CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP042451	Vibrio diabolicus strain FA3 chromosome 1, complete sequence	0 crisprs	DEDDh,cas3HD,DinG,cas3,csx1,csa3	0	0	2	0
NZ_CP042452	Vibrio diabolicus strain FA3 chromosome 2, complete sequence	1 crisprs	DEDDh,WYL,csa3,cas3	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP042452_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP042452_1

64784-64881

Orphan

Consensus_repeat	Method
TATTTTTAAAATGCCTTTTCAAAAA	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP042452_1

>merge|NZ_CP042452|1|64784-64881|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAATTTGAAACCGCGCAATTAAAGAATCCATAAAAACAAGATCGCAATCAATATTTTTAAAACGCCTTTTCAAAAA

>NZ_CP042452|1|1|64784-64881|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAA	TTTGAAACCGCGCAATTAAAGAATCCATAAAAACAAGATCGCAATCAA
TATTTTTAAAACGCCTTTTCAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP042452.1\|WP_167427154.1\|69317_69941_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	unknown	unknown	gnl\|CDD\|235577
NZ_CP042452.1\|WP_005460804.1\|63942_64725_-\|DNA-binding-transcriptional-regulator-KdgR	unknown	unknown	gnl\|CDD\|185046
NZ_CP042452.1\|WP_167427149.1\|58078_59227_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP042452.1\|WP_167427150.1\|59520_60327_+\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NZ_CP042452.1\|WP_167427156.1\|71995_72673_+\|porin	unknown	unknown	gnl\|CDD\|368776
NZ_CP042452.1\|WP_005482867.1\|61990_63859_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225457
NZ_CP042452.1\|WP_005391987.1\|56270_56726_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226429
NZ_CP042452.1\|WP_005467181.1\|66292_66613_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380366
NZ_CP042452.1\|WP_167427155.1\|70126_71866_-\|transporter	unknown	unknown	gnl\|CDD\|271371
NZ_CP042452.1\|WP_167427153.1\|67366_68278_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP042452.1\|WP_167427152.1\|61277_61988_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236392
NZ_CP042452.1\|WP_167427148.1\|57177_58017_-\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|178061
NZ_CP042452.1\|WP_109169350.1\|55167_56265_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP042452.1\|WP_005460779.1\|66653_67289_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	unknown	unknown	gnl\|CDD\|181746
NZ_CP042452.1\|WP_005482884.1\|68376_69306_+\|sugar-kinase	unknown	unknown	gnl\|CDD\|238571
NZ_CP042452.1\|WP_005482916.1\|64980_65742_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	unknown	unknown	gnl\|CDD\|181605
NZ_CP042452.1\|WP_031831553.1\|54753_55158_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042452.1\|WP_167427157.1\|72688_74917_+\|exopolygalacturonate-lyase	unknown	unknown	unknown
NZ_CP042452.1\|WP_167427151.1\|60407_61277_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176159
NZ_CP042452.1\|WP_005497706.1\|65760_66285_+\|YgjV-family-protein	unknown	unknown	gnl\|CDD\|378474

Protein	Function_ID	Function_description	E-value
NZ_CP042452.1\|WP_167427154.1\|69317_69941_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	gnl\|CDD\|235577	PRK05718, PRK05718, keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional.	8.73323e-121
NZ_CP042452.1\|WP_005460804.1\|63942_64725_-\|DNA-binding-transcriptional-regulator-KdgR	gnl\|CDD\|185046	PRK15090, PRK15090, DNA-binding transcriptional regulator KdgR; Provisional.	0
NZ_CP042452.1\|WP_167427149.1\|58078_59227_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP042452.1\|WP_167427150.1\|59520_60327_+\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	2.75406e-97
NZ_CP042452.1\|WP_167427156.1\|71995_72673_+\|porin	gnl\|CDD\|368776	pfam06178, KdgM, Oligogalacturonate-specific porin protein (KdgM). This family consists of several bacterial proteins which are homologous to the oligogalacturonate-specific porin protein KdgM from Erwinia chrysanthemi. The phytopathogenic Gram-negative bacteria Erwinia chrysanthemi secretes pectinases, which are able to degrade the pectic polymers of plant cell walls, and uses the degradation products as a carbon source for growth. KdgM is a major outer membrane protein, whose synthesis is strongly induced in the presence of pectic derivatives. KdgM behaves like a voltage-dependent porin that is slightly selective for anions and that exhibits fast block in the presence of trigalacturonate. In contrast to most porins, KdgM seems to be monomeric.	7.08483e-24
NZ_CP042452.1\|WP_005482867.1\|61990_63859_-\|CBS-domain-containing-protein	gnl\|CDD\|225457	COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].	2.84814e-139
NZ_CP042452.1\|WP_005391987.1\|56270_56726_-\|hypothetical-protein	gnl\|CDD\|226429	COG3915, COG3915, Uncharacterized protein conserved in bacteria [Function unknown].	2.14355e-36
NZ_CP042452.1\|WP_005467181.1\|66292_66613_+\|cupin-domain-containing-protein	gnl\|CDD\|380366	cd02238, cupin_KdgF, pectin degradation protein KdgF and related proteins, cupin domain. This family includes bacterial and archaeal pectin degradation protein KdgF that catalyzes the linearization of unsaturated uronates from both pectin and alginate, which are polysaccharides found in the cell walls of plants and brown algae, respectively, and represent an important source of carbon. These polysaccharides, mostly consisting of chains of uronates, can be metabolized by bacteria through a pathway of enzymatic steps to the key metabolite 2-keto-3-deoxygluconate (KDG). Pectin degradation is used by many plant-pathogenic bacteria during infection, and also, pectin and alginate can both represent abundant sources of carbohydrate for the production of biofuels. These proteins belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	1.13072e-54
NZ_CP042452.1\|WP_167427155.1\|70126_71866_-\|transporter	gnl\|CDD\|271371	cd11477, SLC5sbd_u1, Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain. SLC5 (also called the sodium/glucose cotransporter family or solute sodium symporter family) is a family of proteins that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. Prokaryotic members of this family include Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	7.04039e-109
NZ_CP042452.1\|WP_167427152.1\|61277_61988_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|236392	PRK09146, PRK09146, DNA polymerase III subunit epsilon; Validated.	2.20305e-39
NZ_CP042452.1\|WP_167427148.1\|57177_58017_-\|S-formylglutathione-hydrolase	gnl\|CDD\|178061	PLN02442, PLN02442, S-formylglutathione hydrolase.	1.62424e-143
NZ_CP042452.1\|WP_109169350.1\|55167_56265_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	7.80335e-43
NZ_CP042452.1\|WP_005460779.1\|66653_67289_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	gnl\|CDD\|181746	PRK09273, PRK09273, hypothetical protein; Provisional.	2.15977e-144
NZ_CP042452.1\|WP_005482884.1\|68376_69306_+\|sugar-kinase	gnl\|CDD\|238571	cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.	1.15929e-102
NZ_CP042452.1\|WP_005482916.1\|64980_65742_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	gnl\|CDD\|181605	PRK08993, PRK08993, 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD.	0
NZ_CP042452.1\|WP_167427153.1\|67366_68278_+\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	5.76208e-17
NZ_CP042452.1\|WP_167427151.1\|60407_61277_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176159	cd08470, PBP2_CrgA_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.47042e-108
NZ_CP042452.1\|WP_005497706.1\|65760_66285_+\|YgjV-family-protein	gnl\|CDD\|378474	pfam10688, Imp-YgjV, Bacterial inner membrane protein. This is a family of inner membrane proteins. Many of the members are YgjV protein.	9.00507e-50

>NZ_CP042452.1|WP_005460804.1|63942_64725_-|DNA-binding-transcriptional-regulator-KdgR
MEKSTQPEAVSSVLKVFHILQALGEQKAIGVSELSQRLMMSKATTYRFLQTMKSLGYVSQEGEADKYSLTLKLFELGAKSLEYVDLIELADKEMRHISEQTNEALHLGALDENAIIYIHKIDSGYNLRMQSRIGRRNPLYSTAIGKVLLSERDESFVRDVLSDVEFIKHTEKTLENTDQVLEELAKVRDFHYAEDNEEQEPGLRCIAAPIYDRFGQIIAGLSISFPTIRFDEERMEYYVGLLHQAGKNISEQLGYHDYPA
>NZ_CP042452.1|WP_005482867.1|61990_63859_-|CBS-domain-containing-protein
MGTSVTPNIFDFLIKIDPFDKLPEPVVESIANSVKVKYLVRGETIGFSALCDQRYLYIIRTGAIEQRTPNGELRARLGQDDQFGFTFLDPLENAEDGYQAEAIEDSLLYLIPHSELKLVSEEHPEFADYFAAQANVRLSSAVKYVCRKEEKGLFFRTVGEIASENIAIVDVNDSIRSVAQTMCGKQRSSCAVVMKEGEIIGLVTDRDMTKSVVAQDMDTNQPIADVMTPNPVLIEDDAKVIQAISLMLQYNIRCLPVVHGKQVKGLLTTTHLVHNHRTQSLFLIEKIKYASSLNALAALKEERQTIFQALVESGVSAEIQGRVMSMIMDAFTRRIIQLNEELLGPPPCDYAWLVAGSHARNEVHMLSDQDSAIVLSDDATEEHKLYFTHLAMRVCNGLAACGYPLCDGKYMAASPKWCQPIRRWKEYYQKWVASPEYNKLLSISVFLEVRAIHGNREFVDQIQQHLHDCIQKSPSFIPALVRDAIDTQPPLGIFNNLVLEKGGENSNTLNIKKYALNLIIDLARIFSLAAGGSLTGTEERFRYAAQHGTLSKDSVENIIGAYRFITQVRFRHQLNAILAGTTPDNHIAPDDFSSFERKHLKDAFKIISELQDVAKLKFVKGA
>NZ_CP042452.1|WP_167427152.1|61277_61988_-|DNA-polymerase-III-subunit-epsilon
MIKRWFKRWETPLSPEQKRQAIHVIDDWPIVLKDYLQQPLVDDSTTLKDLSFVALDFETTGVDAQGDKILSIGVVDLTLDGIDIASSKEWYICHGQFIKPETAQINGLTPQDLAKGLPLDEGMNRLLERITGKVVLAHGCCIEKAFIHAYFSSRYQVEDFPAYFVDTLQIEKQFSYAGKSGSHSSYQLDDLRRYYHLPGYLSHSAASDALACAELFLVQSKKLTALPDVTLRQLMR
>NZ_CP042452.1|WP_167427151.1|60407_61277_+|LysR-family-transcriptional-regulator
MANWEGVSEFVAVAETNSFTGAAAKLKTSVAQISRRVSALEERLAVKLLHRTTRKVSLSEAGQLYYQQCKHLVEGLELAELAVTQMQTEPRGLLRVTAPVTYGEMNLAPLLHQFLEKYPRVDLDLVLTNQKLDLIEQGVDVAIRLGRLQDSSMIAKRLSSRQNYVCASPMYLERFGEPHTLSELGRHQCLVGSVDYWHFKENKRDKSLRVSGRIKCNSGFALVDAAKRGLGLVQLPDYYVQEALDSGELVEVLTSYRDDREGIWALYPQSRNLSPKVRLLIDFLAQELA
>NZ_CP042452.1|WP_167427150.1|59520_60327_+|arylamine-N-acetyltransferase
MNKTDLNAYLTKLGLSSELPADLESLHKIHVAQHRCLPFENFDISLQRGISVEIEDIIQKTVYHSRGGYCFELNGLMLDVLKTLGFEARSLLGRVHVMGTPTGRSHQITLVTLDEQAWIVDVGFGSNTPRAPLPFILNQVIQTDLQTFRFVEDAQFGYFLQVLSTDGTDTWNNLYSFDLEFVFAGDIACGNFFTSTSPNSRFTSARVAAKATESGLVTLLNYTLKYTSQGEQTELELEPGQAYLDALKEYFGIELDAQYGDLRPLPDA
>NZ_CP042452.1|WP_167427149.1|58078_59227_-|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MTVEIKPGQTHIKSKAMVAWASGEPLKMEEVDVQLPKAGEVLVRIVATGVCHTDAFTLSGDDPEGIFPSILGHEGGGIVEMVGEGVTSVKVGDHVIPLYTAECGECKFCKSGKTNLCQAVRETQGKGLMPDGTSRFSINGETIFHYMGCSTFSEYTVLPEISLAKVNKDAPLEEVCLLGCGVTTGMGAVMNTAKVEKGDTVAIFGLGGIGLSAIIGARMVGASRIIGIDINESKFDLAKQLGATDVINPQKFDKPIQEVIVEMTDGGVDYSFECIGNVNVMRQALECCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRSELPEIVNRYMAGEFGLQEFITHTMGLADVNKAFDLMHEGKSIRTVIHMDQ
>NZ_CP042452.1|WP_167427148.1|57177_58017_-|S-formylglutathione-hydrolase
MTIENVSQAKVFGGWHKQYTHESKALNCTMRFAIFLPPNATKSNPVPALYWLSGLTCTDENFMQKAGAFRMAAELGIAIIAPDTSPRGEGIADDENYDLGKGAGFYLNATQAPWSLHYFMYDYVTKELPEIIESNFPVSEVKSISGHSMGGHGALTIGLKNAEQYRSISAFSPICNPVQCPWGQKAFTAYLGKDIESWKQYDASELLKQKPSPLPILVDQGDADGFLNEQLRPEALVAAAKVHDSNLNLRMQPGYDHSYYFISSFIDDHLNFHAKYLFA
>NZ_CP042452.1|WP_005391987.1|56270_56726_-|hypothetical-protein
MKKIVALGLFFVAPFLSASTIVFSSSQQPSVTLKLEEIQSLPTTSYTTTLPWIPASSEFLGVKLSTLLTHVYGKVPEQVDVSSLNDYHSTLSRQDILRYQPILAYQQDQHYIKVRNKGPFWVIYSLSLYPELNYNKYHAQMVWQVNEMKAK
>NZ_CP042452.1|WP_109169350.1|55167_56265_-|GGDEF-domain-containing-protein
MKLSEPTHQKQRAPQYSTTSKMLLVVFATSLLLANVLLLQQTRALSQNFNNEQKQATWFLFQLSKELSELVGEARRVDENVLNIEGAELQYELAWSRFDLLISSNEAYTFFSRNNMHQYFIDLFEEFQGLEAQLVEARTGDSQAAAQFYRSTQTLYLSLVDFVNQNFRLSSKVYEAQKGETQRLMQAQYMLFATFVLSILSLTYFFYRESHFHRKLALSDPLTHLGNRNALFINLNELTQEKRPFSLWILDLNGFKSVNDTHGHQVGDTVLREIARRLKSMALNDFTVYRMGGDEFAVILEGEHVDEEGVREHINAVFDAPILNSDNVATLSTSMGLAQYPKDSNNVDFLISIADKRMYKMKFQR
>NZ_CP042452.1|WP_031831553.1|54753_55158_-|hypothetical-protein
MMRKFMQVLLLLAVIAAGVLAWVFIPSHETIGQKTLEQALNDDYSLVGHRIYSTDPDAGNRFGYFVLATGQSIEEQEPFLVTSDQFIRMEQTGDNTLSVTVNGRIYQYHNDLWVPKSDGKLQHFLVSATAKYVR
>NZ_CP042452.1|WP_005482916.1|64980_65742_+|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD
MILDSFNLEGKVAIVTGCDTGLGQGMALGLAKAGCDIVGVNISEPTETIEKVEAEGRKFVDIRANLMKLDDIPTIVDRAVTELGRIDILVNNAGIIRRNDAIEFSEQDWDDVMNINVKSVFFMSQAVAKQFIAQGEGGKIINIASMLSFQGGIRVPSYTASKSGVMGVTRLMANEWASHGINVNAIAPGYMATNNTAALRADEQRNKEIVDRIPAARWGTPEDLAGPCVFLASKAADYINGYTIAVDGGWLAR
>NZ_CP042452.1|WP_005497706.1|65760_66285_+|YgjV-family-protein
MVDTTILAQALGFISFGLGFSVFYQKNDRHLKILMLIFNLNHLLHFLLLGSMVSALSALLSALRTTTAIFVSSKRVAAVFIVISLVSGFWVAEQWRDLWPIIGTVIGTYSVFCLSGIRMRIGFLLGASCWLTNNILVGSIGGTLLEMTVIVMNLLTIYRLHRQQSESMINQSSY
>NZ_CP042452.1|WP_005467181.1|66292_66613_+|cupin-domain-containing-protein
MFVFNQDIPMEDLGEGISRKVLAHSDNMMSVEVHFEEGAIGAMHSHPHEQLTYVLSGEFEFTIGDEKKIVKTGDTMYKEPNIEHGCVCLKAGVLIDTFTPMRKDFV
>NZ_CP042452.1|WP_005460779.1|66653_67289_+|RpiB/LacA/LacB-family-sugar-phosphate-isomerase
MKIALMMENSQAAKNAMVAGELNSVAGGLGHDVFNVGMTDENDHHLTYIHLGIMASILLNSKAVDFVVTGCGTGQGALMSCNLHPGVVCGYCLEPSDAFLFNQINNGNAISLAFAKGFGWAGELNVRYIFEKAFTGKRGEGYPIERAAPQQANAAILNNVKSAVAKDVVEGLRAIDQELVKTAVGSTQFQECFFAHCQVPEIAEYVKSLLD
>NZ_CP042452.1|WP_167427153.1|67366_68278_+|alpha/beta-hydrolase
MHVAPITSLQTWFPEHLVLPLWSEPQIPSHLVQSYQERNPNELLPDREVFEITHPEIVVFEPEQSNGIGILLMPGGGYQRVSVDKEGADSAHVLNQAGFTVFVMTYRMPNEGHEFGSWTPLADAQRAMRLVRRLPLASHLSSIGVLGFSAGGHVAASLATNNALDIYPLQDEAERVSAKPDFCALMYPVISMNIDIAHMGSRAELLANLERESDLLRFSLEKQVTSDMPPCFLLHASDDTAVSAENSLVFWQALRQHEIATEMHLFEQGKHGFGIRDAQGLPVAAWPQLLSAWLQNLAEKARR
>NZ_CP042452.1|WP_005482884.1|68376_69306_+|sugar-kinase
MNPISRVAIIGECMVELKKHDGVLQQGFGGDTLNTAVYLSRLTKQHGVETSYVTGLGHDPFSREMLTAWREEGINTDMVYLSEDKLPGIYAIETAEDGERSFFYWRNDAAAKYWLRERALLSLVKDLCQHQMIYLSGISLAIISDDCRQMLIELLTMCRKEGVKIAFDNNFRPKLWPNIEQARDFYSKILSVTDMAFLTFDDEVMLWGDKHEDEAISRTKNFGVKEIIVKRGADDCFVVTQDQQHTVAALKVDAVVDTTAAGDSFSAGYLAKRILGGDVAESALAGHKVAGTVIQHRGAIIPSQAMPTI
>NZ_CP042452.1|WP_167427154.1|69317_69941_+|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase
MKDLNQQLSEIKVVPVIAIKDAGKAVKLAQVLIENGLPCAEVTFRTEDAALAIKNMREAYPEMLIGAGTVLTSAQVDEAIDAGVDFIVSPGFNPTIVKYCQQRNVTIVPGVNNPSLVEQAMEMGLRTLKFFPAEPSGGVAMLKALSAVYPVKFMPTGGVSPSNVKDYLSISSVLACGGTWMVPGDLIDNEQWDELAKLVREVAGIIE
>NZ_CP042452.1|WP_167427155.1|70126_71866_-|transporter
MTLLDSMIVMIYLLFIGIAAWLFRRFSTSSNDFLQGGGTMMWWMAGATAFMTQFSAWTFTGAAAKAYEDGISVMFIFWGNALGFFVAAAFFARRYRRLRVETAMEVIRVRFGHTSEQLFTWLSFPLTLIACAIWMNGLASFFSAVFAIEMSTTILAMGVVVTLIAVSGGAWTVSVTNVIQLILLIAITLVIGYTALQRFDSPSEVFAHATPIYGEQIRMPSLFVMWAIAMLLQQTMSNNHTLSCYRFLTTANDKDATKAAFVAGVLFVFAPVLWFMPAWFVAAQNIDLLAIYPALEQSANNAAYLYYIQHYMPQGLLGLVMVALVAATIAPLSSAHNRNAGIVVKSLYQVWFNPNATSRQQLMVGKIATIVSGVLATVTALLLASVESYSLFDMMIVFAAFIQMPINIPSLLALVSMKTPNWSGWATVMVGCAVSLFMMFIFDVQWLSSSPLTPRESKDLSVVATLAVHLLVTGGFFLFTRVFYAKEPPSIQQSRTALAIQLATPISDEEQSPINHKQGLYVGSITALAGMLLILAGVVLAGSSQSIFVAIGCIVLLFSLFLLQPTQHSKRAWQKQKTK
>NZ_CP042452.1|WP_167427156.1|71995_72673_+|porin
MKVRYLTSALLLAMTSGLAAAASVDIRHEYVPDRDGDEHRDRIYVSHRFDNQIGFSVEAKWNYKDGHMGNAGHETGVSYRWKATDNFSLTPGINIDASPSGASVFKYNLTGAYKINDEWDVAARIRHGDKNTDDSRYNQLNLYANRKFEWGKLGVEAEYKDIHGGEGGWKDKGHDQLIDFKGEYTKLESGVIPFFAIAAITHKGDGSEFKDEYVPRFRVGLKYNF
>NZ_CP042452.1|WP_167427157.1|72688_74917_+|exopolygalacturonate-lyase
MKKHTLALCLAAILAPVAHAAEIKVEDLTWKAITFGQSTDMNFGSTILPEKVGVNQVTVNGEAVAAGKLASTFTIESRGGKLANSHEGLTFYYTELPTDVNFTLSADVVLEQLGPETGATPNRQEGAGLMVRDILGAERLVPQPEGHEEFPSASNMVMNLMRSHTRTNDGMTNINASFREGVYQPWGTPGNRLSRVDYVEGVPYGTAETYRMTLTRTNDGFKVSYRNGEKFVEQAVKGANANIVEMQNSDSQYVGFFASRNAKMTVSNVDLQLAAADTVDAPKYAAKQGELVFQIASSPRSATKEYPVQARANYSGEFEVLHNDKVVAKQTVTAGELFSQWLTLDSGANQMEVRFTAIDGPNKETQAHRYSVDVVSLPDPMTLYVAPNGSDKGNGSQAQPLDLATAVELLPAGGTIILKDGDYQGMEIPLTASGSVDKLKHLRAERDNVRFVSELRHEANYWHYQGIEVAGAQFIVHGSHNTFEKMVTHGAPDTGFVITSPENIGRALWASYNQVIESESYNNMDPSQINADGFAAKMRIGDGNTFIRCLSHHNIDDGWDLFNKVEDGANGAVTILDSISFSNGRALDVANKGGTIGNGFKLGGEGIPVPHVVKNSLSFNNNMDGFTDNFNPGALVLSDNVSIDNKRFNYLFRKSPYSGEIEQGTFTNNRSYRFHVSSKYDDVINSAKSTGNALVENGTTYTSDGKAVDSKTLAPLKQASVIDTQQAIPGKQEAMQLKQLIH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

954130 : 960606

Vibrio_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167427500.1\|954130_954499_-	hypothetical protein	Q9MCC3	Vibrio_phage	8.5e-56	88.4
WP_012842283.1\|954698_955004_+	hypothetical protein	NA	NA	NA	NA
WP_029826510.1\|955006_955222_+	hypothetical protein	A0A1W6UGD1	Vibrio_phage	1.1e-34	100.0
WP_167427501.1\|955145_956354_+	phage replication protein	Q7DKP2	Vibrio_phage	7.4e-242	98.3
WP_005477647.1\|956357_956717_+	DUF1293 family protein	Q783U4	Vibrio_phage	9.1e-63	100.0
WP_005477619.1\|956720_956951_+	hypothetical protein	Q783U3	Vibrio_phage	1.6e-36	100.0
WP_005477614.1\|956956_957202_+	hypothetical protein	Q783U2	Vibrio_phage	4.3e-32	100.0
WP_062852852.1\|957763_958870_+	hypothetical protein	Q783U1	Vibrio_phage	1.3e-152	96.2
WP_005477634.1\|958871_959216_+	DUF2523 domain-containing protein	Q783U0	Vibrio_phage	5.0e-58	100.0
WP_167427502.1\|959220_960606_+	toxin	Q783T9	Vibrio_phage	2.6e-262	96.3

DBSCAN-SWA_2

1512586 : 1593989

Vibrio_phage(65.96%)

portal,capsid,terminase,integrase,coat,tail,head

attL 1502231:1502249|attR 1554474:1554492

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1502231:1502249	attL	NA	NA	NA	NA
WP_167427718.1\|1512586_1514584_-	S9 family peptidase	F2Y2S5	Organic_Lake_phycodnavirus	4.5e-10	29.5
WP_047009779.1\|1514910_1516254_-	DEAD/DEAH box helicase	E3T5E1	Cafeteria_roenbergensis_virus	2.6e-41	31.2
WP_005375145.1\|1516806_1517061_+	membrane protein	NA	NA	NA	NA
WP_167427719.1\|1517471_1518062_-	acyltransferase	A0A1V0SJ47	Klosneuvirus	9.6e-09	26.7
WP_167427720.1\|1518685_1518883_-	hypothetical protein	A0A2I7RNJ8	Vibrio_phage	4.0e-20	81.5
WP_167427721.1\|1518882_1519650_-	hypothetical protein	A0A2I7RNK2	Vibrio_phage	8.4e-106	74.0
WP_167427722.1\|1519640_1520330_-	hypothetical protein	A0A2I7RNK1	Vibrio_phage	1.8e-115	84.3
WP_062859697.1\|1520339_1520876_-	hypothetical protein	A0A2I7RNK5	Vibrio_phage	8.5e-81	88.1
WP_167427723.1\|1523790_1524393_-	hemolysin	A0A2I7RNJ4	Vibrio_phage	8.9e-103	86.5
WP_167427724.1\|1524379_1525567_-	hypothetical protein	A0A2I7RNJ7	Vibrio_phage	3.2e-197	85.1
WP_029852955.1\|1525559_1525907_-	DUF2590 family protein	A0A2I7RNH9	Vibrio_phage	5.0e-50	90.4
WP_167427725.1\|1525906_1527796_-\|tail	phage tail tape measure protein	A0A2I7RNI7	Vibrio_phage	2.2e-264	76.4
WP_005530037.1\|1527821_1527965_-	hypothetical protein	Q1I0Y8	Pasteurella_virus	4.5e-05	51.2
WP_167427726.1\|1528006_1528270_-	hypothetical protein	A0A2I7RNJ9	Vibrio_phage	1.5e-30	78.3
WP_062859693.1\|1528266_1528503_-	hypothetical protein	A0A1D9C9R8	Salinivibrio_phage	1.3e-09	42.7
WP_062859692.1\|1528505_1528736_-	hypothetical protein	NA	NA	NA	NA
WP_151515336.1\|1528735_1529245_-	hypothetical protein	A0A2I7S7C4	Vibrio_phage	4.2e-21	41.7
WP_167427727.1\|1529241_1529460_-	TraR/DksA family transcriptional regulator	A0A2I7RNJ6	Vibrio_phage	1.4e-18	72.3
WP_020841105.1\|1529487_1529943_-	DUF2597 family protein	A0A2I7RNI0	Vibrio_phage	2.6e-78	95.4
WP_167427728.1\|1529946_1531068_-	DUF2586 family protein	A0A2I7RNI8	Vibrio_phage	4.0e-189	87.2
WP_029839584.1\|1531083_1531740_-	virion morphogenesis protein	A0A2I7RNI6	Vibrio_phage	4.1e-109	91.3
WP_053321695.1\|1531723_1532218_-\|tail	phage tail protein	A0A2I7RNH2	Vibrio_phage	1.7e-83	93.3
WP_167427729.1\|1532214_1532634_-\|head	head completion/stabilization protein	A0A2I7RNH7	Vibrio_phage	9.3e-59	82.0
WP_072866688.1\|1532744_1533461_-\|terminase	terminase	A0A2I7RNJ0	Vibrio_phage	6.2e-119	84.5
WP_167427730.1\|1533473_1534487_-\|capsid	phage major capsid protein, P2 family	A0A2I7RNH6	Vibrio_phage	2.7e-176	90.8
WP_167427731.1\|1534500_1535367_-\|capsid	phage capsid protein	A0A2I7RNH1	Vibrio_phage	3.5e-116	82.1
WP_029860082.1\|1535543_1537325_+\|terminase	terminase	A0A2I7RNI3	Vibrio_phage	0.0e+00	92.1
WP_167427732.1\|1537321_1538347_+\|portal	phage portal protein	A0A2I7RNI9	Vibrio_phage	3.4e-147	74.1
WP_080263359.1\|1538745_1539198_+	transcriptional regulator	A0A2I7RNG8	Vibrio_phage	1.9e-65	77.9
WP_029837886.1\|1539139_1539364_-	hypothetical protein	NA	NA	NA	NA
WP_167427733.1\|1539598_1539931_+	helix-turn-helix transcriptional regulator	U3PIK7	Vibrio_phage	5.4e-17	49.5
WP_167427734.1\|1540099_1542592_-	replication endonuclease	A0A166YHE2	Vibrio_phage	4.2e-300	61.0
WP_167427735.1\|1542588_1543158_-	hypothetical protein	U3PB60	Vibrio_phage	4.4e-19	58.4
WP_167427736.1\|1543154_1543382_-	hypothetical protein	NA	NA	NA	NA
WP_167427737.1\|1543378_1543999_-	DNA methyltransferase	U3PDF3	Vibrio_phage	3.3e-92	77.1
WP_167427738.1\|1543995_1544448_-	DUF3850 domain-containing protein	A0A0A8WI22	Clostridium_phage	5.8e-06	38.3
WP_167427739.1\|1544444_1544933_-	hypothetical protein	R9TNP8	Vibrio_phage	7.4e-23	60.4
WP_167427872.1\|1545013_1545364_-	hypothetical protein	NA	NA	NA	NA
WP_167427740.1\|1545373_1545913_-	transcriptional regulator	A0A2I7RNI1	Vibrio_phage	2.6e-77	81.0
WP_167427741.1\|1545922_1546069_-	hypothetical protein	A0A2I7RNG0	Vibrio_phage	8.3e-15	74.0
WP_167427742.1\|1546065_1546266_-	Rha family transcriptional regulator	A0A1D9C9M5	Salinivibrio_phage	8.4e-18	61.5
WP_029837866.1\|1546458_1547058_+	phage repressor protein CI	A0A2I7RNF9	Vibrio_phage	1.0e-58	55.8
WP_167427743.1\|1547087_1548062_+	hypothetical protein	NA	NA	NA	NA
WP_167427744.1\|1548069_1549113_+\|integrase	tyrosine-type recombinase/integrase	R9TMQ4	Vibrio_phage	1.1e-89	47.3
WP_031780432.1\|1549303_1550209_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_167427745.1\|1550236_1551652_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	1.8e-61	31.6
WP_047009571.1\|1551671_1552475_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	2.5e-20	31.3
WP_065646347.1\|1552464_1553415_-	DUF1722 domain-containing protein	NA	NA	NA	NA
WP_005394915.1\|1553812_1554523_+	purine-nucleoside phosphorylase	NA	NA	NA	NA
1554474:1554492	attR	NA	NA	NA	NA
WP_005394913.1\|1554594_1556064_+	hypothetical protein	NA	NA	NA	NA
WP_167427746.1\|1556224_1557709_+	hypothetical protein	NA	NA	NA	NA
WP_167427747.1\|1557692_1559276_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.2e-16	41.2
WP_006741936.1\|1559519_1559900_+	DUF3302 domain-containing protein	NA	NA	NA	NA
WP_005394904.1\|1559899_1561030_+	HlyD family secretion protein	NA	NA	NA	NA
WP_005375133.1\|1561368_1561917_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_167427748.1\|1561923_1563663_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	35.1
WP_005394899.1\|1563659_1564499_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_043884592.1\|1564623_1564935_-	hypothetical protein	A0A2H4IYD3	uncultured_Caudovirales_phage	3.5e-18	60.3
WP_167427749.1\|1565106_1566288_-	MFS transporter	NA	NA	NA	NA
WP_167427750.1\|1566491_1567346_-	quinol dehydrogenase ferredoxin subunit NapH	NA	NA	NA	NA
WP_167427751.1\|1567345_1568116_-	ferredoxin-type protein NapG	A0A077SLP0	Escherichia_phage	1.2e-08	28.1
WP_005462908.1\|1568511_1569012_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_167427873.1\|1569058_1570036_-	phosphotransferase	NA	NA	NA	NA
WP_006741945.1\|1570035_1570311_-	N-acetyltransferase	NA	NA	NA	NA
WP_167427752.1\|1570447_1571185_+	flagellar brake protein	NA	NA	NA	NA
WP_005394882.1\|1571307_1572267_-	porin	NA	NA	NA	NA
WP_005394881.1\|1572665_1574294_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-31	46.8
WP_005394880.1\|1574588_1576949_-	ATP-binding protein	NA	NA	NA	NA
WP_085342565.1\|1577136_1577634_+	hypothetical protein	NA	NA	NA	NA
WP_167427753.1\|1577720_1579352_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.0e-20	33.0
WP_167427754.1\|1579593_1581627_-	S9 family peptidase	A0A1V0SHT0	Klosneuvirus	2.0e-66	31.7
WP_005375112.1\|1581748_1582648_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006741952.1\|1582810_1584502_+	L-lactate permease	NA	NA	NA	NA
WP_005383962.1\|1584817_1585957_+	FMN-dependent L-lactate dehydrogenase LldD	NA	NA	NA	NA
WP_005375109.1\|1586048_1586396_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_167427755.1\|1586696_1587800_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_104972908.1\|1587872_1588592_-	carbonic anhydrase	NA	NA	NA	NA
WP_167427756.1\|1588733_1589705_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_167427757.1\|1589701_1592116_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_167427758.1\|1592108_1592867_-	molecular chaperone	NA	NA	NA	NA
WP_167427874.1\|1592906_1593383_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_047009589.1\|1593443_1593989_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP042451

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

589783 : 606948

uncultured_Mediterranean_phage(18.18%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005393892.1\|589783_591424_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.2e-155	52.2
WP_005383785.1\|591502_592804_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.1e-137	60.6
WP_005380907.1\|593196_593478_+	cell division protein FtsB	NA	NA	NA	NA
WP_065646112.1\|593479_594184_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	9.0e-06	23.0
WP_005393886.1\|594201_594678_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_046875093.1\|594724_595768_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_005393882.1\|595767_596544_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.8e-66	50.8
WP_167426239.1\|596543_597170_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.5e-36	53.3
WP_167426240.1\|597183_598107_+	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005393877.1\|598187_599174_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	6.9e-36	35.2
WP_167426241.1\|599254_601816_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.3e-30	22.4
WP_104974807.1\|601900_602383_+	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.3e-27	48.7
WP_005393872.1\|602583_603627_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	6.9e-111	60.4
WP_005393871.1\|603755_604223_+	recombination regulator RecX	NA	NA	NA	NA
WP_109169448.1\|604365_606948_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	2.0e-79	38.3

DBSCAN-SWA_2

2498999 : 2505783

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005381572.1\|2498999_2499470_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	48.7
WP_164666669.1\|2499639_2500749_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	9.4e-66	39.8
WP_053811835.1\|2500922_2501576_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	6.8e-32	36.6
WP_167426834.1\|2501584_2502712_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	4.6e-44	33.7
WP_005381578.1\|2502719_2503169_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_167426835.1\|2503375_2504626_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.2e-98	48.5
WP_167426836.1\|2504643_2505783_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.7e-62	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP042452

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP042451

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection