WP_000464381.1\|2273264_2273444_-	hypothetical protein	NA	NA	NA	NA
WP_000986115.1\|2273444_2273735_-	hypothetical protein	NA	NA	NA	NA
WP_000805204.1\|2273875_2274904_-	ead/Ea22-like family protein	A0A2I7QY11	Vibrio_phage	3.8e-13	29.0
WP_023060560.1\|2274916_2275597_-	DNA polymerase III subunit epsilon	NA	NA	NA	NA
WP_001260065.1\|2275767_2276139_-	hypothetical protein	A0A0D4DCB5	Acinetobacter_phage	1.4e-10	40.6

DBSCAN-SWA_11

2280895 : 2288465

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_057691128.1\|2280895_2281537_+	hypothetical protein	Q1MVG0	Enterobacteria_phage	4.6e-49	48.1
WP_169031019.1\|2281539_2283099_+	DNA cytosine methyltransferase	Q5QF27	Pseudomonas_virus	4.0e-131	42.1
WP_169031018.1\|2283102_2284146_+	hypothetical protein	A0A2H4J580	uncultured_Caudovirales_phage	4.3e-28	52.8
WP_000994861.1\|2284142_2284907_+	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	1.0e-63	48.8
WP_016141749.1\|2284903_2285431_+	hypothetical protein	NA	NA	NA	NA
WP_169030925.1\|2285433_2286165_+	hypothetical protein	NA	NA	NA	NA
WP_169030926.1\|2286161_2286662_+	hypothetical protein	A0A0A0RTI7	Acinetobacter_phage	1.9e-34	56.6
WP_169030840.1\|2286841_2287312_+	hypothetical protein	NA	NA	NA	NA
WP_098732747.1\|2287308_2287608_+	hypothetical protein	NA	NA	NA	NA
WP_169030927.1\|2287685_2288465_+	hypothetical protein	A0A0P0J0C5	Acinetobacter_phage	3.2e-28	31.6

DBSCAN-SWA_12

2508002 : 2518447

Acinetobacter_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000004579.1\|2508002_2508725_-	hypothetical protein	A0A0P0HSE1	Acinetobacter_phage	1.7e-55	88.2
WP_000147323.1\|2508721_2509129_-	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	7.5e-13	52.2
WP_000654848.1\|2509129_2509381_-	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	1.1e-38	98.7
WP_057048865.1\|2509382_2510273_-	hypothetical protein	A0A0P0IKV7	Acinetobacter_phage	3.1e-136	75.1
WP_057048866.1\|2510269_2511430_-	ATP-binding protein	A0A0D4DBX7	Acinetobacter_phage	1.9e-125	61.4
WP_057048867.1\|2511440_2511764_-	hypothetical protein	A0A0P0IVW1	Acinetobacter_phage	6.5e-44	80.4
WP_057048868.1\|2511756_2512047_-	hypothetical protein	A0A0P0IDU2	Acinetobacter_phage	1.1e-45	91.7
WP_057048869.1\|2512046_2512487_-	hypothetical protein	A0A0D4DBH9	Acinetobacter_phage	3.7e-74	96.6
WP_057048870.1\|2512711_2513497_-	helix-turn-helix domain-containing protein	A0A0P0J076	Acinetobacter_phage	8.1e-80	80.7
WP_009392811.1\|2513626_2513848_+	hypothetical protein	NA	NA	NA	NA
WP_000041060.1\|2513856_2514213_+	hypothetical protein	J7I452	Acinetobacter_phage	2.2e-56	96.6
WP_057048871.1\|2514273_2514561_+	hypothetical protein	NA	NA	NA	NA
WP_169031010.1\|2514553_2515435_+	replication protein	A0A0P0IKQ2	Acinetobacter_phage	4.7e-129	90.1
WP_057048972.1\|2515437_2516238_+	hypothetical protein	A0A0P0IDV1	Acinetobacter_phage	9.9e-142	93.2
WP_057048973.1\|2516234_2516702_+	adenine methyltransferase	S5MUL8	Brevibacillus_phage	4.1e-47	57.9
WP_153886542.1\|2516698_2516812_+	putative phage replication protein	A0A0P0IR92	Acinetobacter_phage	1.8e-09	83.8
WP_057048974.1\|2516808_2517216_+	DUF1064 domain-containing protein	A0A0R6PIZ9	Moraxella_phage	2.3e-22	50.9
WP_057048975.1\|2517218_2517632_+	antitermination protein	NA	NA	NA	NA
WP_057048978.1\|2518237_2518447_+	hypothetical protein	A0A0D4DCM7	Acinetobacter_phage	3.6e-11	52.5

DBSCAN-SWA_13

2521934 : 2558579

Acinetobacter_phage(66.67%)

terminase,integrase,tail,capsid

attL 2536853:2536867|attR 2560574:2560588

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_057048932.1\|2521934_2522126_+	hypothetical protein	J7I0V8	Acinetobacter_phage	2.3e-20	77.8
WP_057048933.1\|2522122_2522755_+	hypothetical protein	A0A1B1P9K3	Acinetobacter_phage	1.3e-59	54.8
WP_057048934.1\|2522800_2523352_+	DUF2280 domain-containing protein	A0A0P0IKR0	Acinetobacter_phage	2.7e-37	62.7
WP_169031008.1\|2523335_2524652_+\|terminase	terminase	A0A0N7IRE3	Acinetobacter_phage	2.7e-261	97.5
WP_057048936.1\|2524691_2526032_+	DUF4055 domain-containing protein	A0A0P0IDW1	Acinetobacter_phage	4.4e-243	94.6
WP_057048937.1\|2526041_2527148_+\|capsid	minor capsid protein	A0A0P0IR98	Acinetobacter_phage	3.4e-185	86.4
WP_057048961.1\|2527368_2527920_+	hypothetical protein	A0A2I7RHW2	Vibrio_phage	9.5e-19	69.0
WP_057048938.1\|2528008_2528800_+	hypothetical protein	A0A0P0J090	Acinetobacter_phage	8.4e-93	79.4
WP_057048939.1\|2528813_2529764_+	hypothetical protein	A0A0P0HSG2	Acinetobacter_phage	1.4e-174	96.5
WP_016804112.1\|2529808_2530144_+	HeH/LEM domain protein	A0A0N7IRE4	Acinetobacter_phage	5.7e-51	96.4
WP_044102983.1\|2530147_2530528_+	hypothetical protein	A0A0P0IVQ3	Acinetobacter_phage	4.5e-52	82.5
WP_057048940.1\|2530527_2530899_+	hypothetical protein	A0A0P0I456	Acinetobacter_phage	2.1e-62	96.7
WP_169040857.1\|2530983_2531784_+	hypothetical protein	NA	NA	NA	NA
WP_057048942.1\|2531843_2532260_+	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	7.1e-51	72.6
WP_001983390.1\|2532225_2532594_+	hypothetical protein	A0A0D4DBN1	Acinetobacter_phage	5.1e-53	81.1
WP_153886541.1\|2532550_2532994_+	hypothetical protein	A0A0D4DBX3	Acinetobacter_phage	8.6e-63	78.2
WP_004700304.1\|2532995_2533208_+	hypothetical protein	A0A0P0I8C2	Acinetobacter_phage	8.4e-24	84.1
WP_057048944.1\|2533312_2534248_+	hypothetical protein	A0A059VG08	Pseudomonas_phage	2.0e-53	38.7
WP_057048945.1\|2534297_2534810_+	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	1.9e-45	60.5
WP_057048946.1\|2535159_2535342_+	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	2.6e-26	93.2
WP_004700312.1\|2535406_2535811_+	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	2.1e-63	90.3
WP_057048947.1\|2535917_2536280_+	hypothetical protein	NA	NA	NA	NA
WP_057048948.1\|2536335_2536872_+	hypothetical protein	NA	NA	NA	NA
2536853:2536867	attL	NA	NA	NA	NA
WP_000758222.1\|2536883_2537285_+	hypothetical protein	NA	NA	NA	NA
WP_057048950.1\|2541535_2541790_+	hypothetical protein	NA	NA	NA	NA
WP_057048951.1\|2542040_2542316_+	hypothetical protein	NA	NA	NA	NA
WP_057048952.1\|2542729_2543074_+\|tail	phage tail protein	A0A0R6PHH7	Moraxella_phage	4.9e-13	42.2
WP_057048953.1\|2543127_2544288_+	hypothetical protein	U5PW98	Acinetobacter_phage	4.3e-37	57.9
WP_057048954.1\|2544274_2545081_+\|tail	phage minor tail protein L	A0A0R6PGU8	Moraxella_phage	2.0e-94	64.6
WP_057048955.1\|2545087_2545873_+	C40 family peptidase	A0A0R6PIM4	Moraxella_phage	2.8e-80	53.9
WP_049594768.1\|2545878_2546217_+	hypothetical protein	NA	NA	NA	NA
WP_057048956.1\|2546286_2546952_+\|tail	tail assembly protein	A0A0R6PIW1	Moraxella_phage	2.3e-43	48.6
WP_169031007.1\|2547004_2551405_+	host specificity protein J	A0A0R6PIC9	Moraxella_phage	0.0e+00	65.2
WP_057048958.1\|2551401_2551962_+	DUF4376 domain-containing protein	A0A172Q0F8	Acinetobacter_phage	6.3e-26	44.7
WP_057048959.1\|2552027_2552417_+	hypothetical protein	J7I481	Acinetobacter_phage	6.8e-64	94.6
WP_057048960.1\|2552459_2553002_+	N-acetylmuramidase	A0A0D4DCJ5	Acinetobacter_phage	2.6e-93	91.1
WP_169031073.1\|2553238_2553838_-	hypothetical protein	NA	NA	NA	NA
WP_057048844.1\|2553936_2555235_-	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	1.7e-159	61.5
WP_045899668.1\|2555231_2555729_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	1.3e-43	58.3
WP_057048845.1\|2555876_2556512_-	SOS response-associated peptidase family protein	A0A218MNF5	uncultured_virus	1.7e-67	56.5
WP_057048846.1\|2556627_2557116_-	hypothetical protein	NA	NA	NA	NA
WP_079745226.1\|2557205_2558579_-\|integrase	integrase family protein	A0A0R6PGY7	Moraxella_phage	9.5e-76	41.1
2560574:2560588	attR	NA	NA	NA	NA

DBSCAN-SWA_14

3090254 : 3113895

Acinetobacter_phage(40.91%)

head,terminase,integrase,tail

attL 3085071:3085086|attR 3093947:3093962

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3085071:3085086	attL	NA	NA	NA	NA
WP_068544619.1\|3090254_3091214_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P9F9	Acinetobacter_phage	1.3e-47	35.4
WP_032040976.1\|3091179_3091431_-	hypothetical protein	NA	NA	NA	NA
WP_032014841.1\|3091451_3091655_-	hypothetical protein	NA	NA	NA	NA
WP_169030987.1\|3091651_3091999_-	hypothetical protein	NA	NA	NA	NA
WP_169030841.1\|3091995_3092610_-	hypothetical protein	A0A0P0I8H3	Acinetobacter_phage	6.8e-42	78.9
WP_000214186.1\|3092606_3092840_-	protein ninH	NA	NA	NA	NA
WP_169030986.1\|3092836_3094318_-	AAA family ATPase	A0A075DXT4	Acinetobacter_phage	5.1e-67	34.8
3093947:3093962	attR	NA	NA	NA	NA
WP_169030985.1\|3094389_3095322_-	transcriptional regulator	A0A2H4J6I3	uncultured_Caudovirales_phage	5.0e-52	64.8
WP_151983446.1\|3095333_3096314_-	YqaJ viral recombinase family protein	A0A0A7RWR9	Clostridium_phage	3.7e-50	36.0
WP_169031071.1\|3096315_3096888_-	hypothetical protein	NA	NA	NA	NA
WP_169030984.1\|3097017_3097896_-	DUF2303 family protein	I6NVL7	Burkholderia_virus	8.6e-30	35.5
WP_001142429.1\|3097964_3098339_-	hypothetical protein	NA	NA	NA	NA
WP_169030983.1\|3098498_3099221_-	helix-turn-helix domain-containing protein	A0A0P0I8E0	Acinetobacter_phage	3.0e-49	47.5
WP_000432867.1\|3099342_3099546_+	helix-turn-helix domain-containing protein	A0A0P0IKT3	Acinetobacter_phage	6.2e-08	45.2
WP_169030982.1\|3099542_3099899_+	transcriptional regulator	J7I452	Acinetobacter_phage	2.3e-42	78.0
WP_000183472.1\|3099957_3100179_+	hypothetical protein	NA	NA	NA	NA
WP_169030981.1\|3100175_3101027_+	hypothetical protein	A0A220NQL7	Acinetobacter_phage	1.1e-21	33.5
WP_169030980.1\|3101023_3101569_+	hypothetical protein	A0A2I7QY11	Vibrio_phage	5.9e-13	28.1
WP_000126181.1\|3101565_3101937_+	hypothetical protein	NA	NA	NA	NA
WP_000053663.1\|3101933_3102761_+	DNA adenine methylase	Q5QF26	Pseudomonas_virus	9.5e-63	45.1
WP_169030979.1\|3102757_3103642_+	DUF1376 domain-containing protein	NA	NA	NA	NA
WP_000993236.1\|3103638_3104424_+	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	7.4e-57	49.0
WP_000034750.1\|3104416_3104845_+	hypothetical protein	A0A0P0HSP6	Acinetobacter_phage	8.1e-50	72.7
WP_001144535.1\|3104856_3105066_+	hypothetical protein	NA	NA	NA	NA
WP_169030978.1\|3105065_3105815_+\|terminase	terminase small subunit	A0A1Y0SUQ3	Pseudomonas_phage	1.4e-44	45.4
WP_140983301.1\|3106319_3106592_+	hypothetical protein	NA	NA	NA	NA
WP_169030977.1\|3106575_3108198_+\|terminase	terminase	Q775B9	Bordetella_phage	1.3e-188	60.7
WP_000337838.1\|3108275_3108530_+	hypothetical protein	NA	NA	NA	NA
WP_169030976.1\|3108531_3110223_+\|head,tail	phage head-tail adapter protein	T1S9Z7	Salmonella_phage	1.3e-71	32.4
WP_139887862.1\|3110219_3110552_+	hypothetical protein	NA	NA	NA	NA
WP_169030975.1\|3110517_3111201_+	hypothetical protein	A0A2I7RHR0	Vibrio_phage	1.7e-12	38.1
WP_083008891.1\|3111218_3112214_+	hypothetical protein	Q775C7	Bordetella_phage	4.0e-92	53.3
WP_006580593.1\|3112228_3112633_+	hypothetical protein	A0A193GYT9	Enterobacter_phage	1.2e-15	41.0
WP_169030974.1\|3112632_3112893_+	hypothetical protein	NA	NA	NA	NA
WP_151983478.1\|3112959_3113325_+	hypothetical protein	A0A0F6TJP2	Escherichia_coli_O157_typing_phage	3.1e-26	55.0
WP_169030973.1\|3113340_3113895_+	hypothetical protein	W6MVD9	Pseudomonas_phage	1.7e-07	25.7

DBSCAN-SWA_15

3737213 : 3744962

Acinetobacter_phage(80.0%)

integrase

attL 3737049:3737063|attR 3755730:3755744

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3737049:3737063	attL	NA	NA	NA	NA
WP_001108434.1\|3737213_3737978_+	S24 family peptidase	A0A0P0I8E0	Acinetobacter_phage	1.6e-77	63.0
WP_000794429.1\|3737981_3738266_+	hypothetical protein	NA	NA	NA	NA
WP_000183423.1\|3738459_3738798_+	hypothetical protein	A0A0P0ZGH3	Escherichia_phage	1.6e-13	39.3
WP_001072361.1\|3738878_3739208_+	hypothetical protein	NA	NA	NA	NA
WP_169030918.1\|3739204_3739576_+	hypothetical protein	A0A0D4DCB5	Acinetobacter_phage	1.9e-10	40.0
WP_169030917.1\|3739750_3740431_+	3'-5' exonuclease	NA	NA	NA	NA
WP_169030916.1\|3740443_3741472_+	ead/Ea22-like family protein	A0A2I7QY11	Vibrio_phage	1.0e-10	27.0
WP_169030915.1\|3741612_3741903_+	hypothetical protein	NA	NA	NA	NA
WP_000434519.1\|3741903_3742269_+	hypothetical protein	A0A1B1P9I4	Acinetobacter_phage	3.5e-54	83.3
WP_000655910.1\|3742274_3742562_+	hypothetical protein	A0A0P0J0F2	Acinetobacter_phage	1.2e-36	86.7
WP_006581312.1\|3742558_3742945_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	1.2e-12	50.7
WP_000993702.1\|3742941_3743424_+	methyltransferase domain-containing protein	A0A0N7IRF6	Acinetobacter_phage	4.3e-68	72.3
WP_000910238.1\|3743424_3743694_+	hypothetical protein	A0A0N7IRE8	Acinetobacter_phage	3.5e-43	100.0
WP_032057785.1\|3743699_3744962_-\|integrase	integrase family protein	A0A0P0IKP2	Acinetobacter_phage	5.2e-246	98.6
3755730:3755744	attR	NA	NA	NA	NA

DBSCAN-SWA_16

4071270 : 4084653

Acinetobacter_phage(37.5%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000457893.1\|4071270_4072524_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	2.3e-97	52.3
WP_001009255.1\|4072584_4072746_+	hypothetical protein	NA	NA	NA	NA
WP_031999476.1\|4072769_4073999_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_001147934.1\|4074248_4074935_+	DUF3820 family protein	A0A059VJT9	Pseudomonas_phage	1.8e-35	41.6
WP_161773330.1\|4075079_4075715_+	hypothetical protein	NA	NA	NA	NA
WP_000084539.1\|4075965_4076163_-	hypothetical protein	A0A1B1P9F8	Acinetobacter_phage	5.6e-30	96.9
WP_104919046.1\|4076289_4076832_-	hypothetical protein	J7I0Y1	Acinetobacter_phage	2.6e-93	89.4
WP_163072106.1\|4076834_4077224_-	hypothetical protein	A0A0D4DBQ9	Acinetobacter_phage	1.9e-61	92.1
WP_169030902.1\|4077305_4079477_-	hypothetical protein	A0A2H4PIX9	Corynebacterium_phage	1.2e-11	34.3
WP_169030901.1\|4079486_4081145_-\|terminase	phage terminase large subunit	A0A2H4JCA3	uncultured_Caudovirales_phage	7.6e-128	44.1
WP_017724836.1\|4081147_4081462_-	hypothetical protein	NA	NA	NA	NA
WP_163072102.1\|4081557_4082124_-	hypothetical protein	NA	NA	NA	NA
WP_163072101.1\|4082124_4084653_-	hypothetical protein	A0A0F7L5T6	uncultured_marine_virus	2.7e-52	25.4

DBSCAN-SWA_17

4092187 : 4099626

uncultured_Mediterranean_phage(28.57%)

head,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_169030869.1\|4092187_4092748_-	hypothetical protein	A0A1B1IRI7	uncultured_Mediterranean_phage	3.8e-23	36.3
WP_169030868.1\|4092808_4093177_-	hypothetical protein	A0A0F6TJP2	Escherichia_coli_O157_typing_phage	9.1e-26	55.4
WP_114259557.1\|4093243_4094143_-	hypothetical protein	A0A1B1IRE8	uncultured_Mediterranean_phage	2.9e-17	28.1
WP_169030867.1\|4094154_4094778_-	hypothetical protein	NA	NA	NA	NA
WP_169030866.1\|4094770_4095256_-	hypothetical protein	NA	NA	NA	NA
WP_046023847.1\|4095252_4096896_-\|head,tail	head-tail connector protein	A0A2H4J3N6	uncultured_Caudovirales_phage	4.3e-123	44.2
WP_046023848.1\|4096897_4097128_-	hypothetical protein	NA	NA	NA	NA
WP_046023849.1\|4097127_4097469_-	hypothetical protein	NA	NA	NA	NA
WP_031966083.1\|4097535_4097715_-	hypothetical protein	NA	NA	NA	NA
WP_031966085.1\|4097870_4098050_-	hypothetical protein	NA	NA	NA	NA
WP_000651148.1\|4098046_4098250_-	hypothetical protein	NA	NA	NA	NA
WP_151002055.1\|4098673_4098949_-	hypothetical protein	A0A0D4DBT5	Acinetobacter_phage	7.8e-06	59.5
WP_151002057.1\|4098941_4099313_-	HNH endonuclease	S4TWR6	Salmonella_phage	7.5e-28	47.0
WP_057048735.1\|4099299_4099626_-	hypothetical protein	A0A0P0I8J0	Acinetobacter_phage	5.2e-25	58.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP051870

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP051870_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051870_1

31297-31373

Orphan

Consensus_repeat	Method
CTTGTTGCAGTAGATGAACCAGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051870_1

>merge|NZ_CP051870|1|31297-31373|CRISPRCasFinder
CTTGTTGCAGTAGATGAACCAGATCCTCTGGCCATGATTGCAGAAATGGAAAATCTGGTTGCAGTAGATGAACCAGA

>NZ_CP051870|1|1|31297-31373|CRISPRCasFinder
CTTGTTGCAGTAGATGAACCAGA	TCCTCTGGCCATGATTGCAGAAATGGAAAAT
CTGGTTGCAGTAGATGAACCAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051870.1\|WP_169031080.1\|32150_33440_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376240
NZ_CP051870.1\|WP_026444411.1\|22728_23028_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051870.1\|WP_015060246.1\|37254_37866_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239736
NZ_CP051870.1\|WP_111818452.1\|24088_24790_+\|P-type-DNA-transfer-protein-VirB5	unknown	unknown	gnl\|CDD\|369643
NZ_CP051870.1\|WP_005006303.1\|35667_36546_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375596
NZ_CP051870.1\|WP_111818458.1\|34636_35647_-\|nucleotidyltransferase	unknown	unknown	gnl\|CDD\|375587
NZ_CP051870.1\|WP_026444417.1\|33859_34246_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051870.1\|WP_111818454.1\|25780_26674_+\|TrbG/VirB9-family-P-type-conjugative-transfer-protein	unknown	unknown	gnl\|CDD\|274296
NZ_CP051870.1\|WP_111818451.1\|23051_24077_+\|type-IV-secretion-system-protein	unknown	unknown	gnl\|CDD\|377390
NZ_CP051870.1\|WP_111818455.1\|26673_28098_+\|type-IV-secretion-system-protein-VirB10	unknown	unknown	gnl\|CDD\|319755
NZ_CP051870.1\|WP_026444415.1\|31858_32140_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051870.1\|WP_004644768.1\|19624_19930_+\|TrbC/VirB2-family-protein	unknown	unknown	gnl\|CDD\|368210
NZ_CP051870.1\|WP_005407440.1\|19929_20256_+\|VirB3-family-type-IV-secretion-system-protein	unknown	unknown	gnl\|CDD\|368285
NZ_CP051870.1\|WP_026444418.1\|34256_34481_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051870.1\|WP_111034398.1\|20263_22726_+\|VirB4-family-type-IV-secretion/conjugal-transfer-ATPase	unknown	unknown	gnl\|CDD\|273346
NZ_CP051870.1\|WP_005253250.1\|28078_29191_+\|P-type-DNA-transfer-ATPase-VirB11	unknown	unknown	gnl\|CDD\|274301
NZ_CP051870.1\|WP_111818453.1\|24953_25769_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226259
NZ_CP051870.1\|WP_169031081.1\|36706_37042_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051870.1\|WP_000155092.1\|38055_38940_-\|Mph(E)-family-macrolide-2'-phosphotransferase	unknown	unknown	gnl\|CDD\|270701
NZ_CP051870.1\|WP_000052512.1\|38995_40471_-\|ABC-F-type-ribosomal-protection-protein-Msr(E)	unknown	unknown	gnl\|CDD\|223562

Protein	Function_ID	Function_description	E-value
NZ_CP051870.1\|WP_169031080.1\|32150_33440_+\|hypothetical-protein	gnl\|CDD\|376240	pfam18821, LPD7, Large polyvalent protein-associated domain 7. This domain contains conserved aspartate and phenylalanine residues. It is widely present in polyvalent proteins and gene neighbourhoods of conjugative elements. This domain is also known as PTox1.	3.73659e-14
NZ_CP051870.1\|WP_015060246.1\|37254_37866_+\|recombinase-family-protein	gnl\|CDD\|239736	cd03767, SR_Res_par, Serine recombinase (SR) family, Partitioning (par)-Resolvase subfamily, catalytic domain; Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subgroup is composed of proteins similar to the E. coli resolvase found in the par region of the RP4 plasmid, which encodes a highly efficient partitioning system. This protein is part of a complex stabilization system involved in the resolution of plasmid dimers during cell division. Similar to Tn3 and other resolvases, members of this family may contain a C-terminal DNA binding domain.	1.50196e-59
NZ_CP051870.1\|WP_111818452.1\|24088_24790_+\|P-type-DNA-transfer-protein-VirB5	gnl\|CDD\|369643	pfam07996, T4SS, Type IV secretion system proteins. Members of this family are components of the type IV secretion system. They mediate intracellular transfer of macromolecules via a mechanism ancestrally related to that of bacterial conjugation machineries.	1.43238e-44
NZ_CP051870.1\|WP_005006303.1\|35667_36546_-\|hypothetical-protein	gnl\|CDD\|375596	pfam18159, S_4TM, SMODS-associating 4TM effector domain. Predicted pore-forming effector domain found in conserved genome contexts with diverse nucleotide synthetases including the SMODS synthetases. Predicted to function as a pore-forming effector in a class of conflict systems reliant on the production of second messenger nucleotide or nucleotide derivatives. S-4TM domains are predicted to initiate cell suicide responses upon their activation.	4.17246e-58
NZ_CP051870.1\|WP_111818458.1\|34636_35647_-\|nucleotidyltransferase	gnl\|CDD\|375587	pfam18144, SMODS, Second Messenger Oligonucleotide or Dinucleotide Synthetase domain. Nucleotide synthetase enzyme of the DNA polymerase beta superfamily. Experimental studies have demonstrated cGAMP synthetase activity in the Vibrio cholerae DncV protein, a member of the SMODS family. The diversity inherent to the SMODS family suggests members of the family could generate a range of nucleotides, cyclic and/or linear. The nucleotide second messengers generated by the SMODS domains are predicted to activate effectors in a class of conflict systems reliant on the production and sensing of the nucleotide second messengers.	1.09718e-08
NZ_CP051870.1\|WP_111818454.1\|25780_26674_+\|TrbG/VirB9-family-P-type-conjugative-transfer-protein	gnl\|CDD\|274296	TIGR02781, Protein_virB9, P-type conjugative transfer protein VirB9. The VirB9 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in a type IV secretion system . VirB9 is a homolog of the F-type conjugative transfer system TraK protein (which is believed to be an outer membrane pore-forming secretin, TIGR02756) as well as the Ti system TrbG protein. [Cellular processes, Conjugation].	2.91442e-57
NZ_CP051870.1\|WP_111818451.1\|23051_24077_+\|type-IV-secretion-system-protein	gnl\|CDD\|377390	pfam04610, TrbL, TrbL/VirB6 plasmid conjugal transfer protein.	5.46239e-31
NZ_CP051870.1\|WP_111818455.1\|26673_28098_+\|type-IV-secretion-system-protein-VirB10	gnl\|CDD\|319755	cd16429, VirB10, VirB10 forms part of core complex in Type IV secretion system (T4SS). This family contains VirB10, a component of the type IV secretion system (T4SS), including homologs TrbI, TraF, TrwE and TraL. T4S system is employed by pathogenic bacteria to export virulence DNAs and/or proteins directly from the bacterial cytoplasm into the host cell. It forms a large multiprotein complex consisting of 12 proteins termed VirB1-11 and VirD4. VirB10, interacts with VirB7 and VirB9, forming the membrane-spanning 'core complex' (CC), around which all other components assemble. The CC is inserted in both, the outer and inner membranes, playing a fundamental role as a scaffold for the rest of the T4SS components and actively participating in T4S substrate transfer through the bacterial envelope via conformational changes regulating channel opening and closing. TrwE in R33 plasmid has been shown to be anchored to the inner membrane and its C-terminal is necessary for conjugation; the transmembrane domains of TrwB and TrwE are involved in TrwB-TrwE interactions. TraF protein of the RP4 plasmid is involved in circularization of pilin subunits of P-type pili. In gonococcal genetic island (GGI) of Neisseria gonorrhoeae, T4SS encodes TrbI and circularization occurs via a covalent intermediate between the C terminus of putative pilin protein TraA and TrbI.	1.74802e-69
NZ_CP051870.1\|WP_004644768.1\|19624_19930_+\|TrbC/VirB2-family-protein	gnl\|CDD\|368210	pfam04956, TrbC, TrbC/VIRB2 family. Conjugal transfer protein, TrbC has been identified as a subunit of the pilus precursor in bacteria. The protein undergoes three processing steps before gaining its mature cyclic structure. This family also contains several VIRB2 type IV secretion proteins. The virB2 gene encodes a putative type IV secretion system and is known to be a pathogenicity factor in Bartonella species.	5.87386e-07
NZ_CP051870.1\|WP_005407440.1\|19929_20256_+\|VirB3-family-type-IV-secretion-system-protein	gnl\|CDD\|368285	pfam05101, VirB3, Type IV secretory pathway, VirB3-like protein. This family includes the Type IV secretory pathway VirB3 protein, that is found associated with bacterial inner and outer membranes. The family also includes the conjugal transfer protein TrbD family that contains a nucleotide binding motif and may provide energy for the export of DNA or the export of other Trb proteins.	1.43212e-15
NZ_CP051870.1\|WP_111034398.1\|20263_22726_+\|VirB4-family-type-IV-secretion/conjugal-transfer-ATPase	gnl\|CDD\|273346	TIGR00929, CAG_pathogenicity_island_protein_23, type IV secretion/conjugal transfer ATPase, VirB4 family. Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation).	0
NZ_CP051870.1\|WP_005253250.1\|28078_29191_+\|P-type-DNA-transfer-ATPase-VirB11	gnl\|CDD\|274301	TIGR02788, conjugal_transfer_protein, P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.	1.04117e-122
NZ_CP051870.1\|WP_111818453.1\|24953_25769_+\|hypothetical-protein	gnl\|CDD\|226259	COG3736, VirB8, Type IV secretory pathway, component VirB8 [Intracellular trafficking and secretion].	1.00439e-40
NZ_CP051870.1\|WP_000155092.1\|38055_38940_-\|Mph(E)-family-macrolide-2'-phosphotransferase	gnl\|CDD\|270701	cd05152, MPH2', Macrolide 2'-Phosphotransferase. MPH2' catalyzes the transfer of the gamma-phosphoryl group from ATP to the 2'-hydroxyl of macrolide antibiotics such as erythromycin, clarithromycin, and azithromycin, among others. Macrolides penetrate the bacterial cell and bind to ribosomes, where it interrupts protein elongation, leading ultimately to the demise of the bacterium. Phosphorylation of macrolides leads to their inactivation. Based on substrate specificity and amino acid sequence, MPH2' is divided into types I and II, encoded by mphA and mphB genes, respectively. MPH2'I inactivates 14-membered ring macrolides while MPH2'II inactivates both 14- and 16-membered ring macrolides. Enzymatic inactivation of macrolides has been reported as a mechanism for bacterial resistance in clinical samples. MPH2' is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	6.72435e-130
NZ_CP051870.1\|WP_000052512.1\|38995_40471_-\|ABC-F-type-ribosomal-protection-protein-Msr(E)	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	2.75095e-109

>NZ_CP051870.1|WP_005253250.1|28078_29191_+|P-type-DNA-transfer-ATPase-VirB11
MNSAQNNVLSKDVMVRQLLLPLEKFLKTKGVTEIAINAPNEVWTESNKGWEKHSINLEMAQITALANVIATYTNQRIGQENPILSAQLPDGERIQIVLPPAIENGTVSMTIRIPDESNRSFQEYKDQGFFDHFRYGKSKEFEQFKPVLRTEDIKLVQFLENKDLEGFFKFAVQCKKNIAVVGDTGSGKTTFMKAICQYIPKDERLVTIEDVRELFVPHENKVHLLYSKGGQGKAKVTPSDLIASNMRMKPDRVLLAELRGGEAFDFLKLLTTGHSGSITSYHAESCSLAYDRYVFMCKEHEQANIYDATTLKELVALTIDIIVHVEVKKKYDDESNLIGKERFISEIKFDPVSKVKAQFGDAEIIVGDRA
>NZ_CP051870.1|WP_111818455.1|26673_28098_+|type-IV-secretion-system-protein-VirB10
MNINDQKPLDDQQAPDEEFNESENGIVSVNERGDQEDGKGKKIAFIAVMAVLFTVIAVFAYNFFSDSSDAEEAAQLKENQIDPSLDASTKRRDFTNTDPMPMDAGQNAQFQSLDACQDQSIPRQLTDNNGNAVTYNGMLVFQCQNGQQILRQPEAAPVVEQQAANQQPVVIQPQPQQQAQYVPLNNGSRYGGGIFVNSSQQGGAVGQPSSMNHQAAYNQVTGMMKQFEQDQNSNSRSGNFSGSGLMSLAHDDDEPMQQHQPQQATTNMVSHSSNKVQARFIGDRNYLIAKGRVIRCNLSVKVVSEIGGMASCVLPQPVYSDNGRVVLAEAGSEVIGEYKSIAAQGQRRLGIIWSRLKTPHGVIVDIDSPAADHLGTGGLSGRVDNRWGARIGAAFMLSLVQDAIAYGISKETGGNNSTPYMLQNTSDMGKSMAETVLNETINIKPTIYKNQGDVASIYVAKDIDFRGVYELRAK
>NZ_CP051870.1|WP_111818454.1|25780_26674_+|TrbG/VirB9-family-P-type-conjugative-transfer-protein
MKKLILALGLAVHGISYAAITPKALPTDSRIRTINYVPNDVYRITVKKGTVTRIVLGEDERILERGAATGYPSDCEKDDTNWCIFADTGSNLVWVKPKDKATRNNLELRTNKRDYSFDFQVLKNANEKPMYRVVFKYPQEEEEKRKQEEAQRYNAYAAQLKEESQLTEFLVLQHRLANAAPIPKNWNYRQAANSKGKHFVPEMLFDDGRFTYMRFKGNTDIPVVFIEGTEGEEKVNFHISKEDPKLLIVEALAKKFVLRQGKGVVSIFNESYDPVGVAPQDGTTVEGVKRVITGDMN
>NZ_CP051870.1|WP_111818453.1|24953_25769_+|hypothetical-protein
MNKLKKVSAAEEAKSYEKAMDWEADLIAMRAKSERKAWTIAKVAVGVAVLEAIGLVTLAPMRQTVPVVFTVDKAQGNVEYVGVVDDQQVKGKQELIDKNNITRYVTARESYFYPLLQPDYDLVMTMSSNQVGNDFASLYEGDSARDKKYGKKYELKVDVISVQTNQDETGFTASVRFTKTLHSVEANRDEQPQYYIASIRYEYAPNNLNKLVEKDLIKNPFGFKVVGYRVDPELSPNRPVAQAAVIEPSQQVYVPIQQGGAAVQPQAQQGM
>NZ_CP051870.1|WP_111818452.1|24088_24790_+|P-type-DNA-transfer-protein-VirB5
MKKQLLALGLGSSLFISGQANATGIPVIDGANLVQAVQNMVAWGEQYNQMVNQIQQAKQQYDSITGIRGFGDAVNNPYLKDVIPSDVADIYKGIQQGGVNGMTSAARNIRDATMVYDCASRTGQNYKACQAALNNNAQTQALNQQALGVADLRTEQIDNLRKQINNTTDAKAIAELQARIQTEQSQVANDANRIALMQAQAQAQKDAAQQLEIEGRLKRAAQKGNILDGYSGN
>NZ_CP051870.1|WP_111818451.1|23051_24077_+|type-IV-secretion-system-protein
MAIITTLETKIDSLLASYVTGVSSNIASAIVPIALTAATIYILIIGYNIATGAQEDSIYTALWKFFKIAFVGGIALSAGVYQSFVVEAINGLAIGLIQIVSPGGESSLGALLDQVSVPWGELIQKLGEEAESASGVFPDIGLYLSAAVVSVAQFLLFFIGTGLYLLAKISLQLCLGVGPIFILCAMFPATQKYFESWLSQTLSYVFTIGFITAIISMLFAFVSGMCTQIANNFDAGDILTSVVSLCIVAGTIVVIMWNIPTMASAITGGAGVQGVGRAVAQAITKGRGGNNSKSDSASATPTTGGSVQGNSSSSNNSNSSNTGGSKPLYQRHTLSNLKRNK
>NZ_CP051870.1|WP_026444411.1|22728_23028_+|hypothetical-protein
MTKFLALSSLLVISTLTTACSDDKEQVKQLKEEVKAAQQLKPQDLTAEQQEELKQRKARASQKGNILDEYDPSAPQKSVKPETKKGSGNILDGYNPDSK
>NZ_CP051870.1|WP_111034398.1|20263_22726_+|VirB4-family-type-IV-secretion/conjugal-transfer-ATPase
MRSKQQVKDSANAEVAISDYLPFGNHVSNNVIKLKNGEYIATWKLEGISFETVEADIIRIRKEGLNNFYRALGGGHFAVWTHKIRRGVNERLNGVYENDFIADFNERYYQQFQGEKNKQMATELYLTILYRPEISRLTKIFKSKASRDPVALKKQIKRDLDILDDVAKQVEASLYHYNPERLATYTKKGFVYSEMCNLLGFLTNGVWEEIPLRQANLDQYIPSSRLFFGDKNGYLQIKHPEAQKYVGFLDIQEFPRLSESGMCNSILYGNYEYIETQSFTVYGKRDAVDKLKTIKGQLNSVEDVSDQEIRDIDLAMSEANSGNFQLGEYHYTLAIFGDSPNQVALNVSSARTALSDEAGFKMAVIDTVPECAWFSQLAGNFNMRPREAYLTSLNFSALSPFHNFARGKRDGNPWGEALALFKTPSGQPFYFNHHVSPDKQDSTDDKMPGNTCVIGTTGVGKTTLVMAMMMFACKYKNLKGVFFDKDRGAEIGIRRIGGQYYALERGVPTGFNPLQLPPTETNIQFVEKLVKILVGGVRNAAEDLEISQAVRTIMRDDMPLELRRLSALYMNLKVNGGGDSLQDRLAKWCNTADHDGNLSWVFDNPYDTQDFSKAKMPIFGYDYTEFLDDPEVRTPIMAYLLHITDSLIDGSPFIYWMDEFWKPLTDEYFKDFAKDKQKTIRKLNGLGVFMTQSPSDVLDSDIGKTMVEQSVTQIFLPNPRADYDDYVNGFKVTPQEFEIIRELEENSRMFLVKQGSRSALCKMDLGEMRDVLQIISGSKDNVELLENLMNEVGEDPNDWGELFLQRIAERKKLISEKGVA
>NZ_CP051870.1|WP_005407440.1|19929_20256_+|VirB3-family-type-IV-secretion-system-protein
MSNFSDPIFRGCTRPAMLFGVPMLPFLLVTGVAILLAGWSFYLLSAYVTLFIAAIYVPIYFWMRAITKVDDQRLKQVLMRWRIRGKQIQNHQKWGAISFSPLKLKKRK
>NZ_CP051870.1|WP_004644768.1|19624_19930_+|TrbC/VirB2-family-protein
MKANQTQITTTKTTGIKASVLMLFMTLISSPAFAQISKVNTVMANVQSVLAGVAVTVFTITIMWAGFKLAWQQAKWSDISNIVIGGILVGGAAGIAAWLIN
>NZ_CP051870.1|WP_026444415.1|31858_32140_+|hypothetical-protein
MKKISLTLISLALSFSVVGCTSNKAVTSPNGFSSKAVNHPDTVKNYMQSIVVYQQNKDLSTETERQIALLTDKYIQTKMIIDEAARRQNISNQ
>NZ_CP051870.1|WP_169031080.1|32150_33440_+|hypothetical-protein
MTEANKVDKPSFNKEQTGYTKLGQTLETNQAEANSIEKAENIDISKSTKGINQDPEETKVTDTKKLKADDSKEPSEEGIPKALLNKYYVVDDKYHFKGNPEKVAFEDSGKALKTTIDDKHIAASMVEVAKAKKWETIQVKGSEEFKRNVWLEASMKGMTVKGYEPRDIDLALLNDMKKEQGKEVIPNTIEKGNEHQKEKPLNEKDKVDPTQERKEKINNLSEQEKALLTVFDKKMKADGFTEKQRTASIDVAVEQLNQKKMHVGKLVDHGAAPYEHDPKNNSSYYATIENSKGEKNTIWAKDLERTLKEQNIIKNDDIVLTYKGSNKVEVNTKEIDPKTGLPTGARVQTLANKGKWEAQSLSKLKETTEKALTKNDKTKLQIQHNADIQNQKFHKPKLTAYDANAPKQQPVQQPQVKTQERNKNKDISR
>NZ_CP051870.1|WP_026444417.1|33859_34246_+|hypothetical-protein
MTNADFKLLVESLGFYNPEAVKDYFKAIGFNESINVRPIQYWLNGKSVALNMPIPDDVVEHFKQLEQMKIELSSQEKFKKNTFLYKDKYLMWEKFPELNGLPCTYLNQLMILVNMLHGYREMQYCTSY
>NZ_CP051870.1|WP_026444418.1|34256_34481_+|hypothetical-protein
MKNQDLSIVELVSKRNKIVYTICGLLVLLTALSFARYFLNFSILYLLILLIPFFALMYWMIQVTEDIKEKKDSL
>NZ_CP051870.1|WP_111818458.1|34636_35647_-|nucleotidyltransferase
MATTVISAFNDFQKNIVNLDSATSSTARNSRNWLLDQISNFPENNDNFPNLYPEIDIGFGSFARKTKTRPLDDIDLMVGIKADGCTYYERSWDDIELKFPENYSGKLKKYAKTLDSSGLSSTRITNAFKSELSKVSQYSSAEIKRDGEAATLKLKSYTWNFDIVPCFLTSPDSDGNSYYLIPNRSGNWKKTNPKTDRDRLSAVNQNQSGNVLNVIRILKYWKQEKRVNIGSYLLEAMILYYYESKPNNTCSEYVDLELENVFNYLANSIINTVADPKNIQSNINDIDYYSRYSLSEKFKTFAQLSRDARQLENEGKDKESINTWKKVFGYNFPDYG
>NZ_CP051870.1|WP_005006303.1|35667_36546_-|hypothetical-protein
MISKKQNDLANLELQAAVNTLYSDSKFLMTINFIISVCMPFTLGLIGIVKDYSIFIYLAIFCSLSSIALSCWIKNIRSSAVQMQELYDRSIFNLKWNKLYLGEKPNNRQVTLLSEKYKKKYGDFSEFLNWYTSPAATYQYPMAIILCQSQNLSWDIPNRERYYKTVLAFIVLLIFVFFAVSIYYFENISLFIKTLSASIPIVIFLFFLVLEHKETVKEGNRLNSEIEDALNQLSNNSATDQDVISLAEEVQNAVYSYRKSARPIPNKLHKYFKNQNETLSIRNIQRYIDNYL
>NZ_CP051870.1|WP_169031081.1|36706_37042_+|hypothetical-protein
MNSDKQYFDRLQEEYSEKYGHELYAIDDIEGKKIFIDINDPWSVSSSWGSLENEIRLIKMGLFPLTLRQKFDRKETFEKKADELAKLINVVHTKENSILCPTSRYNRNKEK
>NZ_CP051870.1|WP_015060246.1|37254_37866_+|recombinase-family-protein
MIEMNTRIYLRASTKDQDAERALQILQDLNQNLNLGETIVYVENYSGTKLDRPELNKLLSEANQGDTLLVESIDRLSRLTQRDFQELKRRIQEKGLRLVVADLPTTYQMIQTSDSITHSILELINNMLIDLLATMARLDNEKRIERIKQGLARSGYKPTGKKANEAKHKRIKELLVVGNMTKEEIAKAVNCGVATVYRVAKVI
>NZ_CP051870.1|WP_000155092.1|38055_38940_-|Mph(E)-family-macrolide-2'-phosphotransferase
MTIQDIQSLAEAHGLLLTDKMNFNEMGIDFKVVFALDTKGQQWLLRIPRRDGMREQIKKEKRILELVKKHLSVEVPDWRISSTELVAYPILKDNPVLNLDAETYEIIWNMDKDSPKYITSLAKTLFEIHSIPEKEVRENDLKIMKPSDLRPEIANNLQLVKSEIGISEQLETRYRKWLDNDVLWADFTQFIHGDLYAGHVLASKDGAVSGVIDWSTAHIDDPAIDFAGHVTLFGEESLKTLIIEYEKLGGKVWNKLYEQTLERAAASPLMYGLFALETQNESLIVGAKAQLGVI
>NZ_CP051870.1|WP_000052512.1|38995_40471_-|ABC-F-type-ribosomal-protection-protein-Msr(E)
MSLIIKARNIRLDYAGRDVLDIDELEIHSYDRIGLVGDNGAGKSSLLKVLNGEIVLAEATLQRFGDFAHISQLGGIEIETVEDRAMLSRLGVSNVQNDTMSGGEETRAKIAAAFSQQVHGILADEPTSHLDLNGIDLLIGQLKAFDGALLVISHDRYFLDMVVDKIWELKDGKITEYWGGYSDYLRQKEEERQHQAVEYELMMKERERLESAVQEKRQQANRLDNKKKGEKSKNSTESAGRLGHAKMTGTKQRKLYQAAKSMEKRLAALEDIQAPEHLRSIRFRQSSALELHNKFPITADGLSLKFGSRTIFDDANFIIPLGAKVAITGSNGTGKTSLLKMISERADGLTISPKAEIGYFTQTGYKFNTHKSVLSFMQEECEYTVAEIRAVLASMGIGANDIQKNLSDLSGGEIIKLLLSKMLLGKYNILLMDEPGNYLDLKSIAALETMMKSYAGTIIFVSHDKQLVDNIADIIYEIKDHKIIKTFERDC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP051870.1	31410-31440	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP051870.1	31500-31530	0	1.0

1. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to position: 31410-31440, mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

2. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to position: 31500-31530, mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	KT325596	Uncultured bacterium plasmid pFK2-7, complete sequence	2646-2676	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	KT325596	Uncultured bacterium plasmid pFK2-7, complete sequence	2736-2766	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	KT325596	Uncultured bacterium plasmid pFK2-7, complete sequence	2826-2856	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP038024	Acinetobacter radioresistens strain DD78 plasmid pAR2, complete sequence	29770-29800	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP010903	Acinetobacter nosocomialis strain 6411 plasmid p6411-66.409kb, complete sequence	25434-25464	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP010903	Acinetobacter nosocomialis strain 6411 plasmid p6411-66.409kb, complete sequence	25524-25554	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP010903	Acinetobacter nosocomialis strain 6411 plasmid p6411-66.409kb, complete sequence	25614-25644	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	MK978162	Acinetobacter lwoffii strain M2a plasmid pAVAci14, complete sequence	29881-29911	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NC_019217	Uncultured bacterium HHV216 plasmid pHHV216, complete sequence	2757-2787	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NC_019218	Uncultured bacterium HHV35 plasmid pHHV35, complete sequence	2637-2667	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NC_019218	Uncultured bacterium HHV35 plasmid pHHV35, complete sequence	2763-2793	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NC_019218	Uncultured bacterium HHV35 plasmid pHHV35, complete sequence	2925-2955	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NC_019299	Uncultured bacterium HH1107 plasmid pHH1107, complete sequence	2757-2787	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP044465	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-2, complete sequence	6229-6259	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP044465	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-2, complete sequence	6373-6403	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP041290	Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence	42002-42032	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP041290	Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence	42092-42122	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP041290	Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence	42182-42212	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP041290	Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence	42272-42302	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP041290	Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence	42362-42392	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP041290	Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence	42452-42482	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP044485	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence	16888-16918	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP044485	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence	16978-17008	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP044485	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence	17068-17098	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP044485	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence	17158-17188	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP044485	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence	17248-17278	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP044485	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence	17338-17368	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP051870	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_1, complete sequence	31320-31350	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP051870	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_1, complete sequence	31410-31440	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP051870	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_1, complete sequence	31500-31530	0	1.0
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	MK978162	Acinetobacter lwoffii strain M2a plasmid pAVAci14, complete sequence	29791-29821	1	0.968
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	MK978162	Acinetobacter lwoffii strain M2a plasmid pAVAci14, complete sequence	29611-29641	1	0.968
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	MK978162	Acinetobacter lwoffii strain M2a plasmid pAVAci14, complete sequence	29701-29731	1	0.968
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NC_019217	Uncultured bacterium HHV216 plasmid pHHV216, complete sequence	2847-2877	1	0.968
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NC_019299	Uncultured bacterium HH1107 plasmid pHH1107, complete sequence	2847-2877	1	0.968
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP044465	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-2, complete sequence	6319-6349	1	0.968
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP044485	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence	17428-17458	1	0.968
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	113155-113185	9	0.71
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	114069-114099	9	0.71
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	26991-27021	9	0.71
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	148892-148922	9	0.71
NZ_CP051870_1	1.1\|31320\|31\|NZ_CP051870\|CRISPRCasFinder	31320-31350	31	NC_021795	Cellulophaga phage phi17:1, complete genome	3565-3595	10	0.677

1. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to KT325596 (Uncultured bacterium plasmid pFK2-7, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

2. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to KT325596 (Uncultured bacterium plasmid pFK2-7, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

3. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to KT325596 (Uncultured bacterium plasmid pFK2-7, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

4. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP038024 (Acinetobacter radioresistens strain DD78 plasmid pAR2, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

5. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP010903 (Acinetobacter nosocomialis strain 6411 plasmid p6411-66.409kb, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

6. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP010903 (Acinetobacter nosocomialis strain 6411 plasmid p6411-66.409kb, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

7. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP010903 (Acinetobacter nosocomialis strain 6411 plasmid p6411-66.409kb, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

8. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to MK978162 (Acinetobacter lwoffii strain M2a plasmid pAVAci14, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

9. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NC_019217 (Uncultured bacterium HHV216 plasmid pHHV216, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

10. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NC_019218 (Uncultured bacterium HHV35 plasmid pHHV35, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

11. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NC_019218 (Uncultured bacterium HHV35 plasmid pHHV35, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

12. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NC_019218 (Uncultured bacterium HHV35 plasmid pHHV35, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

13. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NC_019299 (Uncultured bacterium HH1107 plasmid pHH1107, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

14. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP044465 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

15. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP044465 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

16. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP041290 (Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

17. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP041290 (Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

18. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP041290 (Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

19. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP041290 (Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

20. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP041290 (Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

21. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP041290 (Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

22. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP044485 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

23. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP044485 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

24. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP044485 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

25. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP044485 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

26. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP044485 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

27. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP044485 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

28. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP051870 (Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_1, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

29. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP051870 (Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_1, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

30. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP051870 (Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_1, complete sequence) position: , mismatch: 0, identity: 1.0

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaat	Protospacer
*******************************

31. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to MK978162 (Acinetobacter lwoffii strain M2a plasmid pAVAci14, complete sequence) position: , mismatch: 1, identity: 0.968

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
acctctggccatgattgcagaaatggaaaat	Protospacer
 ******************************

32. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to MK978162 (Acinetobacter lwoffii strain M2a plasmid pAVAci14, complete sequence) position: , mismatch: 1, identity: 0.968

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctttggccatgattgcagaaatggaaaat	Protospacer
****.**************************

33. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to MK978162 (Acinetobacter lwoffii strain M2a plasmid pAVAci14, complete sequence) position: , mismatch: 1, identity: 0.968

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctttggccatgattgcagaaatggaaaat	Protospacer
****.**************************

34. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NC_019217 (Uncultured bacterium HHV216 plasmid pHHV216, complete sequence) position: , mismatch: 1, identity: 0.968

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatgaaaaat	Protospacer
*************************.*****

35. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NC_019299 (Uncultured bacterium HH1107 plasmid pHH1107, complete sequence) position: , mismatch: 1, identity: 0.968

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatgaaaaat	Protospacer
*************************.*****

36. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP044465 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-2, complete sequence) position: , mismatch: 1, identity: 0.968

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggccatgattgcagaaatggaaaac	Protospacer
******************************.

37. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP044485 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence) position: , mismatch: 1, identity: 0.968

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
tcctctggctatgattgcagaaatggaaaat	Protospacer
*********.*********************

38. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 9, identity: 0.71

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
gatcttggccatgattgcagaacaggaacgt	Protospacer
  ...*****************  **** .*

39. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 9, identity: 0.71

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
gatcttggccatgattgcagaacaggaacgt	Protospacer
  ...*****************  **** .*

40. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 9, identity: 0.71

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
gatcttggccatgattgcagaacaggaacgt	Protospacer
  ...*****************  **** .*

41. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 9, identity: 0.71

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
gatcttggccatgattgcagaacaggaacgt	Protospacer
  ...*****************  **** .*

42. spacer 1.1|31320|31|NZ_CP051870|CRISPRCasFinder matches to NC_021795 (Cellulophaga phage phi17:1, complete genome) position: , mismatch: 10, identity: 0.677

tcctctggccatgattgcagaaatggaaaat	CRISPR spacer
gaggactgcaatgattgcagaaatggataag	Protospacer
     . ** ***************** **

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP051871

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP051871_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051871_1

2090-2186

Orphan

Consensus_repeat	Method
GTCATAGTTAGTAGTCAATCCGTCATAGTTAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051871_1

>merge|NZ_CP051871|1|2090-2186|CRISPRCasFinder
GTCATAGTTAGTAGTCAATCCGTCATAGTTAAGTAGTCAATCCGTCATAGTTAGTAGTCAATCCGTCATAGTTAGTAGTCAATCCGTCATAGTTAAG

>NZ_CP051871|1|1|2090-2186|CRISPRCasFinder
GTCATAGTTAGTAGTCAATCCGTCATAGTTAAG	TAGTCAATCCGTCATAGTTAGTAGTCAATCC
GTCATAGTTAGTAGTCAATCCGTCATAGTTAAG

Protein	Function_ID	Function_description	E-value
NZ_CP051871.1\|WP_001983304.1\|7424_7739_-\|BrnA-antitoxin-family-protein	gnl\|CDD\|373040	pfam14384, BrnA_antitoxin, BrnA antitoxin of type II toxin-antitoxin system. BrnA is family of antitoxins that neutralizes the toxin BrnT, pfam04365. It consists of 3 alpha-helices and a C-terminal ribbon-helix-helix DNA binding domain. As in other toxin-antitoxin systems, BrnA negatively autoregulates the brnTA operon and has higher affinity for the DNA operator when complexed with BrnT. It dimerizes with two molecules of its toxin BrnT.	3.92781e-21
NZ_CP051871.1\|WP_000438827.1\|7725_8013_-\|BrnT-family-toxin	gnl\|CDD\|367913	pfam04365, BrnT_toxin, Ribonuclease toxin, BrnT, of type II toxin-antitoxin system. BrnT is a ribonuclease toxin of a type II toxin-antitoxin system that exhibits a RelE-like fold. The antitoxin that neutralizes this toxin is pfam14384. BrnT is found in bacteria, archaea, bacteriophage, and plasmids. BrnT-BrnA forms a 2:2 tetrameric complex and autoregulates its own expression, which is induced by a number of different environmental stresses. Expression of BrnT alone results in cessation of bacterial growth which can be rescued after subsequent expression of BrnA.	3.83729e-28
NZ_CP051871.1\|WP_057048785.1\|1154_2048_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	7.85278e-63
NZ_CP051871.1\|WP_000932953.1\|4885_7297_-\|TonB-dependent-receptor	gnl\|CDD\|224544	COG1629, CirA, Outer membrane receptor proteins, mostly Fe transport [Inorganic ion transport and metabolism].	2.10014e-35
NZ_CP051871.1\|WP_000761346.1\|4119_4581_-\|DIP1984-family-protein	gnl\|CDD\|213403	cd12208, septicolysin_like, putative septicolysin, cholesterol-dependent cytolysin family and related proteins. This group contains some members identified as septicolysin. While septolysin is poorly characterized, it has been identified as a a cholesterol-dependent cytolysin, and acts to facilitate the infection of certain pathogenic bacteria to cells. Cholesterol-dependent cytolysins are pore-forming toxins that aid in bacterial pathogenesis of various gram positive species. Pores are formed by oligomerization into ring-like structures. Related proteins in eukaryotic immune systems use this pore-forming mechanism.	2.73137e-55

>NZ_CP051871.1|WP_057048785.1|1154_2048_-|replication-initiation-protein
MNKNHVVKSNQVIEASYQLSAVEQRIVLAAISRIPKNQPITDDELYPVSINELRQLGVHEKTAYRDLKEGINRLYERSINLSIDDKSIKMRWVQEVQFLDSQSVIGIRFSKPILPFISNLSREFTKYALSDIAGINSGYGIRIYELLVQYRQIGKREISVENLRTMLELGKKYPLFADFKKRVIDTAIDQINECSPLNVTYEQKKTGRKVTSIIFSFKEKTKSISHPNTDVPKEFYKLTDAQINMFGNQLSRLHELSHLAQQGESYDDLAITIKDMLRDPKQQKQFLPYLKNLGFKL
>NZ_CP051871.1|WP_002067466.1|545_1091_-|hypothetical-protein
MKTSTKYSVSDAATLYKKSRATLYKDIKNGVLSRDHDGSIDFSELLRVYGEPFGGTNSKRLDTSPRQNIDTPEYTDNTVVELKNQIEFLKKQLEKAEDRETKANARIDTLLTLIEMKPPQANISTFTEQQSDQDIATDPRSKKPNEGGLTTQEIKRIPVPEHIEPEPEKRGFWSRFFKPYG
>NZ_CP051871.1|WP_002067614.1|3252_3624_+|hypothetical-protein
MGEKVKTYAVRLDPQVAEFYDQLANSEGIRTSKLFSKILTNDFQSIAVKQQADRIEDLVNRLEKRIDDFEEDNNFSEKYYEDFSSTYMMLLWLLMKNGASKDEIRSMQAKAANYAKQNFSKES
>NZ_CP051871.1|WP_002067611.1|3626_3797_+|hypothetical-protein
MDNIIQISKPCTLCGNGQNVQLFAGLMLCRSCQENIKLTNPGMFAANDEIEQKAQD
>NZ_CP051871.1|WP_000761346.1|4119_4581_-|DIP1984-family-protein
MKLAEALLLRSDQQKKIISLKQRINANVLVQDGDQPSEDPNELLKQVFSLIQEFQKLSYAIHETNALTKLNDGRSLLALLTLRDEFVEQHKTLTAAISNTSRESDRYSTREIKWHKVIPVSSLQKQADDISLKLRDLNVLIQSTNWKIDLIEA
>NZ_CP051871.1|WP_000932953.1|4885_7297_-|TonB-dependent-receptor
MLNKSKLFLALITLGASKILLAAEGPVTTLNTIVLTAQSDELGSELLGKSLNVSNQFIDTSKLKQRSTTLGDALGTELGIHSNQYGGGASTPIIRGQEGKRIKVLQNNADVLDMSNMSPDHAVTVEPSLAKSIEIIRGASTLLYSSNSAAGVVNVIDYKIPTQMPQDGLEGNTTLRFNTGSNEKLTTAGVTVGLSPHVALRAEGLYRNAGNYKTPHYQSSSYNSLEDLENQNSIYKNLKYLPESWAESRVGTLGLSWIDDNTYLGVSYTHRHDEYGLPAHSHLYEGCGASAIGIDSRISGLKNYLLYYPQLMDEQDINYINPRPDCHQHNHIHETNFSHNAPYIDLNTRRYDVRGEFTQPFTGIDKIRTSLSYIDYFHNELEGDKITNFFKNTGKVGRIELSHQPLGELTGILGLQYLEQDNSALSPVHSQEGHTTYLDNQQLLNRNVTKNFSVFGLEKYNWNDFTFELGARIEKQKVSMDYDIEKIKDSMKPWPNKYNSPYVEKNNKIRAQNLKSILEAVQPNKETAFSYAGTVHWRFAPNYILSLTGTHQERLPNAQEMYTHGMHLATNSFEIGNRFLRKEKSNNLEISLAYKDDLLDYQISTYYYDFDNYIYLQTLNEVLGTTKVRDQHTLRINHYSQSAANFYGLEGNIGYQFNSVYHGSLFGDYVKGRLTNLPDAVIAYDIWNREPTLAPQKDRYTPRLPPARLGTRLKADFDESLKGEIEYYRVFKQDNISKFEQVTSGYNMLNMTLAYKNKLSHTEYDLFFKANNLLDQKVYAHETFLPYIPQIGRNFSLGLNLNF
>NZ_CP051871.1|WP_001983304.1|7424_7739_-|BrnA-antitoxin-family-protein
MSMVRYSHKELNEKFGEKQDAEIQRLLAKGTVPDDQLDLSDIPEITDWSNAVRQNQFYRPVKQQTSIRLDADVLAWFKAQGKGYQTRMNEILRDAMLKELKNHQ
>NZ_CP051871.1|WP_000438827.1|7725_8013_-|BrnT-family-toxin
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIISARQVTKAERNKYEHG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP044476	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence	6019-6049	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP044476	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence	6040-6070	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_LR026972	Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence	14314-14344	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_LR026972	Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence	14335-14365	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP023027	Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence	2706-2736	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP023027	Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence	2727-2757	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP020587	Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence	1572-1602	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP020587	Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence	1593-1623	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP021348	Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence	15134-15164	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP021348	Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence	15155-15185	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP023021	Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence	4058-4088	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP023021	Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence	4079-4109	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_KY499579	Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence	6032-6062	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_KY499579	Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence	6053-6083	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP027248	Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence	13480-13510	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP027248	Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence	13501-13531	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP028570	Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence	3685-3715	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP028570	Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence	3706-3736	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP031994	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence	2308-2338	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP031994	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence	2329-2359	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP044462	Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence	3598-3628	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP044462	Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence	3619-3649	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NC_010481	Acinetobacter baumannii plasmid pABIR, complete sequence	228-258	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NC_010481	Acinetobacter baumannii plasmid pABIR, complete sequence	249-279	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	CP033542	Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence	59-89	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	CP033542	Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence	80-110	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP038648	Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence	1818-1848	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP038648	Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence	1839-1869	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	CP033571	Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence	6655-6685	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	CP033571	Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence	6676-6706	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP033132	Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence	8645-8675	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP033132	Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence	8666-8696	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP033752	Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence	9523-9553	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP033752	Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence	9544-9574	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP027252	Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence	8103-8133	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP027252	Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence	8124-8154	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_LT984691	Acinetobacter baumannii isolate K50 plasmid II, complete sequence	9414-9444	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_LT984691	Acinetobacter baumannii isolate K50 plasmid II, complete sequence	9435-9465	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP029572	Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence	6928-6958	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP029572	Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence	6949-6979	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	MN461228	Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence	3638-3668	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	MN461228	Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence	3659-3689	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	MN481286	Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence	2719-2749	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	MN481286	Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence	2740-2770	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	MN495625	Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence	8319-8349	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	MN495625	Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence	8340-8370	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	MN495626	Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence	8319-8349	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	MN495626	Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence	8340-8370	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP051871	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence	2123-2153	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP051871	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence	2144-2174	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NC_013506	Acinetobacter baumannii plasmid pMMCU2, complete sequence	8538-8568	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NC_013506	Acinetobacter baumannii plasmid pMMCU2, complete sequence	8559-8589	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	MK978160	Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence	2818-2848	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	MK978160	Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence	2839-2869	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NC_013056	Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence	7752-7782	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NC_013056	Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence	7773-7803	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	CP042207	Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence	8144-8174	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	CP042207	Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence	8165-8195	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP042367	Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence	10198-10228	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP042367	Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence	10219-10249	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP018141	Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence	4129-4159	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP018141	Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence	4150-4180	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP038260	Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence	10479-10509	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP038260	Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence	10500-10530	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP049810	Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence	7569-7599	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP049810	Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence	7590-7620	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP015146	Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence	247-277	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP015146	Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence	268-298	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP051877	Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence	1390-1420	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP051877	Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence	1411-1441	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP031981	Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence	759-789	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP031981	Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence	780-810	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP026427	Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence	6953-6983	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP026427	Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence	6974-7004	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP014479	Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence	17984-18014	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP014479	Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence	18005-18035	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP016899	Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence	2196-2226	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP016899	Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence	2217-2247	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP051868	Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence	7687-7717	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP051868	Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence	7708-7738	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NC_019280	Acinetobacter baumannii plasmid pMMD, complete sequence	7703-7733	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NC_019280	Acinetobacter baumannii plasmid pMMD, complete sequence	7724-7754	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP023035	Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence	2972-3002	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP023035	Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence	2993-3023	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_KT022421	Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence	4251-4281	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_KT022421	Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence	4272-4302	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP032127	Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence	18027-18057	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP032127	Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence	18048-18078	0	1.0
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP015112	Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence	7418-7448	1	0.968
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP015112	Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence	7439-7469	1	0.968
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP032275	Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence	4788-4818	1	0.968
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP032275	Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence	4809-4839	1	0.968
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP010354	Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence	8559-8589	1	0.968
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP010354	Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence	8580-8610	1	0.968
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP050406	Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence	9451-9481	1	0.968
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP050406	Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence	9472-9502	1	0.968
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP035940	Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence	3221-3251	1	0.968
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP035940	Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence	3242-3272	1	0.968
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP032275	Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence	4767-4797	8	0.742
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP050406	Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence	9493-9523	8	0.742
NZ_CP051871_1	1.1\|2123\|31\|NZ_CP051871\|CRISPRCasFinder	2123-2153	31	NZ_CP035940	Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence	3200-3230	8	0.742

1. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP044476 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

2. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP044476 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

3. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_LR026972 (Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

4. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_LR026972 (Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

5. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP023027 (Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

6. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP023027 (Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

7. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP020587 (Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

8. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP020587 (Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

9. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP021348 (Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

10. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP021348 (Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

11. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP023021 (Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

12. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP023021 (Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

13. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_KY499579 (Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

14. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_KY499579 (Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

15. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP027248 (Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

16. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP027248 (Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

17. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP028570 (Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

18. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP028570 (Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

19. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP031994 (Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

20. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP031994 (Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

21. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP044462 (Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

22. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP044462 (Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

23. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NC_010481 (Acinetobacter baumannii plasmid pABIR, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

24. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NC_010481 (Acinetobacter baumannii plasmid pABIR, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

25. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to CP033542 (Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

26. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to CP033542 (Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

27. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP038648 (Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

28. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP038648 (Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

29. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to CP033571 (Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

30. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to CP033571 (Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

31. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP033132 (Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

32. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP033132 (Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

33. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP033752 (Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

34. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP033752 (Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

35. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP027252 (Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

36. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP027252 (Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

37. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_LT984691 (Acinetobacter baumannii isolate K50 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

38. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_LT984691 (Acinetobacter baumannii isolate K50 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

39. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP029572 (Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

40. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP029572 (Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

41. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to MN461228 (Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

42. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to MN461228 (Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

43. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to MN481286 (Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

44. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to MN481286 (Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

45. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to MN495625 (Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

46. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to MN495625 (Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

47. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to MN495626 (Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

48. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to MN495626 (Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

49. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP051871 (Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

50. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP051871 (Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

51. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NC_013506 (Acinetobacter baumannii plasmid pMMCU2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

52. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NC_013506 (Acinetobacter baumannii plasmid pMMCU2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

53. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to MK978160 (Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

54. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to MK978160 (Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

55. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NC_013056 (Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

56. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NC_013056 (Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

57. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to CP042207 (Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

58. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to CP042207 (Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

59. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP042367 (Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

60. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP042367 (Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

61. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP018141 (Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

62. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP018141 (Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

63. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP038260 (Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

64. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP038260 (Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

65. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP049810 (Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

66. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP049810 (Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

67. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP015146 (Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

68. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP015146 (Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

69. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP051877 (Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

70. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP051877 (Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

71. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP031981 (Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

72. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP031981 (Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

73. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP026427 (Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

74. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP026427 (Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

75. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP014479 (Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

76. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP014479 (Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

77. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP016899 (Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

78. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP016899 (Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

79. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP051868 (Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

80. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP051868 (Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

81. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NC_019280 (Acinetobacter baumannii plasmid pMMD, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

82. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NC_019280 (Acinetobacter baumannii plasmid pMMD, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

83. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP023035 (Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

84. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP023035 (Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

85. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_KT022421 (Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

86. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_KT022421 (Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

87. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP032127 (Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

88. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP032127 (Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence) position: , mismatch: 0, identity: 1.0

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttagtagtcaatcc	Protospacer
*******************************

89. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP015112 (Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.968

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttggtagtcaatcc	Protospacer
*******************.***********

90. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP015112 (Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.968

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccgtcatagttggtagtcaatcc	Protospacer
*******************.***********

91. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP032275 (Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence) position: , mismatch: 1, identity: 0.968

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccctcatagttagtagtcaatcc	Protospacer
********** ********************

92. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP032275 (Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence) position: , mismatch: 1, identity: 0.968

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccctcatagttagtagtcaatcc	Protospacer
********** ********************

93. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP010354 (Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence) position: , mismatch: 1, identity: 0.968

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccctcatagttagtagtcaatcc	Protospacer
********** ********************

94. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP010354 (Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence) position: , mismatch: 1, identity: 0.968

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccctcatagttagtagtcaatcc	Protospacer
********** ********************

95. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP050406 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence) position: , mismatch: 1, identity: 0.968

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccctcatagttagtagtcaatcc	Protospacer
********** ********************

96. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP050406 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence) position: , mismatch: 1, identity: 0.968

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccctcatagttagtagtcaatcc	Protospacer
********** ********************

97. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP035940 (Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence) position: , mismatch: 1, identity: 0.968

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccctcatagttagtagtcaatcc	Protospacer
********** ********************

98. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP035940 (Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence) position: , mismatch: 1, identity: 0.968

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccctcatagttagtagtcaatcc	Protospacer
********** ********************

99. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP032275 (Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence) position: , mismatch: 8, identity: 0.742

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccctcatagttaggagctgaaag	Protospacer
********** ********** **...*

100. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP050406 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence) position: , mismatch: 8, identity: 0.742

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccctcatagttaggagctgaaag	Protospacer
********** ********** **...*

101. spacer 1.1|2123|31|NZ_CP051871|CRISPRCasFinder matches to NZ_CP035940 (Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence) position: , mismatch: 8, identity: 0.742

tagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
tagtcaatccctcatagttaggagctgaaag	Protospacer
********** ********** **...*

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP051869

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP051870

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP051871

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection