CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP044462	Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence	1 crisprs	NA	0	1	0
NZ_CP044455	Acinetobacter indicus strain B18 chromosome, complete genome	4 crisprs	c2c9_V-U4,cas14j,csa3,cas3,WYL,DEDDh,TnsE_C	3	27	13
NZ_CP044460	Acinetobacter indicus strain B18 plasmid pB18-5, complete sequence	1 crisprs	NA	0	1	0
NZ_CP044457	Acinetobacter indicus strain B18 plasmid pB18-2, complete sequence	0 crisprs	DEDDh,RT,WYL	0	0	1
NZ_CP044461	Acinetobacter indicus strain B18 plasmid pB18-6, complete sequence	0 crisprs	NA	0	0	0
NZ_CP044456	Acinetobacter indicus strain B18 plasmid pB18-1, complete sequence	1 crisprs	csf2gr7	0	1	0
NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	1 crisprs	cas3-cas2,cas8f,cas5f,cas7f,cas6f	0	28	0
NZ_CP044459	Acinetobacter indicus strain B18 plasmid pB18-4, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044462_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044462_1

3586-3682

Orphan

Consensus_repeat	Method
CTTAACTATGACGGATTGACTACTAACTATGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044462_1

>merge|NZ_CP044462|1|3586-3682|CRISPRCasFinder
CTTAACTATGACGGATTGACTACTAACTATGACGGATTGACTACTAACTATGACGGATTGACTACTTAACTATGACGGATTGACTACTAACTATGAC

>NZ_CP044462|1|1|3586-3682|CRISPRCasFinder
CTTAACTATGACGGATTGACTACTAACTATGAC	GGATTGACTACTAACTATGACGGATTGACTA
CTTAACTATGACGGATTGACTACTAACTATGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044462.1\|WP_171524640.1\|6908_7103_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044462.1\|WP_163146742.1\|8926_9490_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044462.1\|WP_002067466.1\|4680_5226_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044462.1\|WP_163146741.1\|7128_7740_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239736
NZ_CP044462.1\|WP_163146740.1\|5413_6262_-\|trypsin-like-peptidase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379142
NZ_CP044462.1\|WP_163146738.1\|104_1424_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|373913
NZ_CP044462.1\|WP_057048785.1\|3723_4617_+\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP044462.1\|WP_163146743.1\|9513_9723_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044462.1\|WP_163146744.1\|10472_11297_+\|ImmA/IrrE-family-metallo-endopeptidase	unknown	unknown	gnl\|CDD\|368753
NZ_CP044462.1\|WP_000877730.1\|7947_8376_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044462.1\|WP_163146739.1\|1447_1912_-\|DNA-mismatch-endonuclease-Vsr	unknown	unknown	gnl\|CDD\|226250
NZ_CP044462.1\|WP_087662598.1\|10110_10440_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045

Protein	Function_ID	Function_description	E-value
NZ_CP044462.1\|WP_163146738.1\|104_1424_+\|hypothetical-protein	gnl\|CDD\|373913	pfam15515, MvaI_BcnI, MvaI/BcnI restriction endonuclease family. This family of proteins includes the restriction endonucleases MvaI and BcnI. These enzymes both function as monomers. MvaI cleaves the sequence CC/WGG, where W is an A or a T nucleotide, leaving sticky ends. BcnI cleaves the sequence CC/SGG, where S is G or C, leaving sticky ends.	7.5597e-34
NZ_CP044462.1\|WP_163146744.1\|10472_11297_+\|ImmA/IrrE-family-metallo-endopeptidase	gnl\|CDD\|368753	pfam06114, Peptidase_M78, IrrE N-terminal-like domain. This entry includes the catalytic domain of the protein ImmA, which is a metallopeptidase containing an HEXXH zinc-binding motif from peptidase family M78. ImmA is encoded on a conjugative transposon. Conjugating bacteria are able to transfer conjugative transposons that can, for example, confer resistance to antibiotics. The transposon is integrated into the chromosome, but during conjugation excises itself and then moves to the recipient bacterium and re-integrate into its chromosome. Typically a conjugative tranposon encodes only the proteins required for this activity and the proteins that regulate it. During exponential growth, the ICEBs1 transposon of Bacillus subtilis is inactivated by the immunity repressor protein ImmR, which is encoded by the transposon and represses the genes for excision and transfer. Cleavage of ImmR relaxes repression and allows transfer of the transposon. ImmA has been shown to be essential for the cleavage of ImmR. This domain is also found in in metalloprotease IrrE, a central regulator of DNA damage repair in Deinococcaceae, HTH-type transcriptional regulators RamB and PrpC.	1.78701e-11
NZ_CP044462.1\|WP_163146741.1\|7128_7740_-\|recombinase-family-protein	gnl\|CDD\|239736	cd03767, SR_Res_par, Serine recombinase (SR) family, Partitioning (par)-Resolvase subfamily, catalytic domain; Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subgroup is composed of proteins similar to the E. coli resolvase found in the par region of the RP4 plasmid, which encodes a highly efficient partitioning system. This protein is part of a complex stabilization system involved in the resolution of plasmid dimers during cell division. Similar to Tn3 and other resolvases, members of this family may contain a C-terminal DNA binding domain.	1.39139e-58
NZ_CP044462.1\|WP_057048785.1\|3723_4617_+\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	7.85278e-63
NZ_CP044462.1\|WP_163146739.1\|1447_1912_-\|DNA-mismatch-endonuclease-Vsr	gnl\|CDD\|226250	COG3727, Vsr, DNA G:T-mismatch repair endonuclease [DNA replication, recombination, and repair].	4.77879e-54
NZ_CP044462.1\|WP_087662598.1\|10110_10440_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	3.99489e-15
NZ_CP044462.1\|WP_163146740.1\|5413_6262_-\|trypsin-like-peptidase-domain-containing-protein	gnl\|CDD\|379142	pfam13365, Trypsin_2, Trypsin-like peptidase domain. This family includes trypsin-like peptidase domains.	1.5496e-08

>NZ_CP044462.1|WP_163146739.1|1447_1912_-|DNA-mismatch-endonuclease-Vsr
MVDIVDPSTRSRMMAGIKGSNTKPELLVRHLLHKKGFRYRFHVKDLPGKPDIVLPKYRSVIFIHGCFWHGHQNCHLFRLPATRTEFWQEKICRNQANDSRAVDILRASNWRVCIVWECSIRGAKKDPEKVVSTIADWLAGDRQFLEIRDTPRDR
>NZ_CP044462.1|WP_163146738.1|104_1424_+|hypothetical-protein
MATIRQMSQTMQALGATRILLKPLSNNDNSKQQIYFGGNFEVLQDFPLGEIRADGESSKGPIFKAPLKLFWITPEGETEEATGSQIILYPKYPEIRLSGFLRGCSLAPSKIMKPPTPEERALYASQKRGMILGLAEDKVFAYTGSWDEKISGEIQEYAEQNQDRQVLSVFYEYYSSLTDSQELLIGKLKDIYLKGPIRSRRLDKDGTVIFYEAPNGAGFTLECEFGIIPNGKASPDFLDWELKTRSKSSTTLMTPEPDIGLYRDSYANFMNTHANRRQPQQLYFTAKHQTGIRNPETCLTLFIEGYDLEKKKITLSEGGYFLKNDNGEVAAGWTFSKLLNHWKNKHTKTCYVSYTNLKLEGSTYYQFGPKVSLAKGASIEKFLDALATGIVVHDPGCKYALDVNTGKWKQKKRNQFRVSAVNSACLYDEYKELDLSSDK
>NZ_CP044462.1|WP_057048785.1|3723_4617_+|replication-initiation-protein
MNKNHVVKSNQVIEASYQLSAVEQRIVLAAISRIPKNQPITDDELYPVSINELRQLGVHEKTAYRDLKEGINRLYERSINLSIDDKSIKMRWVQEVQFLDSQSVIGIRFSKPILPFISNLSREFTKYALSDIAGINSGYGIRIYELLVQYRQIGKREISVENLRTMLELGKKYPLFADFKKRVIDTAIDQINECSPLNVTYEQKKTGRKVTSIIFSFKEKTKSISHPNTDVPKEFYKLTDAQINMFGNQLSRLHELSHLAQQGESYDDLAITIKDMLRDPKQQKQFLPYLKNLGFKL
>NZ_CP044462.1|WP_002067466.1|4680_5226_+|hypothetical-protein
MKTSTKYSVSDAATLYKKSRATLYKDIKNGVLSRDHDGSIDFSELLRVYGEPFGGTNSKRLDTSPRQNIDTPEYTDNTVVELKNQIEFLKKQLEKAEDRETKANARIDTLLTLIEMKPPQANISTFTEQQSDQDIATDPRSKKPNEGGLTTQEIKRIPVPEHIEPEPEKRGFWSRFFKPYG
>NZ_CP044462.1|WP_163146740.1|5413_6262_-|trypsin-like-peptidase-domain-containing-protein
MNKTMSVAEELLYSTVKITAYLNGKAHSTGTGFFTAFDNDGENCFLALVTNKHVIEKSDQIKIICHVKNNEGEPSGNFVELSIGINDKQVIYHPDTKIDLCAISIAGLINQAIDQGMPIFYKFLDLSLIPNTDDWQYFDAIEEVTMIGCPNGISDEVNHLPIIRKGITASSLAKLYNGKQEFMVDMACFPGSSGSPIFLYDKKGYLDRKTNTYYMDKSRIHLVGILYAGPLINNNGQVILAQPPQVTVAAMMHLGNAIRSTELHVLNDEVRKFKSTLISAQV
>NZ_CP044462.1|WP_171524640.1|6908_7103_-|hypothetical-protein
MSYLFTKEQGILKGQKTELMMKKHLIFLVFIVMVFILALVVKIDNDHKKGQALKKLELVEKQIP
>NZ_CP044462.1|WP_163146741.1|7128_7740_-|recombinase-family-protein
MIEMNTRIYLRASTKDQDAERALQILQDLNQNLNLGKTIVYVENYSGTKLDRPELNKLLSEANQGDTLLVESIDRLSRLIQQDFQELKRRIQEKGLRLIVADLPTTYQMIQTSDSITHSILELINNMLIDLLATMARLDNEKRIERIKQGLERSGYKPTGKKANEAKHKRIKELLASGNMTKEEIAKAVNCGVATVYRVAKVI
>NZ_CP044462.1|WP_000877730.1|7947_8376_-|hypothetical-protein
MKYSNEKIVKALLLSPLPLLFFTAVLFIVMNQEYSLYSILVVLVGHGLVYLAYCILTVPFSFIFSILLNRYNSLNLLTICIASIIIATPFFILFGWSHTGEISKEWWKMYTDTWTIFMALFPGLCYWLFLINLKDKKSKNIE
>NZ_CP044462.1|WP_163146742.1|8926_9490_-|hypothetical-protein
MFPPKEYIKKSFKQGVAITILLGVIPLLLALCQDIWGVIFHKSHDLSNFNEMMKSLIPSHDNYVHILIWLSGIYCLPLLMLVVAERELERKIPIPSWIKNFILNFEYALSAIFSVMFVASAIFFTTGFFFCFTSFGVSYGIGFVVIGIILFTLTMYALAAMLELKDLFVKNDSDSEKNLDSDNEKES
>NZ_CP044462.1|WP_163146743.1|9513_9723_-|hypothetical-protein
MTDQTINILCSCGSDKFEIPSNPKASDTITCAKCGAQEKYGILQKEIASKVKKQVEANFKKMLRRAGFK
>NZ_CP044462.1|WP_087662598.1|10110_10440_+|helix-turn-helix-transcriptional-regulator
MNTESNETYVFPERLKAIRELRKLTQAQLAEKSKIPSTSISHLEAGSRKPSFDNLRKLGIALEVSTDYLLGRVDSFEGTNTDTLFRDLQNLTDSDRETIRRFAESLRNK
>NZ_CP044462.1|WP_163146744.1|10472_11297_+|ImmA/IrrE-family-metallo-endopeptidase
MSNNTKQYIEKAATQIRQDYDLIDYEIDLFKLGEELGIDIQTQSQKSHGISGALIRNGNDFLIYYASSINNIPYQRFSIAHEFGHYFLPEHPENIFNKNGTHFSSAGSSSKDPYEREADYFSTCLLMPKFLFEKEMYKYNDGLEAIKSLASIFNTSLTSTAIRYIELTEAPALLIISSNGKVDAVFDTKELRKFGKCIYIKNKVLPNKNIISTELSKKEIFLNEWIDTNHRIKAIEESITLGSYEKTLTVITTNTLYEEIEDEFSDTWEPPSFK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP044476	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence	6019-6049	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP044476	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence	6040-6070	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_LR026972	Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence	14314-14344	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_LR026972	Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence	14335-14365	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP023027	Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence	2706-2736	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP023027	Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence	2727-2757	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP020587	Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence	1572-1602	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP020587	Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence	1593-1623	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP021348	Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence	15134-15164	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP021348	Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence	15155-15185	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP023021	Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence	4058-4088	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP023021	Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence	4079-4109	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_KY499579	Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence	6032-6062	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_KY499579	Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence	6053-6083	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP027248	Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence	13480-13510	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP027248	Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence	13501-13531	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP028570	Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence	3685-3715	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP028570	Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence	3706-3736	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP031994	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence	2308-2338	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP031994	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence	2329-2359	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP044462	Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence	3598-3628	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP044462	Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence	3619-3649	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NC_010481	Acinetobacter baumannii plasmid pABIR, complete sequence	228-258	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NC_010481	Acinetobacter baumannii plasmid pABIR, complete sequence	249-279	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	CP033542	Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence	59-89	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	CP033542	Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence	80-110	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP038648	Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence	1818-1848	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP038648	Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence	1839-1869	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	CP033571	Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence	6655-6685	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	CP033571	Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence	6676-6706	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP033132	Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence	8645-8675	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP033132	Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence	8666-8696	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP033752	Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence	9523-9553	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP033752	Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence	9544-9574	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP027252	Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence	8103-8133	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP027252	Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence	8124-8154	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_LT984691	Acinetobacter baumannii isolate K50 plasmid II, complete sequence	9414-9444	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_LT984691	Acinetobacter baumannii isolate K50 plasmid II, complete sequence	9435-9465	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP029572	Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence	6928-6958	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP029572	Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence	6949-6979	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	MN461228	Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence	3638-3668	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	MN461228	Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence	3659-3689	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	MN481286	Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence	2719-2749	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	MN481286	Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence	2740-2770	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	MN495625	Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence	8319-8349	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	MN495625	Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence	8340-8370	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	MN495626	Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence	8319-8349	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	MN495626	Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence	8340-8370	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP051871	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence	2123-2153	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP051871	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence	2144-2174	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NC_013506	Acinetobacter baumannii plasmid pMMCU2, complete sequence	8538-8568	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NC_013506	Acinetobacter baumannii plasmid pMMCU2, complete sequence	8559-8589	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	MK978160	Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence	2818-2848	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	MK978160	Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence	2839-2869	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NC_013056	Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence	7752-7782	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NC_013056	Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence	7773-7803	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	CP042207	Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence	8144-8174	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	CP042207	Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence	8165-8195	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP042367	Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence	10198-10228	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP042367	Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence	10219-10249	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP018141	Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence	4129-4159	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP018141	Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence	4150-4180	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP038260	Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence	10479-10509	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP038260	Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence	10500-10530	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP049810	Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence	7569-7599	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP049810	Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence	7590-7620	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP015146	Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence	247-277	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP015146	Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence	268-298	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP051877	Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence	1390-1420	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP051877	Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence	1411-1441	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP031981	Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence	759-789	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP031981	Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence	780-810	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP026427	Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence	6953-6983	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP026427	Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence	6974-7004	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP014479	Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence	17984-18014	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP014479	Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence	18005-18035	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP016899	Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence	2196-2226	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP016899	Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence	2217-2247	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP051868	Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence	7687-7717	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP051868	Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence	7708-7738	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NC_019280	Acinetobacter baumannii plasmid pMMD, complete sequence	7703-7733	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NC_019280	Acinetobacter baumannii plasmid pMMD, complete sequence	7724-7754	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP023035	Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence	2972-3002	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP023035	Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence	2993-3023	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_KT022421	Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence	4251-4281	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_KT022421	Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence	4272-4302	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP032127	Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence	18027-18057	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP032127	Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence	18048-18078	0	1.0
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP015112	Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence	7418-7448	1	0.968
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP015112	Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence	7439-7469	1	0.968
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP032275	Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence	4788-4818	1	0.968
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP032275	Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence	4809-4839	1	0.968
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP010354	Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence	8559-8589	1	0.968
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP010354	Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence	8580-8610	1	0.968
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP050406	Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence	9451-9481	1	0.968
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP050406	Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence	9472-9502	1	0.968
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP035940	Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence	3221-3251	1	0.968
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP035940	Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence	3242-3272	1	0.968
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP032275	Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence	4767-4797	8	0.742
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP050406	Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence	9493-9523	8	0.742
NZ_CP044462_1	1.1\|3619\|31\|NZ_CP044462\|CRISPRCasFinder	3619-3649	31	NZ_CP035940	Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence	3200-3230	8	0.742

1. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP044476 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

2. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP044476 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

3. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_LR026972 (Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

4. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_LR026972 (Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

5. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP023027 (Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

6. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP023027 (Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

7. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP020587 (Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

8. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP020587 (Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

9. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP021348 (Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

10. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP021348 (Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

11. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP023021 (Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

12. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP023021 (Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

13. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_KY499579 (Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

14. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_KY499579 (Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

15. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP027248 (Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

16. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP027248 (Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

17. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP028570 (Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

18. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP028570 (Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

19. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP031994 (Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

20. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP031994 (Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

21. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP044462 (Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

22. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP044462 (Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

23. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NC_010481 (Acinetobacter baumannii plasmid pABIR, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

24. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NC_010481 (Acinetobacter baumannii plasmid pABIR, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

25. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to CP033542 (Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

26. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to CP033542 (Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

27. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP038648 (Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

28. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP038648 (Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

29. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to CP033571 (Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

30. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to CP033571 (Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

31. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP033132 (Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

32. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP033132 (Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

33. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP033752 (Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

34. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP033752 (Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

35. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP027252 (Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

36. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP027252 (Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

37. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_LT984691 (Acinetobacter baumannii isolate K50 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

38. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_LT984691 (Acinetobacter baumannii isolate K50 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

39. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP029572 (Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

40. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP029572 (Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

41. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to MN461228 (Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

42. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to MN461228 (Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

43. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to MN481286 (Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

44. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to MN481286 (Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

45. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to MN495625 (Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

46. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to MN495625 (Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

47. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to MN495626 (Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

48. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to MN495626 (Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

49. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP051871 (Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

50. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP051871 (Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

51. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NC_013506 (Acinetobacter baumannii plasmid pMMCU2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

52. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NC_013506 (Acinetobacter baumannii plasmid pMMCU2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

53. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to MK978160 (Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

54. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to MK978160 (Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

55. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NC_013056 (Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

56. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NC_013056 (Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

57. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to CP042207 (Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

58. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to CP042207 (Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

59. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP042367 (Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

60. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP042367 (Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

61. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP018141 (Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

62. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP018141 (Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

63. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP038260 (Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

64. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP038260 (Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

65. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP049810 (Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

66. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP049810 (Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

67. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP015146 (Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

68. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP015146 (Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

69. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP051877 (Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

70. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP051877 (Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

71. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP031981 (Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

72. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP031981 (Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

73. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP026427 (Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

74. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP026427 (Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

75. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP014479 (Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

76. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP014479 (Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

77. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP016899 (Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

78. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP016899 (Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

79. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP051868 (Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

80. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP051868 (Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

81. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NC_019280 (Acinetobacter baumannii plasmid pMMD, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

82. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NC_019280 (Acinetobacter baumannii plasmid pMMD, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

83. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP023035 (Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

84. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP023035 (Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

85. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_KT022421 (Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

86. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_KT022421 (Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

87. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP032127 (Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

88. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP032127 (Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgacggattgacta	Protospacer
*******************************

89. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP015112 (Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.968

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactaccaactatgacggattgacta	Protospacer
***********.*******************

90. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP015112 (Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.968

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactaccaactatgacggattgacta	Protospacer
***********.*******************

91. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP032275 (Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence) position: , mismatch: 1, identity: 0.968

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgagggattgacta	Protospacer
******************** **********

92. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP032275 (Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence) position: , mismatch: 1, identity: 0.968

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgagggattgacta	Protospacer
******************** **********

93. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP010354 (Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence) position: , mismatch: 1, identity: 0.968

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgagggattgacta	Protospacer
******************** **********

94. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP010354 (Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence) position: , mismatch: 1, identity: 0.968

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgagggattgacta	Protospacer
******************** **********

95. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP050406 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence) position: , mismatch: 1, identity: 0.968

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgagggattgacta	Protospacer
******************** **********

96. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP050406 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence) position: , mismatch: 1, identity: 0.968

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgagggattgacta	Protospacer
******************** **********

97. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP035940 (Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence) position: , mismatch: 1, identity: 0.968

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgagggattgacta	Protospacer
******************** **********

98. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP035940 (Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence) position: , mismatch: 1, identity: 0.968

ggattgactactaactatgacggattgacta	CRISPR spacer
ggattgactactaactatgagggattgacta	Protospacer
******************** **********

99. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP032275 (Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence) position: , mismatch: 8, identity: 0.742

ggattgactactaactatgacggattgacta	CRISPR spacer
ctttcagctcctaactatgagggattgacta	Protospacer
   *...** ********** **********

100. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP050406 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence) position: , mismatch: 8, identity: 0.742

ggattgactactaactatgacggattgacta	CRISPR spacer
ctttcagctcctaactatgagggattgacta	Protospacer
   *...** ********** **********

101. spacer 1.1|3619|31|NZ_CP044462|CRISPRCasFinder matches to NZ_CP035940 (Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence) position: , mismatch: 8, identity: 0.742

ggattgactactaactatgacggattgacta	CRISPR spacer
ctttcagctcctaactatgagggattgacta	Protospacer
   *...** ********** **********

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP044455

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044455_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044455_1

334618-334892

Unclear

Consensus_repeat	Method
CGTCGTGAAGGTGGCTTTGGCGACCGTCCACA	CRISPRCasFinder

3 spacers

cas3

The CRISPR arrays of NZ_CP044455_1

>merge|NZ_CP044455|1|334618-334892|CRISPRCasFinder
CGTCGTGAAGGTGGCTTTGGCGACCGTCCACAGCGTTCTTTCGATGACCGTCCACGTCGCGAATTCAACAGCGACCGTCCACGTCGTGAAGGTGGCTTTGGTGACCGTCCACAACGTTCTTTCGATGATCGTCCACGCCGTGAATTCAACAGTGACCGTCCGCGTCGCGAAGGTGGTTTCAACGAGCGTCCACGTTTTGACAGCAATGATGACAACCGTGGCAACCGCGTAGACTACAAACCACGTCGTGAAGGTGCTTTCGGTGACCGTCCTAA

>NZ_CP044455|1|1|334618-334892|CRISPRCasFinder
CGTCGTGAAGGTGGCTTTGGCGACCGTCCACA	GCGTTCTTTCGATGACCGTCCACGTCGCGAATTCAACAGCGACCGTCCA
CGTCGTGAAGGTGGCTTTGGTGACCGTCCACA	ACGTTCTTTCGATGATCGTCCACGCCGTGAATTCAACAGTGACCGTCCG
CGTCGCGAAGGTGGTTTCAACGAGCGTCCACG	TTTTGACAGCAATGATGACAACCGTGGCAACCGCGTAGACTACAAACCA
CGTCGTGAAGGTGCTTTCGGTGACCGTCCTAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044455.1\|WP_171065120.1\|337734_338319_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|377516
NZ_CP044455.1\|WP_163141099.1\|340519_340921_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240046
NZ_CP044455.1\|WP_005180314.1\|341565_343611_-\|ATP-dependent-DNA-helicase-RecG	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|236794
NZ_CP044455.1\|WP_005180318.1\|339923_340517_+\|TIGR00730-family-Rossman-fold-protein	unknown	unknown	gnl\|CDD\|129813
NZ_CP044455.1\|WP_104470047.1\|326211_327153_-\|oxygen-dependent-coproporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|235413
NZ_CP044455.1\|WP_034597976.1\|331937_332768_+\|inositol-monophosphatase	unknown	unknown	gnl\|CDD\|238817
NZ_CP044455.1\|WP_005180328.1\|336217_336997_+\|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE	unknown	unknown	gnl\|CDD\|223838
NZ_CP044455.1\|WP_075168246.1\|324790_325579_-\|shikimate-dehydrogenase	unknown	unknown	gnl\|CDD\|234703
NZ_CP044455.1\|WP_005180329.1\|335399_336221_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213228
NZ_CP044455.1\|WP_034598237.1\|320727_321186_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|377396
NZ_CP044455.1\|WP_034598236.1\|329001_329604_-\|GTP-cyclohydrolase-II	unknown	unknown	gnl\|CDD\|234745
NZ_CP044455.1\|WP_163141096.1\|338330_338618_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132914
NZ_CP044455.1\|WP_005180334.1\|329914_331825_+\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|235470
NZ_CP044455.1\|WP_163141093.1\|322557_324381_-\|acyl-CoA-dehydrogenase-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|185635
NZ_CP044455.1\|WP_005180320.1\|338757_339771_-\|magnesium-and-cobalt-transporter-CorA	unknown	unknown	gnl\|CDD\|213369
NZ_CP044455.1\|WP_163145399.1\|321313_322468_+\|radical-SAM-family-heme-chaperone-HemW	unknown	unknown	gnl\|CDD\|235550
NZ_CP044455.1\|WP_016658513.1\|325797_326007_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044455.1\|WP_163141102.1\|340943_341579_-\|ComF-family-protein	unknown	unknown	gnl\|CDD\|223970
NZ_CP044455.1\|WP_127801056.1\|327388_328762_+\|oxygen-independent-coproporphyrinogen-III-oxidase	unknown	unknown	gnl\|CDD\|236430
NZ_CP044455.1\|WP_016658517.1\|336996_337668_+\|outer-membrane-lipid-asymmetry-maintenance-protein-MlaD	unknown	unknown	gnl\|CDD\|275223

Protein	Function_ID	Function_description	E-value
NZ_CP044455.1\|WP_171065120.1\|337734_338319_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|377516	pfam05494, MlaC, MlaC protein. MlaC is a component of the Mla pathway, an ABC transport system that functions to maintain the asymmetry of the outer membrane. This family of proteins is involved in toluene tolerance, which is mediated by increased cell membrane rigidity resulting from changes in fatty acid and phospholipid compositions, exclusion of toluene from the cell membrane, and removal of intracellular toluene by degradation. Many proteins are involved in these processes.	1.28169e-40
NZ_CP044455.1\|WP_163141099.1\|340519_340921_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240046	cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	3.1048e-35
NZ_CP044455.1\|WP_005180314.1\|341565_343611_-\|ATP-dependent-DNA-helicase-RecG	gnl\|CDD\|236794	PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional.	0
NZ_CP044455.1\|WP_005180318.1\|339923_340517_+\|TIGR00730-family-Rossman-fold-protein	gnl\|CDD\|129813	TIGR00730, LOG_family_protein_YJL055W, TIGR00730 family protein. This model represents one branch of a subfamily of proteins of unknown function. Both PSI-BLAST and weak hits by this model show a low level of similarity to and suggest an evolutionary relationship of the subfamily to the DprA/Smf family of DNA-processing proteins involved in chromosomal transformation with foreign DNA. Both Aquifex aeolicus and Mycobacterium leprae have one member in each of two branches of this subfamily, suggesting that the branches may have distinct functions. [Hypothetical proteins, Conserved].	3.79905e-61
NZ_CP044455.1\|WP_104470047.1\|326211_327153_-\|oxygen-dependent-coproporphyrinogen-oxidase	gnl\|CDD\|235413	PRK05330, PRK05330, oxygen-dependent coproporphyrinogen oxidase.	0
NZ_CP044455.1\|WP_034597976.1\|331937_332768_+\|inositol-monophosphatase	gnl\|CDD\|238817	cd01639, IMPase, IMPase, inositol monophosphatase and related domains. A family of Mg++ dependent phosphatases, inhibited by lithium, many of which may act on inositol monophosphate substrate. They dephosphorylate inositol phosphate to generate inositol, which may be recycled into inositol lipids; in eukaryotes IMPase plays a vital role in intracellular signaling. IMPase is one of the proposed targets of Li+ therapy in manic-depressive illness. This family contains some bacterial members of the inositol monophosphatase family classified as SuhB-like. E. coli SuhB has been suggested to participate in posstranscriptional control of gene expression, and its inositol monophosphatase activity doesn't appear to be sufficient for its cellular function. It has been proposed, that SuhB plays a role in the biosynthesis of phosphatidylinositol in mycobacteria.	7.94629e-111
NZ_CP044455.1\|WP_005180328.1\|336217_336997_+\|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	2.70936e-82
NZ_CP044455.1\|WP_075168246.1\|324790_325579_-\|shikimate-dehydrogenase	gnl\|CDD\|234703	PRK00258, aroE, shikimate 5-dehydrogenase; Reviewed.	1.24994e-109
NZ_CP044455.1\|WP_005180329.1\|335399_336221_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213228	cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	5.52648e-142
NZ_CP044455.1\|WP_034598237.1\|320727_321186_-\|DMT-family-transporter	gnl\|CDD\|377396	pfam04657, DMT_YdcZ, Putative inner membrane exporter, YdcZ. DMT_YdcZ is a family of putative inner membrane exporters from both Gram-positive and Gram-negative bacteria.	5.76236e-35
NZ_CP044455.1\|WP_034598236.1\|329001_329604_-\|GTP-cyclohydrolase-II	gnl\|CDD\|234745	PRK00393, ribA, GTP cyclohydrolase II RibA.	2.65905e-124
NZ_CP044455.1\|WP_163141096.1\|338330_338618_+\|STAS-domain-containing-protein	gnl\|CDD\|132914	cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.	7.58837e-09
NZ_CP044455.1\|WP_005180334.1\|329914_331825_+\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|235470	PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional.	0
NZ_CP044455.1\|WP_163141093.1\|322557_324381_-\|acyl-CoA-dehydrogenase-C-terminal-domain-containing-protein	gnl\|CDD\|185635	PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provisional.	0
NZ_CP044455.1\|WP_005180320.1\|338757_339771_-\|magnesium-and-cobalt-transporter-CorA	gnl\|CDD\|213369	cd12835, EcCorA-like_1, Escherichia coli Mg2+ transporter CorA_like subgroup. A bacterial subgroup of the Escherichia coli CorA-Salmonella typhimurium ZntB_like (EcCorA_ZntB-like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. This subgroup includes the Mg2+ transporters Escherichia coli CorA and Salmonella typhimurium CorA (which can also transport Co2+, and Ni2+). Structures of the intracellular domain of Vibrio parahaemolyticus and Salmonella typhimurium ZntB form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA, and Mrs2p. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	4.76729e-128
NZ_CP044455.1\|WP_163145399.1\|321313_322468_+\|radical-SAM-family-heme-chaperone-HemW	gnl\|CDD\|235550	PRK05660, PRK05660, radical SAM family heme chaperone HemW.	0
NZ_CP044455.1\|WP_163141102.1\|340943_341579_-\|ComF-family-protein	gnl\|CDD\|223970	COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only].	6.09741e-31
NZ_CP044455.1\|WP_127801056.1\|327388_328762_+\|oxygen-independent-coproporphyrinogen-III-oxidase	gnl\|CDD\|236430	PRK09249, PRK09249, coproporphyrinogen dehydrogenase.	0
NZ_CP044455.1\|WP_016658517.1\|336996_337668_+\|outer-membrane-lipid-asymmetry-maintenance-protein-MlaD	gnl\|CDD\|275223	TIGR04430, OM_asym_MlaD, outer membrane lipid asymmetry maintenance protein MlaD. Members of this protein family are the MlaD (maintenance of Lipid Asymmetry D) protein of an ABC transport system that seems to remove phospholipid from the outer leaflet of the Gram-negative bacterial outer membrane (OM), leaving only lipopolysaccharide in the outer leaflet. The Mla locus has long been associated with toluene tolerance, consistent with the proposed role in retrograde transport of phospholipid and therefore with maintaining the integrity of the OM as a protective barrier.	3.54577e-46

>NZ_CP044455.1|WP_034597976.1|331937_332768_+|inositol-monophosphatase
MEPMVVMAARAAQTVGQELLKAHQNRHKLDLQVEEKGIDGPVTRVDRYLEQLTIDTLRKSYKNHSFLGEEFGLQEGKGHDADWCWVIDPLDGTLNFINGFPHFCISIAVQHKGVTQHGVIYDPVKDELFSASRGRGAMLNQRRIRVNVKDSLENTFLAVGHAYRAKRNGEVVSYAKNHFESLLNVTEAGAQYRRAGSAALDLAYVAAGRLDGYFELGLKPWDIAAGELIVKEAGGTVVDARGGSDSMDNGQVLACSMKMLKPLMKAVVPAWGDAAK
>NZ_CP044455.1|WP_005180334.1|329914_331825_+|1-deoxy-D-xylulose-5-phosphate-synthase
MLYTEIPTQRPVTPLLDSIDHPQQLRLLAQSQLAQVADELRQFILYAAGQSGGHFGANLGVIELTVALHYAFNTPHDRLIWDVGHQAYPHKALTGRREQLTTIRAKDGLAAFPAREESEFDTFGVGHSSTAISAGLGMALASRYQQQQREVVAIIGDGAMTAGMAFEAMNDAVAHQADLMVILNDNDMSISCSTGGFAKHLAALWQRGESVHIDAAGEAYIQPHPEWNYTSRLHCAATDAADNLFKAIGFDYFGPFDGHDVDQLVNVFQALKKRKGPRLIHVYTKKGKGFAPAEADQIKYHAISKINSSASAAAAPKYSDVFGQWLSDEAAQDSRLLAITPAMCEGSGMVQFAKQYPERFFDVAIAEQHAVTLAAGMACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLDVTFGIDRAGLVGEDGPTHAGAYDYAYMRTVPNMVIMAPKDENECRQMLHTAYHYPGPAAVRYPRGNGVGVEIQQQLNLMEIGQAEIVARFNEQSDEQIAILAFGSRVYPAIEAAQAFAARHDIAVQVVNMRFVKPLDEAMIERLAENTQLFVTVEEHAVMGGAGSAVSEYLAKAQLVKPIIHLGLDDSFMQQATHSQMLQQAGLDAAGIEQAMTQAWNKLTESVSS
>NZ_CP044455.1|WP_034598236.1|329001_329604_-|GTP-cyclohydrolase-II
MPIEFVATSRLPTAFGEFKITVFQDPKTGEEHVALSKGLEQAPTEPVLVRVHSECLTGDAFASLKCDCGPQLQATQRLINEAGQGVILYLRQEGRGIGLTNKIRAYALQDQGHDTVDANLMLNLPADARQYDMCSIMLDHLQVKAVRLITNNPLKIEALREQGINVVDRVPLTVGLNPFNEQYLKTKHERMAHMYQKDDF
>NZ_CP044455.1|WP_127801056.1|327388_328762_+|oxygen-independent-coproporphyrinogen-III-oxidase
MLKPASSLVQKYNVPGPRYTSYPTVPYWEEASFSSEAWQQSLQRAFAESNASEGISLYIHLPFCESLCTFCGCHKRVTKRHEVEQPYIQAVLKEWDLYCQLLPDRPMIKEIHLGGGTPTFFSVAHLQQLIQGILAKAIVAPEHEFSFEGHPNNTTREHLQALYDLGFRRVSYGVQDYNEKVQKAIHRIQPYEHVQRVTEWARDIGYTSISHDLVFGLPFQNLEDVLHTIQQTTQLNPDRLAFYSYAHVPWIKGNGQRGFKDDDVPKDELKRTLYEEGKKKLLAHGYHEIGMDHFALKSDAMYQAFQQGSLHRNFMGYTASKTQLMIGLGLSSISDSWYSFAQNEKTLEDYYARLEQNEIPVFRGHVLTAEDLMIRRHILNLMCSFQTSWAEPEMQFPELPEVLKQLEEMQEDGLLTLFEDHLQVTEQGKPFVRNICMAFDLRLKRKVPSTRIFSMTI
>NZ_CP044455.1|WP_104470047.1|326211_327153_-|oxygen-dependent-coproporphyrinogen-oxidase
MQHPTSADIQRVREFLLDLQARICAALEQQERAGGGTAEFVIDDWQRPEGGGGRSRVLQNGSVIEKGGVMFSHINISKLPASATERHPGIAGAKAQAMGVSLVIHPKNPNVPTSHANVRLFVAEPEGQDPIWWFGGGFDLTPFYPNDEDVLSWHQTAHDLCAPFGEQVYAEHKQWCDDYFYLKHRDEQRGVGGLFFDDLNQWDFDTCFEYIQAVGNGYLEAILPIFKRNQDKPYTEAQREFQLYRRGRYVEYNLVYDRGTLFGLQTGGRIESILVSLPNLAGWSYRPEWDADSAEKKLTDYYLKPHDWLRELQ
>NZ_CP044455.1|WP_016658513.1|325797_326007_-|hypothetical-protein
MLQNFIAQHKGLLFWLILSLLVCSLSITFIFEHPLSDSLSIVASVFALIALVFTSVLLVLDTILDICNP
>NZ_CP044455.1|WP_075168246.1|324790_325579_-|shikimate-dehydrogenase
MRKQFAVVGNPIEQSRSPELHHAFAEKTGVDLVYRKRLAPLDGFEANIREFFAEGGVGMNVTVPFKEQAFALCDVLSERAKTAKAVNTLWMQDGQLHGDNTDGQGLVDAIRALNWNLDNTEILIIGAGGATRGVIYPLVQAGVKKVVIANRTLARAEQLVADLQQAVPQAELSAIGLDALAGEFDIVINATSASLSGDALILPDALQFQHAYEMAYGKPSSFLEQAKARQIPTSEGFGMLVGQAIESFSIWNGVKPDLKDFL
>NZ_CP044455.1|WP_163141093.1|322557_324381_-|acyl-CoA-dehydrogenase-C-terminal-domain-containing-protein
MPAYKAPLHDIRFLMNEVFDYPAHYQTLSNGEAADPETVDMILEGAADFCENVLSPLNQTGDQEGCHFENGEVKTPKGFKEAYDQFVQSGWQGLSYPEQYGGQNLPMSLNLIKSEMMGTANWSFQMYPGLSVGCINTIIQYGTDEQKDTYLPHLVAGTWSGTMCLTEPQCGTDLGQVKTKAEPQADGTYAISGTKIFISAGEHDLTENIVHIVLARLPDAPAGTKGISLFIVPKFLPSADGGVGERNPVTCGSIEHKMGIRASATAVLNFDNAVGYLIGEPNKGLHAMFTFMNTARIGTAIQGICHAELAFQGALPYAKERMSMRALSGKKDPEKVADAIIHHADVRRMLLTQKAIAEGGRAMIYHAAQIADKMTDALERGDTAAFEQHDDHLGFYTPILKGFLTEMGYEAANHGMQVYGGHGYIKEWGMEQIVRDSRISTLYEGTTGVQALDLIGRKVLLTSKGKVIRDYTAEILKFCGQHARNKYMRRFAWDLTKLCAQWNALTVRIMLAARKDRDIVSSASVDFLMFSGYVMMAYFWAQQAAVASAKLASNDGVETPEFYKAKIKVADFYFERLLPRTQGHAEAMVNPSKTMTALAPEHFSFDY
>NZ_CP044455.1|WP_163145399.1|321313_322468_+|radical-SAM-family-heme-chaperone-HemW
MAELNPASVPLSLYIHMPWCVRKCPYCDFNSHAVPDGKLSLDLEQQYLQALVADFNTQLEFAQGREIHSVFIGGGTPSLISAAGYQWLFAQLKALLPFQDDCEITLEANPGTIEHDPFAGYLAAGINRLSIGVQSFNSDHLKKLGRIHSQSDALSAIHLAREAGFQRINVDLMHGLPEQTLEQALNDLKLAVEQGATHISWYQLTIEPNTVFFRTQPVLPVDEVLEAIQEQGEAYLKANGFINYEVSAWRKERPSAHNLNYWQFGDYLAIGAGAHGKVTRPDGVYRFQKTRLPKDYLAKVPAEHGQFKRITAEEMPFEFMMNALRLNAGVDAKLYAERTGLNLDDLAPVLTSLRQRKLLVEDANRLACTEQGHVFLNSVLEEFL
>NZ_CP044455.1|WP_034598237.1|320727_321186_-|DMT-family-transporter
MKISSQLLLLMPLAMGIGIAMTLQTAINTQLREYLYSPLQAALFSFLIGTIVLAILVFFQQVPKPNLHEIVHLPWYMWLGGVLGVYAISLSIYAAPKLGYLTLTGLILFGQIAMSMLVDHFGVLGTEKAPINWQRLLGGVVIFIGVLLTLQR
>NZ_CP044455.1|WP_005180329.1|335399_336221_+|ABC-transporter-ATP-binding-protein
MNNQTPLQAPALIEVNHLSFKRGERVIYDNVSLKIRRGQITAIMGPSGTGKTTLLRLIGGQLTPDQGEVLLDGKNIGKMSRQELFAARARMGMLFQSGALFTDMTVYENVAFPIRAHTRLPEHLIAELVALKLESVGLRGAEQLMPSELSGGMNRRVALARAIALDPELIMYDEPFAGQDPIVMGVLTRLIRSLREALDLTTIIVSHDVAETLSIADYIYVVAEGKVQGEGTPEQLKQHASPFVRQFLTGSVEGPVDYQFSHQPYLSHEVHSA
>NZ_CP044455.1|WP_005180328.1|336217_336997_+|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE
MNAIAALGRRVIERVRGIGVATLMLLQILFSMPTWIGVKLFIYQMYRVGVMSLLIIVVSGLFIGAVLGLQMYSILVTFGSEAMLGTAVALTLLRELAPVVAALLFAGRAGSALTAEIGLMKATEQLSSMEMIGVDPLKRVISPRLWAGIFSLPMLSVIFAAVGIMGGKFVGVDFLGADEGSYWSGMESTVQFYKDIFNGTIIKSFVFALICTWIAVYQGYACEPTSEGIATSTTRTVVYSSLCVLGFDFVLTAVMFGGV
>NZ_CP044455.1|WP_016658517.1|336996_337668_+|outer-membrane-lipid-asymmetry-maintenance-protein-MlaD
MKSRTSELAVGVFVILFGIALFFLAMRVSGLVGTTIQDSYSMTATFDNINGIKPRAKVALSGVKVGQVESITLDPVTRLATVTMILDGELTTFNQEQLQQVQQYALEELRYSSEYSEADSAQQKAMEKQLLDNMTSITNIDEDAYIMVATNGLLGEKYLKIVPGGGLNYLKRGDQISNTQSTMEIEDLVTKFVTGGAGNKSSSDNPADETSAETTDAEVSFVE
>NZ_CP044455.1|WP_171065120.1|337734_338319_+|ABC-transporter-substrate-binding-protein
MVAGSAFAAPTETPPAFIKKVADGLISRLKADHAKLQNNPALVKTIVRQNLDPYIDSQAFTRIVMGTYATNQYSSAAQRAQFEKNFRETLIENYGSAFAKFSNQTYTLRPYKASNSKNPVVTIDFNNKGEKIPVSFQLVDKGNQWKIRNINVSGIDLGLQFRNQFAANVKRNGGNIDKAIATFKPDAEAAVDKK
>NZ_CP044455.1|WP_163141096.1|338330_338618_+|STAS-domain-containing-protein
MIEYVNQELRVSGKIDFNNAEQYYQQGLQLIQQQPASVVVNLAGLEQGSTLALAVLVRWLRQTPDTQGLVFKAVPEKMMKIIQSCHLQDDLQLSA
>NZ_CP044455.1|WP_005180320.1|338757_339771_-|magnesium-and-cobalt-transporter-CorA
MLEAFYATERGSLEDATINGGFDLHPELVWIDLIAPSQEEQQWVMDAYRQDLPTLKSLEDISSSARFYRDDDGVLHISTYFLTKNKNYQVDDESEENSSILATVQTVAFILNRDRLLTLRGEKLVAFRAFRARARRNDYEIDYKDPTWVLLGLLEAKLDELADILEDIHKDLEKYSTEVLNNRHREMILDLDDMITRLAQLEDMLGKAQLCLIDLRRVLTFLARPRALGSHIYDADIRELSEDVRSLVEHDAFLFQKVRFLLDTTSGFINTEQNDTIRRFSILPSMLAPPMLVASVYGMNTDVLPFAKGTTSFIIVSIILIGFFIGPLIYFRWKKWI
>NZ_CP044455.1|WP_005180318.1|339923_340517_+|TIGR00730-family-Rossman-fold-protein
MTNSIAVFCGSALGSDAVFVDTAQLVGQTIAKQGKTLVYGGGRSGLMGVVADSALQAGGAVIGVIPEPLVDRELAHPGLTELHVVKNMHERKTKMSELSDAFIAMPGGAGTLEEIFEQWTWAQLGIHLKPNAFLNVEGFYDDLLRFIRMTTDKGFTHARFTEALIVSDSMDEILSQFERFQAPEPKWGMADRQALVK
>NZ_CP044455.1|WP_163141099.1|340519_340921_+|NUDIX-domain-containing-protein
MNTITVAAAIILNEQQQLLLVRKQHTECFMQVGGKLESNEPLEQTICREIAEEIGCQAQIKQFVGRFETATANEPDHRLVSYVYYVQLDQDPQVQAEIAEMKWIELEDKTTRLAPLTTEVVIPWVKQHLLQSA
>NZ_CP044455.1|WP_163141102.1|340943_341579_-|ComF-family-protein
MPMFKLLAHSHTLFKKLLPCQLCGSAAQQQYRVCADCLQQLPWLKANVYRQETEIQVACHYRYPVDRMIQQFKYEQQLHYQPLLAGSLCELAYPRVQAIVPMPVATERLAERGYHHTLLLAQVLARHLQLPIWQPVVRRHQHSQKGLSRLERLENLDQQFQLRPDAGRPYRRVLIVDDVVTTGSSIRALKQQLEQLGCHKVYAVCIASADG
>NZ_CP044455.1|WP_005180314.1|341565_343611_-|ATP-dependent-DNA-helicase-RecG
MAAVHQLQGVGAAAAALLEKLNIFTTDDLLFHLPRDYEDRSTIIPMNQLNVGRSYLLEGIVKGVDFPPGKRKSMAILLDDDSAKVTLRFYHIYKGLTDRAKVGNRLRVFGEVRVGARGLEMYHPEIQLISEHTPLPKTQLTAIYPSTEGLTQSKLRDYVKQALKQHSDDLPELLPEKFTNGYALKQALEYIHEPPTSANMLQLGQGSHPAQQRLIFEELVAHQVSLLTRRAYIQQIEAPAFAPSQRLAKQLLAGLPFSMTGAQKRVSKEIIQDLKQNKPMLRLVQGDVGAGKTLVAAVAACHALEEGWQVALMAPTEILAEQHYLNFKRWFEPLGLTVSWLSGKQKGKARASAEQIIQDGSAQLVVGTHALFQDNVEFAKLGLVIIDEQHRFGVDQRLALRNKGLNHMTPHQLVMTATPIPRTLAMSAYGDLDTSIIDELPPGRTPIQTVTIPLDRREQVLQRIASNCAEGKQAYWVCTLVEQSETLDAQAAEATFAEIKERFPELNIGLVHGKMKADDKQAVMQQFKDNQLQLLIATTVIEVGVDVPNASIMVIENAERLGLSQLHQLRGRVGRGAKASFCALLYKHPLSQNGQERLRILRESNDGFVIAEKDLELRGPGELLGTKQTGDMGFRVAKLERDDHLLNQAHYVAQQMLKDYPEQAEALLKRWLPEAPRYAYV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044455_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044455_2

1138237-1144620

Orphan

Consensus_repeat	Method
CNNNGANTCNGACNNNGA	CRT

81 spacers

The CRISPR arrays of NZ_CP044455_2

>merge|NZ_CP044455|2|1138237-1144620|CRT
CTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGATAGCGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGACTCTGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGACTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGATAGCGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGACTCTGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGACTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGATAGCGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGACTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGATAGCGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGACTCTGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGACTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGACTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGACTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGATAGCGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGACTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGATAGCGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGACTCTGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGACTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATTCAGACAGCGATTCTGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCCGATAGCGATTCTGACTCCGATAGCGA

>NZ_CP044455|2|1|1138237-1144620|CRT
CTCTGACTCTGATAGCGA	CAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGA
CAGCGACTCTGATAGCGA	CAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGA
CAGCGACTCTGATTCCGA	CAGCGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGATAGCGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGACTCTGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGACTCCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGA
CAGCGATTCTGACTCTGA	TTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGACTCTGATAGCGATAGCGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGACTCTGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGATTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATAGCGA
CAGCGACTCTGACTCTGA	TAGCGACAGCGATTCCGACAGCGACTCTGACTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGACTCTGATAGCGATAGCGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGA
CAGCGATTCTGACTCTGA	TTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGA
CAGCGATTCTGACTCTGA	TTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATAGCGA
CAGCGACTCTGACTCTGA	TAGCGACAGCGATTCCGACAGCGACTCTGACTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGA
CAGCGATTCTGACTCTGA	TTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATTCCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATTCCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGACTCTGATAGCGATAGCGATTCCGACAGCGACTCTGACTCTGATAGCGA
CAGCGATTCTGACTCTGA	CTCTGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGA
CAGCGATTCTGACTCTGA	TTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATAGCGA
CAGCGACTCTGACTCTGA	TAGCGACAGCGATTCCGACAGCGACTCTGACTCCGACAGCGATTCTGACTCTGATAGCGA
CAGCGACTCTGACTCTGA	TTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGACTCTGATAGCGA
CAGCGACTCTGACTCTGA	TTCCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGA
CAGCGATTCTGACTCTGA	TTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGA
CAGCGACTCTGACTCTGA	TTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGATTCCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATTCCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGACTCTGACTCTGATTCCGA
CAGCGATTCCGACAGCGA	CTCTGACTCTGATTCCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGATTCTGACTCTGATTCCGA
CAGCGATTCTGACTCTGA	TAGCGACAGCGACTCTGATAGCGA
CAGCGACTCTGACTCTGA	TTCCGACAGCGACTCTGATTCCGA
CAGCGACTCTGATTCCGA	CAGCGACTCTGATAGCGA
CAGCGACTCTGACTCTGA	TTCCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGATAGCGA
CAGCGACTCTGACTCTGA	TAGCGACAGCGATTCCGACAGCGACTCTGACTCCGACAGCGATTCTGACTCTGATAGCGA
CAGCGACTCTGACTCTGA	TTCCGACAGCGACTCTGACTCTGATAGCGA
CAGCGATTCTGACTCTGA	TTCAGACAGCGACTCTGATAGCGA
CAGCGATTCTGACTCTGA	TTCCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGA
CAGCGATTCCGACAGCGA	CTCTGATTCCGACAGCGACTCTGA
CTCTGATTCCGACAGCGA	CTCTGATAGCGACAGCGACTCTGA
CTCTGATTCCGACAGCGA	TTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGA
CTCTGATTCCGACAGCGA	TTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGA
CTCTGATTCAGACAGCGA	CTCTGATAGCGACAGCGATTCTGACTCTGATAGCGACAGCGACTCTGA
CTCTGATTCCGACAGCGA	TTCCGACAGCGACTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGA
CTCTGATTCCGACAGCGA	TTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGACTCTGA
CTCTGATTCCGACAGCGA	CTCTGATTCCGACAGCGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGA
CTCTGATTCCGACAGCGA	CTCTGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCCGACAGCGA
CTCTGACTCCGACAGCGA	TTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGA
CTCTGACTCTGATAGCGA	CAGCGATTCTGACTCTGATAGCGACAGCGACTCTGATAGCGATAGCGATTCCGACAGCGA
CTCTGACTCTGATAGCGA	CAGCGACTCTGACTCTGATTCCGACAGCGA
CTCTGACTCTGATAGCGA	CAGCGATTCTGACTCTGATTCCGACAGCGA
TTCTGACTCTGATAGCGA	CAGCGATTCTGACTCTGATTCCGACAGCGACTCTGACTCTGATAGCGACAGCGA
TTCTGACTCTGATAGCGA	CAGCGACTCTGACTCTGATTCCGACAGCGA
CTCTGACTCTGATAGCGA	CAGCGACTCTGACTCTGATTCCGACAGCGA
TTCTGACTCTGATAGCGA	CAGCGATTCTGACTCTGATTCCGACAGCGA
TTCTGACTCTGATAGCGA	CAGCGACTCTGATAGCGACAGCGATTCCGACAGCGA
CTCTGATTCCGACAGCGA	CTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGATTCCGACAGCGA
CTCTGACTCCGACAGCGA	TTCTGACTCTGATAGCGACAGCGACTCTGA
CTCTGATTCCGACAGCGA	TTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATAGCGACAGCGACTCTGA
CTCTGATTCCGACAGCGA	CTCTGACTCTGATAGCGACAGCGATTCTGACTCTGATTCAGACAGCGACTCTGATAGCGACAGCGATTCTGA
CTCTGATTCCGACAGCGA	TTCTGACTCTGATAGCGACAGCGACTCTGATAGCGACAGCGATTCCGACAGCGA
CTCTGATTCCGACAGCGA	CTCTGATTCCGACAGCGACTCTGATTCCGACAGCGATTCTGA
CTCTGATAGCGACAGCGA	CTCTGATAGCGATAGCGATTCCGACAGCGACTCTGA
CTCTGATAGCGACAGCGA	TTCTGACTCTGACTCTGACAGCGACTCTGA
CTCTGATAGCGACAGCGA	CTCTGACTCTGATTCCGACAGCGATTCTGA
CTCTGATAGCGACAGCGA	TTCTGACTCTGATTCCGACAGCGATTCTGA
CTCTGATAGCGACAGCGA	CTCTGATAGCGACAGCGATTCCGACAGCGACTCTGATTCCGACAGCGA
CTCTGATAGCGACAGCGA	CTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGACTCCGACAGCGATTCTGA
CTCTGATAGCGACAGCGA	CTCTGACTCTGATTCCGACAGCGACTCTGA
CTCTGATAGCGACAGCGA	TTCTGACTCTGATTCAGACAGCGA
CTCTGATAGCGACAGCGA	TTCTGACTCTGATAGCGACAGCGACTCTGACTCTGATTCCGACAGCGACTCTGA
CTCTGATAGCGACAGCGA	TTCTGACTCTGATTCAGACAGCGA
CTCTGATAGCGACAGCGA	TTCTGACTCTGATTCCGACAGCGATTCTGA
CTCTGATAGCGACAGCGA	CTCTGATAGCGACAGCGATTCCGACAGCGA
CTCTGATTCCGACAGCGA	CTCTGACTCTGATTCCGACAGCGACTCTGATAGCGACAGCGACTCTGA
CTCTGATTCCGACAGCGA	TTCTGACTCTGATAGCGACAGCGATTCCGACAGCGACTCTGA
CTCTGATTCCGACAGCGA	TTCTGACTCTGATTCCGACAGCGATTCTGACTCTGATAGCGACAGCGATTCTGA
CTCTGATTCCGACAGCGA	TTCTGACTCTGATTCAGACAGCGATTCTGA
CTCTGATTCCGACAGCGA	CTCTGATTCCGACAGCGACTCTGA
CTCTGATTCCGACAGCGA	CTCTGATAGCGACAGCGACTCTGA
CTCTGATAGCGACAGCGA	TTCTGACTCCGATAGCGA
TTCTGACTCCGATAGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044455.1\|WP_005178913.1\|1126239_1126506_+\|PAAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|269829
NZ_CP044455.1\|WP_163141702.1\|1127436_1128132_-\|HTH-type-transcriptional-repressor-FabR	unknown	unknown	gnl\|CDD\|236881
NZ_CP044455.1\|WP_163145692.1\|1128270_1129341_+\|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|99812
NZ_CP044455.1\|WP_163145694.1\|1147971_1149624_+\|poly-alpha-glucosyltransferase	unknown	unknown	unknown
NZ_CP044455.1\|WP_163145690.1\|1122431_1123076_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP044455.1\|WP_163145698.1\|1157365_1157596_+\|transposase	unknown	unknown	unknown
NZ_CP044455.1\|WP_163145699.1\|1158306_1159353_+\|tRNA-dihydrouridine-synthase-DusB	unknown	unknown	gnl\|CDD\|129820
NZ_CP044455.1\|WP_005178879.1\|1157892_1158102_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_CP044455.1\|WP_104499072.1\|1151128_1152916_+\|CapA-family-protein	unknown	unknown	gnl\|CDD\|214858
NZ_CP044455.1\|WP_104487626.1\|1129356_1130451_+\|acyl-CoA-desaturase	unknown	unknown	gnl\|CDD\|239583
NZ_CP044455.1\|WP_163145689.1\|1121591_1122290_+\|acyl-carrier-protein	unknown	unknown	gnl\|CDD\|225967
NZ_CP044455.1\|WP_163141690.1\|1120730_1121525_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044455.1\|WP_104513564.1\|1123215_1126053_+\|RNA-polymerase-associated-protein-RapA	unknown	unknown	gnl\|CDD\|235319
NZ_CP044455.1\|WP_104487240.1\|1154356_1154665_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044455.1\|WP_005178885.1\|1155468_1156674_-\|DUF1615-domain-containing-protein	unknown	unknown	gnl\|CDD\|369501
NZ_CP044455.1\|WP_163145695.1\|1149633_1151136_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP044455.1\|WP_163145691.1\|1126615_1127416_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP044455.1\|WP_163145696.1\|1152917_1153595_-\|metalloprotease	unknown	unknown	gnl\|CDD\|239806
NZ_CP044455.1\|WP_163145697.1\|1154866_1155502_-\|HAD-IB-family-phosphatase	unknown	unknown	gnl\|CDD\|319796
NZ_CP044455.1\|WP_127801857.1\|1131062_1131908_+\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|236764

Protein	Function_ID	Function_description	E-value
NZ_CP044455.1\|WP_005178913.1\|1126239_1126506_+\|PAAR-domain-containing-protein	gnl\|CDD\|269829	cd14744, PAAR_CT_2, proline-alanine-alanine-arginine (PAAR) domain with uncharacterized C-terminal extension. This domain is found in the PAAR (proline-alanine-alanine-arginine) repeat family of mostly beta- and gamma-proteobacteria, and forms a sharp conical extension on the VgrG spike, a trimeric protein complex of the bacterial type VI secretion system (T6SS). Most members contain C-terminal domain extensions corresponding to several uncharacterized domains such as S-type pyocin, DUF2235, DUF2345 and cytotoxic proteins. However, these terminal domains are exposed to solution, and do not distort the binding site of VgrG. The pointed tip of the PAAR domain is stabilized by a zinc atom positioned close to the cone's vertex and is likely to be important for its integrity during penetration of the target cell envelope. VgrG proteins are orthologous to the central baseplate spikes of bacteriophages with contractile tails, and genes encoding proteins with PAAR motifs have been frequently found immediately downstream from vgrG-like genes.	1.88387e-22
NZ_CP044455.1\|WP_163141702.1\|1127436_1128132_-\|HTH-type-transcriptional-repressor-FabR	gnl\|CDD\|236881	PRK11202, PRK11202, HTH-type transcriptional repressor FabR.	1.33077e-56
NZ_CP044455.1\|WP_163145692.1\|1128270_1129341_+\|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein	gnl\|CDD\|99812	cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	1.11562e-82
NZ_CP044455.1\|WP_163145690.1\|1122431_1123076_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	2.04012e-72
NZ_CP044455.1\|WP_005178879.1\|1157892_1158102_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	1.28423e-28
NZ_CP044455.1\|WP_104499072.1\|1151128_1152916_+\|CapA-family-protein	gnl\|CDD\|214858	smart00854, PGA_cap, Bacterial capsule synthesis protein PGA_cap. This protein is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria. Poly-gamma-glutamate is a natural polymer that may be involved in virulence and may help bacteria survive in high salt concentrations. It is a surface-associated protein.	1.27624e-45
NZ_CP044455.1\|WP_104487626.1\|1129356_1130451_+\|acyl-CoA-desaturase	gnl\|CDD\|239583	cd03506, Delta6-FADS-like, The Delta6 Fatty Acid Desaturase (Delta6-FADS)-like CD includes the integral-membrane enzymes: delta-4, delta-5, delta-6, delta-8, delta-8-sphingolipid, and delta-11 desaturases found in vertebrates, higher plants, fungi, and bacteria. These desaturases are required for the synthesis of highly unsaturated fatty acids (HUFAs), which are mainly esterified into phospholipids and contribute to maintaining membrane fluidity. While HUFAs may be required for cold tolerance in bacteria, plants and fish, the primary role of HUFAs in mammals is cell signaling. These enzymes are described as front-end desaturases because they introduce a double bond between the pre-exiting double bond and the carboxyl (front) end of the fatty acid. Various substrates are involved, with both acyl-coenzyme A (CoA) and acyl-lipid desaturases present in this CD. Acyl-lipid desaturases are localized in the membranes of cyanobacterial thylakoid, plant endoplasmic reticulum (ER), and plastid; and acyl-CoA desaturases are present in ER membrane. ER-bound plant acyl-lipid desaturases and acyl-CoA desaturases require cytochrome b5 as an electron donor. Most of the eukaryotic desaturase domains have an adjacent N-terminal cytochrome b5-like domain. This domain family has extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain the residues: HXXXH, HXX(X)HH, and Q/HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within the homolog, stearoyl CoA desaturase.	3.92914e-55
NZ_CP044455.1\|WP_163145689.1\|1121591_1122290_+\|acyl-carrier-protein	gnl\|CDD\|225967	COG3433, COG3433, Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism].	1.19413e-07
NZ_CP044455.1\|WP_163145699.1\|1158306_1159353_+\|tRNA-dihydrouridine-synthase-DusB	gnl\|CDD\|129820	TIGR00737, Probable_tRNA-dihydrouridine_synthase, putative TIM-barrel protein, nifR3 family. This model represents one branch of COG0042 (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family). This branch includes NifR3 itself, from Rhodobacter capsulatus. It excludes a broadly distributed but more sparsely populated subfamily that contains sll0926 from Synechocystis PCC6803, HI0634 from Haemophilus influenzae, and BB0225 from Borrelia burgdorferi. It also excludes a shorter and more distant archaeal subfamily.The function of nifR3, a member of this family, is unknown, but it is found in an operon with nitrogen-sensing two component regulators in Rhodobacter capsulatus.Members of this family show a distant relationship to alpha/beta (TIM) barrel enzymes such as dihydroorotate dehydrogenase and glycolate oxidase. [Unknown function, General].	7.90915e-137
NZ_CP044455.1\|WP_104513564.1\|1123215_1126053_+\|RNA-polymerase-associated-protein-RapA	gnl\|CDD\|235319	PRK04914, PRK04914, RNA polymerase-associated protein RapA.	0
NZ_CP044455.1\|WP_005178885.1\|1155468_1156674_-\|DUF1615-domain-containing-protein	gnl\|CDD\|369501	pfam07759, DUF1615, Protein of unknown function (DUF1615). This is a family of proteins of unknown function expressed by various bacterial species. Some members of this family are thought to be lipoproteins. Another member of this family is thought to be involved in photosynthesis.	1.64172e-149
NZ_CP044455.1\|WP_163145695.1\|1149633_1151136_+\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	1.20003e-65
NZ_CP044455.1\|WP_163145691.1\|1126615_1127416_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	4.67797e-10
NZ_CP044455.1\|WP_163145696.1\|1152917_1153595_-\|metalloprotease	gnl\|CDD\|239806	cd04279, ZnMc_MMP_like_1, Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.	0.000881761
NZ_CP044455.1\|WP_163145697.1\|1154866_1155502_-\|HAD-IB-family-phosphatase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	5.03976e-34
NZ_CP044455.1\|WP_127801857.1\|1131062_1131908_+\|OmpA-family-protein	gnl\|CDD\|236764	PRK10808, PRK10808, outer membrane protein A; Reviewed.	2.60699e-26

>NZ_CP044455.1|WP_127801857.1|1131062_1131908_+|OmpA-family-protein
MLKLSLLAVVASLGVVACTSSPYTKPSDLRFQKKTQENNQPIVLKRDEKLCGGDTAEQQNCPIEFYIDSIKAGNFYINNSAQYALKPETYNFKVKNCTEESCQSCDVDLSVGKLTSNEFVLSVNTDGKPFISNNGQPLSCEVKHQVAAQEQIIRVDLAADTLFKFDGSSLNDLLPKGRQEVLEVASQIRNNFVSVSQIKLVGHTDRLGSDSYNNQLGQNRADTVRNLLIQNGVAGNVISTASAGKRQPVTNGCFDVKQREALHACLQPDRRVTVEVTGLSK
>NZ_CP044455.1|WP_104487626.1|1129356_1130451_+|acyl-CoA-desaturase
MNMPVKFEYFKNPKNRELTQLELDELARELDAIKQEVLDDLGEKDAKYIRRVYSTIRYASIAGRACLFAGWFPPAWILGTGLLGFAKIMENMELGHNVMHGQYDWMNDPKFNGQTYEWDIVGTSENWRQTHNYKHHTYTNIKGMDDDIGYGLVRLFPEQRWKPGHLLQPIYSIPFCLLFQWGVAIQNLELGKVWMGRKTKAELKEEWKPLQSKISKQLFKDYVFFPLIAGPAAIPVFTGNLVANGIRNIWTFSIIFCGHFTKDVEVFPKSVLKNESRGHWYMRQIRGSSNLTGSEAFHILTGHLSHQIEHHLYPDVPARRYRQMAPKVQAVCEKYGLHYNNASLFKQYGSVLKRIAKYAFPFKK
>NZ_CP044455.1|WP_163145692.1|1128270_1129341_+|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein
MHVIEKSKSPLKSLASAIVDPYSANFWLQKINPLWSVNQALGKIVQKQQTAQDTVSLMVQFNQKFQLGQAGQHHPVFVTIEGIRYERTYSLTQLDTQHVLLTVKKVDQGKVSSWLVNQANVGDILEFGQPYGDMLLPEATQPLILLAAGSGITPMYSLVDALAKSGQLKQTSVKLMYWVKTFADVAFKTQFEQWATQYPHFSFDVFYTQAGETPAQRLNESHLQTFEQIEQSAVYACGPSGFAARVEELFAHAQQLKTEAFSMSPMLNEEAGFVQVTLTQSNKTVTIPKGQSILTSLEQQNIQPKHGCRMGICNKCACNKVEGSTKNLVNGAQNTEPGNLLKLCVNSAQTDLVIDL
>NZ_CP044455.1|WP_163141702.1|1127436_1128132_-|HTH-type-transcriptional-repressor-FabR
MTQPAMKISNDVLAQDVPNIREPMTVRTVGRKATITKEELFQAALNLIGPQKSIASLSLREVAREAGIAPNSFYRHFKDIDELAIALIDRAGHVLRQILNQARLKASKQNSIIRTSVEVFIEQLDADEGNLSLLLREGYTGSTSYKQAVERQLNYFQQELKDDLIRLERLNNSKLTHPEIVSSAITQLVFNMGAKVIDMPANERKIIAEQTMIMIRMLLEGARHLDEAQIR
>NZ_CP044455.1|WP_163145691.1|1126615_1127416_+|alpha/beta-fold-hydrolase
MTKTVVYFAHANGIASPCYQTFFDYFDADIELKYIPVIGLNPDYPVEPKWEKLVAQVIADIELQTPKQAVVGLRHSFGALVLLMASYQRPDLFSQLILMDPPFVIGKTAPIFELLQKLGSKQIDRLTPAGLSLKRKDAWSSREQAYQQLRGNALFKQFDERCFQDFIRHGLREDEAGISLQIPKQVEADIFRTVPSWWWRWPRKAPNLPVHLITAEQSAFYKQGFPQGLKKIYGIEFSVVAGGHMFPLESPEQSARDVQQRIRSTL
>NZ_CP044455.1|WP_005178913.1|1126239_1126506_+|PAAR-domain-containing-protein
MGKALVTLGSKTSHGGVVAECESSFVINGIAVHLNGMKHYCPKCKTTVAAIAADPTTQVKGRGVVIVGDKTTCGATFLPSQNLVVSAK
>NZ_CP044455.1|WP_104513564.1|1123215_1126053_+|RNA-polymerase-associated-protein-RapA
MEKLQQFAIGQRWLSDTETELGLGVLIDVDERSISILFPKSDETRVYARNNAPLSRIVFNAGDEVQDQEGLKWTVQSLEDRGGVVRYNVVRQLEDGSEEQKSLNETRIGAQIQLSKPLDRLLASQIDYKEWYDLRIEALLMQANMHSSPLRGLIGSRVGLIPHQLYIAHEVGKRFAPRVLLADEVGLGKTIEAGLIIHQQLKTGRSERILILVPDSLQYQWMIEMRRRFNLQFSLFDLTRTASIKEHDPDLNPFLTEQCIIASIDLMIDHEDLREQALEAGFDLLVVDEAHHLMWSEEEGGNDRYDLVEEFAEQTAGVLLLTATPEQLGVESHFARLRLLDPQRFSSLDRFLDEEAQYQQTAKIAEVLMSDMPLEEGHLAALEGLLGHRIEDHPEQRFRAIHELLDRHGTGRILFRNTREAIQGFPGRDCQPAPLPAPEHWAKEGKLREQMWPEEGQLDGAWMETDPRVMWLMEKLRSDLKHKKVLLIARSGPVVEALENALRLHAGIRTAMFHEGMSLLERDQAAAYFAEDSYGAQILLCSEIGSEGRNFQFASDLILFDLPANPDVLEQRIGRLDRIGQENRIQIHVPYLLGTAQERMFRWYNEALNIFSNISPTAQTLQENFIVELKDCLLADQGQQFEELLEAVSVQREALEAELQEGRDRLLEYNSCRPVVAQEIVQALEDYDDNTTLPMFMKRFMASTNIDFDEQSNGTVIIKPTDQMQVQGLTLDEEGMTATFYRDQAQIREDAQYLTLEHPFTESVMEMINTQSFGSTNVAVLKSAALPQGSVLLEVWFKVDVIAPKALNLPSSLPQQLIRVLLSEKGQDLSQKIAPEILKPYLHHLDGNSCRQVVKARREVIEQRYAQALDIAKTALPGLKEQAKEMYGAKWQYEIDRLTYLKQFNPSIREDEISRLQKLQKEGLSLLDGIAVTPEAIQVMVVVKP
>NZ_CP044455.1|WP_163145690.1|1122431_1123076_+|RluA-family-pseudouridine-synthase
MSNFLTEHLIYRDEDFMLIHKPAGLLTVPGKTADLQDCLISRLVAIEPKTLLIHRLDRDTSGILVFGLSRLGQNKISRQFQERQTDKHYQAVVAGHLYGEGTIDVPVVYDPTRPPLHMADPSHSKPALTHWQALEQFEINGQAVTRVKLIPITGRSHQLRVHMQYLGHPIIGDTLYATPEQQQLSPRLCLHAAYLSFQHPQTGETLEFNCPVPF
>NZ_CP044455.1|WP_163145689.1|1121591_1122290_+|acyl-carrier-protein
MLYPVPKKIQLAPSQAKWQLASNESVLVLVGLQNLRMQQGIQESGLMANLIQLTNKAKALDIPIVDLYGDDLMQGMQQLGEYASTHPQLIFAGQVTPMLKQILPHLMSVTDQIGMVDDAILLANQDQHIQWIENISAQGIHHLNTYSLTRLWDLSAPSEYVLSTKGIMLAVAEQLDMDALEIDPYVDLKNYGLDSVSMVSLVGLWRANGANIRYEDLQSKPTLHGLLQILTD
>NZ_CP044455.1|WP_163141690.1|1120730_1121525_+|hypothetical-protein
MIKKIIFILLNSIFISACSDSVEVDHSYDDVQYYEDNSQTGDLIMWGISPELIIKTYVGAKQNIAENTVLSSPFLGQFPINFEPTTHISNSLDNIENVADFENPMQFNLLLNQAKDIPINNFYDKNHKNQVKVHVQNFSKADPLYFKYKQTPREWINYLISHQYVKYEDSFKKFDLDCYSLNFDSSIAYHCIGRASDQYQTEFLMKITKNIENQQIITTTVETPLYPNVRVEWRMTRDSLNDWKVVDRNIWHLLSIWNVSQYRK
>NZ_CP044455.1|WP_163145694.1|1147971_1149624_+|poly-alpha-glucosyltransferase
MAISKYSDLQEFKLKLTDWLFSLRENQQDFYSVFFSYGDKNIRCRVWNTADKNYDKVVKRTLNFIDKLYEKNNRLPDFLKFDFAKNIEERKWTDLVKEVSEQKHNNHYRKGIAFDENLSICFLEQEIYAKAIIRGVVYNEPNFFDEKNLNDAIKKKYTNVKANYSLNKIEKVWVFDTQAVFFENNQLIDLISTGPENGIRVLKGNKKEHIKELVLNNAKFLHNEILESGRLVYGYFPAYNREIKSYNTVRHCTAIYALLETLEVNYNEAYLPKIRNAMQYAIDHLYKEVDGKAFMIDGNEPDLEIKLGSNAAAIFMFAKYQEIIGDSKYQKYAEMLAEGIRFMVDGKGETTHVLSFPSLAVKEKFRIVYYDGEAALGLLRLYQINQNPILLETVKLMFEHFITKKYDKYHDHWLSYCTNELTKICPEKKYFEFGLNNYLKHMDFIKNRKTAYATFLEMMMSAYKMVVRLKEQGFTDLVNMAKFDKLKDLIELRVEFQRATGYFYPEIAMYMAKPEKILNAFYVRHDRFRTRIDDQEHNLSGYVAYLNYFI
>NZ_CP044455.1|WP_163145695.1|1149633_1151136_+|glycosyltransferase
MFFFLSAGIGEKLTGIEHAILKRKHVFDSCGLAHKIVTLNYNANYLKNLNIHHIRADSFLNLYDDYQYLIFAALRSNTLEDYLSHIAGEVTLEKNNANTDVKVYINGNYLFYIHFFSNGNISYINYFDKARKKFKRALYTESGYLSKEIYLEKNQVKSCLYYNQQGIVVLEEHYTQDNQLSYLSLKESNGSSCFFQDRDQWIKHWFQKIITSYKQPVFYVDKNRLYNHILVELKSPAFKLISIFHSVHVSNPQKMEDGRINSNYKISLAETNKFDGYIVSTEQQRQDLWARFGSELKIWVIPPTFAHIESELTVNAVASPFNVISVGRYYVEKRLHHIIQAVEILKEKYPEIQLDLYGFGDSRDNFIYEKEIRKYVDDHDLETNVHFKGYVHNISDKIRNAHVSVVTSTIEGFCIGILDSLSVGTPVVAYDIKYGPNALIEQNLSGVLVENENIQALAIAIEQCYLNPHMRTHAIKSAKKYDLNSYKKKWLDHLLELSYV
>NZ_CP044455.1|WP_104499072.1|1151128_1152916_+|CapA-family-protein
MYNYLVQKNGALLPHSKPQYVDFSDQNEGLGPLLVLYVVYKLLDERKLSLDDSVEITEMALQERGRGVVGYALHDKVNLLQVLMHYKVTAGVDSLFLLAQHVYNKTQKRMSHYFEELIKKHNLSPNSAKNLSGKKNSKFIQQYTLNDVLKIAELMTQINPFYLQILTLSKIAYKARNFLSPTFLLDQGKVNYFFSFLNISIAWQKHTSSDFTIVITQGIESSFQQDSVIERHLLGHEGLDRLISDLNVVTTLKQDRAIVNIIGDTYLGEYYTERRRKRKVFDPLLNHGYDYSFEKLNFFLNAADINLANHEACFVNNQIQSPLVGLKKFILGAQDVPTVNALKKANIHYLCLANNHTADFGAVGITHTLKTLQNAQIHYVGVGENEFEACTPMRIQINGRIISFYSGYWHRATNEKIFKFYATPSSSGVATLESVLYEAVALEKQKYPSHFIVVLAHWGVDFLPTQAYQKILANRLVQQGADLILGHGAHTLQSMETIQDSTVIYSLGNGIFNSDGEYDGYPDALPFGMIAQLIFEKDSLNLRLLPIQSNNRETMWQPDFVQLDDFNQVADYYGDIDFNAINRAQWPYYFEKKIL
>NZ_CP044455.1|WP_163145696.1|1152917_1153595_-|metalloprotease
MNIKKLATIPLLLIGEYAMALPIVQVNFIFATPHVEAQKFDNLSQIKKEVDILNRYFVTEKNQPIFKFELNKYIPYQKFKQLNCKLSHLLESPKPMERPALIKIFRQCFPSKSKEAEVYIFIFDSYSSKSGFKAADSWGFHNNGRPIILLDWERLNYNIQAALPHEMGHAFGLRHLCVKGAKFKDTTNLMASKGGCDGSGGQRNIGFNDQQIQIIKEHYQKLKSR
>NZ_CP044455.1|WP_104487240.1|1154356_1154665_-|hypothetical-protein
MTYKQAQDHYGIQGCSTILVWLRKHGRLDWSKGSPFSNGVQAMSDPLPLTPEQRIKKLEKELLDTQRKAEFFEAIIDVLEKEYGVKLVKKPKGILSARSKKK
>NZ_CP044455.1|WP_163145697.1|1154866_1155502_-|HAD-IB-family-phosphatase
MHAKSQKYKNLALFDFDGTLCSKDSFTGFIFYVLSKRHIIKQGLKILPWIQAYYLKAYPAHAMRPKLFNAMFKDASTAEILVLAQHYAADLMHDLNPQLLQQLKQHQLNGDDVVIVSASVDIYLPYICQQLNVDLICTKTEIKNLQFTGRYSTPDCSREQKKIRILEQYDLNNYTTIYAYGNSDEDDAMLSLATYSYMVGTDHSLPGSTAF
>NZ_CP044455.1|WP_005178885.1|1155468_1156674_-|DUF1615-domain-containing-protein
MKHTFLSSVIKPLSLIALSLSLAACGDSAWWNKGDEPSLDADQIKRLIPSRVKDRDSWAKDIYDISEQLGIPQTKENMCTIVAVVDQESNFVADPQVYGLGEKAVKEVQERLDEKFKDKLGEAIGGTIAGYFQDVLKNHPSPEDNYLSQMRRVKTERELDELYREIFDYMAKHYHVSALTGAAKLFGQNIGEKLNPITTLGSMQVHISYAKEHKRQGGNIAELRTDLYSQYGGLYYGIHRLMMYPADYDKPLYRFADYNSGMYSSRNAAFQSMLNDLTEAELSLDGDLLLYSKDGGVRSAKSQSERELISVFAKHNIVLTPRQIRSDLKKEKEQDFEDTASYRALLKLYQEQTGKEPFYAMMPEVVISGPKLSRDYNTNWFATRVNGRYTTCMQKAKNIKI
>NZ_CP044455.1|WP_163145698.1|1157365_1157596_+|transposase
MLNNVENWQLATAVNGQEIFVKVMPLKKKQRSSQGFIWVEVGKMIELQSGQQVEFNLDGKSFYIALNQLYKLDFLR
>NZ_CP044455.1|WP_005178879.1|1157892_1158102_+|cold-shock-protein
MSNTVTGTVKWFNETKGFGFIQADSGQDVFAHYSEITNQGFKTLHEGQRVEFTIVAGKKGDQASGITAI
>NZ_CP044455.1|WP_163145699.1|1158306_1159353_+|tRNA-dihydrouridine-synthase-DusB
MSSHPVIQELFDRPIERKLWVAPMAGVTDRPFRTLCKYFGAGHAVSEMMTSDKTLRMSKKSLYRANFDGEIAPISAQIAGSDPADLAEAARYQVANGAQIVDINMGCPAKKVCNKLAGSALLQDEDLVARILDAVVEAVDVPVTLKTRLGFLNGQENILRVAKRAEQAGIAALALHGRTREDMYLNTARYELIKQVKAELNIPLIANGDIDSPEKAKMVLDYTGADAIMIGRAAQGRPWIFREIVHYLTTGEHLAAPSIEEVKQVLLGHLTELYSFYGEYSGCRISRKHIAWYTKGLRSSNEFRQNMYRVESTAEQYQVVEYYFNQLLEHGNIMSDVEVEQVNLLETK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044455_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044455_3

1756167-1756310

Orphan

Consensus_repeat	Method
TAAGCTGCCTACATGGCAGTGAAC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP044455_3

>merge|NZ_CP044455|3|1756167-1756310|CRISPRCasFinder
TAAGCTGCCTACATGGCAGTGAACATGGTGATGACGGGGATTTGGCCGTACTCAAATTTCTAAGCTGCCTATATGGCAGTGAACTTTGCGATTAGTTCATTCATCCCTCAACTCCTTTTCTAAGCTGCCTGTATGGCAGTGAAC

>NZ_CP044455|3|2|1756167-1756310|CRISPRCasFinder
TAAGCTGCCTACATGGCAGTGAAC	ATGGTGATGACGGGGATTTGGCCGTACTCAAATTTC
TAAGCTGCCTATATGGCAGTGAAC	TTTGCGATTAGTTCATTCATCCCTCAACTCCTTTTC
TAAGCTGCCTGTATGGCAGTGAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044455.1\|WP_104490639.1\|1750408_1751353_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-A	unknown	unknown	gnl\|CDD\|184320
NZ_CP044455.1\|WP_163145891.1\|1766240_1767035_+\|energy-transducer-TonB	unknown	unknown	gnl\|CDD\|367555
NZ_CP044455.1\|WP_163145886.1\|1751614_1753732_+\|phenylacetic-acid-degradation-bifunctional-protein-PaaZ	unknown	unknown	gnl\|CDD\|236931
NZ_CP044455.1\|WP_163145883.1\|1746892_1747663_-\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|182026
NZ_CP044455.1\|WP_005176703.1\|1756829_1757981_-\|IS4-family-transposase	unknown	unknown	gnl\|CDD\|372999
NZ_CP044455.1\|WP_005177343.1\|1755619_1756114_+\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|223854
NZ_CP044455.1\|WP_075166740.1\|1765797_1766244_+\|protein-TolR	unknown	unknown	gnl\|CDD\|274306
NZ_CP044455.1\|WP_016658268.1\|1748785_1749286_-\|phenylacetate-CoA-oxygenase-subunit-PaaJ	unknown	unknown	gnl\|CDD\|131214
NZ_CP044455.1\|WP_104472268.1\|1765104_1765791_+\|protein-TolQ	unknown	unknown	gnl\|CDD\|131843
NZ_CP044455.1\|WP_163145892.1\|1767606_1769760_+\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|227114
NZ_CP044455.1\|WP_163145888.1\|1759306_1760230_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP044455.1\|WP_005177370.1\|1746101_1746893_-\|2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA-isomerase	unknown	unknown	gnl\|CDD\|236163
NZ_CP044455.1\|WP_163145890.1\|1763065_1765033_+\|phytase	unknown	unknown	gnl\|CDD\|226698
NZ_CP044455.1\|WP_163145889.1\|1760547_1763007_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273804
NZ_CP044455.1\|WP_163145885.1\|1749314_1750070_-\|phenylacetate-CoA-oxygenase-subunit-PaaC	unknown	unknown	gnl\|CDD\|368300
NZ_CP044455.1\|WP_163145884.1\|1747687_1748746_-\|phenylacetate-CoA-oxygenase/reductase-subunit-PaaK	unknown	unknown	gnl\|CDD\|131215
NZ_CP044455.1\|WP_163145887.1\|1753932_1755357_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340886
NZ_CP044455.1\|WP_005177339.1\|1758320_1759310_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP044455.1\|WP_005177351.1\|1750081_1750372_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-B	unknown	unknown	gnl\|CDD\|237504
NZ_CP044455.1\|WP_163146318.1\|1756427_1756826_-\|transposase	unknown	unknown	gnl\|CDD\|225511

Protein	Function_ID	Function_description	E-value
NZ_CP044455.1\|WP_104490639.1\|1750408_1751353_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-A	gnl\|CDD\|184320	PRK13778, paaA, phenylacetate-CoA oxygenase subunit PaaA; Provisional.	0
NZ_CP044455.1\|WP_163145891.1\|1766240_1767035_+\|energy-transducer-TonB	gnl\|CDD\|367555	pfam03544, TonB_C, Gram-negative bacterial TonB protein C-terminal. The TonB_C domain is the well-characterized C-terminal region of the TonB receptor molecule. This protein is bound to an inner membrane-bound protein ExbB via a globular domain and has a flexible middle region that is likely to help in positioning the C-terminal domain into the iron-transporter barrel in the outer membrane. TonB_C interacts with the N-terminal TonB box of the outer membrane transporter that binds the Fe3+-siderophore complex. The barrel of the transporter, consisting of 22 beta-sheets and an inside plug, binds the iron complex in the barrel entrance.	6.21861e-13
NZ_CP044455.1\|WP_163145886.1\|1751614_1753732_+\|phenylacetic-acid-degradation-bifunctional-protein-PaaZ	gnl\|CDD\|236931	PRK11563, PRK11563, bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional.	0
NZ_CP044455.1\|WP_163145883.1\|1746892_1747663_-\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|182026	PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; Provisional.	6.36704e-109
NZ_CP044455.1\|WP_005176703.1\|1756829_1757981_-\|IS4-family-transposase	gnl\|CDD\|372999	pfam14294, DUF4372, Domain of unknown function (DUF4372). This domain family is found in bacteria, and is approximately 80 amino acids in length. The family is found in association with pfam01609. There is a single completely conserved residue G that may be functionally important.	2.81347e-20
NZ_CP044455.1\|WP_005177343.1\|1755619_1756114_+\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|223854	COG0783, Dps, DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism].	4.20272e-64
NZ_CP044455.1\|WP_075166740.1\|1765797_1766244_+\|protein-TolR	gnl\|CDD\|274306	TIGR02801, Protein_TolR, TolR protein. The model describes the inner membrane protein TolR, part of the TolR/TolQ complex that transduces energy from the proton-motive force, through TolA, to an outer membrane complex made up of TolB and Pal (peptidoglycan-associated lipoprotein). The complex is required to maintain outer membrane integrity, and defects may cause a defect in the import of some organic compounds in addition to the resulting morphologic. While several gene pairs homologous to talR and tolQ may be found in a single genome, but the scope of this model is set to favor finding only bone fide TolR, supported by operon structure as well as by score. [Transport and binding proteins, Other, Cellular processes, Pathogenesis].	1.68688e-46
NZ_CP044455.1\|WP_016658268.1\|1748785_1749286_-\|phenylacetate-CoA-oxygenase-subunit-PaaJ	gnl\|CDD\|131214	TIGR02159, Putative_12-phenylacetyl-CoA_epoxidase_subunit_D, phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other].	2.22331e-59
NZ_CP044455.1\|WP_104472268.1\|1765104_1765791_+\|protein-TolQ	gnl\|CDD\|131843	TIGR02796, Protein_TolQ, TolQ protein. TolQ is one of the essential components of the Tol-Pal system. Together with TolR, it harnesses protonmotive force to energize TolA, which spans the periplasm to reach the complex of TolB and Pal at the outer member. The tol-pal system proves to be important for maintaining outer membrane integrity. Gene pairs similar to the TolQ and TolR gene pair often number several per genome, but this model describes specificially TolQ per se, as found in tol-pal operons. A close homolog, excluded from this model, is ExbB of the ExbB/ExbD/TonB protein complex, which powers transport of siderophores and vitamin B12 across the bacterial outer membrane. The Tol-Pal system is exploited by colicin and filamentous phage DNA to enter the cell. It is also implicated in pathogenesis in several bacterial species [Transport and binding proteins, Other, Cellular processes, Pathogenesis].	8.77921e-78
NZ_CP044455.1\|WP_163145892.1\|1767606_1769760_+\|TonB-dependent-siderophore-receptor	gnl\|CDD\|227114	COG4773, FhuE, Outer membrane receptor for ferric coprogen and ferric-rhodotorulic acid [Inorganic ion transport and metabolism].	1.80221e-172
NZ_CP044455.1\|WP_163145888.1\|1759306_1760230_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.62874e-21
NZ_CP044455.1\|WP_005177370.1\|1746101_1746893_-\|2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA-isomerase	gnl\|CDD\|236163	PRK08140, PRK08140, enoyl-CoA hydratase; Provisional.	2.62799e-159
NZ_CP044455.1\|WP_163145890.1\|1763065_1765033_+\|phytase	gnl\|CDD\|226698	COG4247, Phy, 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism].	3.54808e-79
NZ_CP044455.1\|WP_163145889.1\|1760547_1763007_+\|TonB-dependent-receptor	gnl\|CDD\|273804	TIGR01782, TonB-dependent_receptor, TonB-dependent receptor. This model represents a family of TonB-dependent outer-membrane receptors which are found mainly in Xanthomonas and Caulobacter. These appear to represent the expansion of a paralogous family in that the 22 X. axonopodis (21 in X. campestris) and 18 C. crescentus sequences are more closely related to each other than any of the many TonB-dependent receptors found in other species. In fact, the Crescentus and Xanthomonas sequences are inseparable on a phylogenetic tree using a PAM-weighted neighbor-joining method, indicating that one of the two genuses may have acquired this set of receptors from the other. The mechanism by which this family is shared between Xanthomonas, a gamma proteobacterial plant pathogen and Caulobacter, an alpha proteobacterial aquatic organism is unclear. [Transport and binding proteins, Porins].	0
NZ_CP044455.1\|WP_163145885.1\|1749314_1750070_-\|phenylacetate-CoA-oxygenase-subunit-PaaC	gnl\|CDD\|368300	pfam05138, PaaA_PaaC, Phenylacetic acid catabolic protein. This family includes proteins such as PaaA and PaaC that are part of a catabolic pathway of phenylacetic acid. These proteins may form part of a dioxygenase complex.	4.3893e-109
NZ_CP044455.1\|WP_163145884.1\|1747687_1748746_-\|phenylacetate-CoA-oxygenase/reductase-subunit-PaaK	gnl\|CDD\|131215	TIGR02160, 12-phenylacetyl-CoA_epoxidase_subunit_E, phenylacetate-CoA oxygenase/reductase, PaaK subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other].	1.18651e-134
NZ_CP044455.1\|WP_163145887.1\|1753932_1755357_+\|MFS-transporter	gnl\|CDD\|340886	cd17328, MFS_spinster_like, Protein spinster and spinster homologs of the Major Facilitator Superfamily of transporters. The protein spinster family includes Drosophila protein spinster, its vertebrate homologs, and similar proteins. Humans contain three homologs called protein spinster homologs 1 (SPNS1), 2 (SPNS2), and 3 (SPNS3). Protein spinster and its homologs may be sphingolipid transporters that play central roles in endosomes and/or lysosomes storage. SPNS2 is also called sphingosine 1-phosphate (S1P) transporter and is required for migration of myocardial precursors. S1P is a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. The spinster-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.92405e-67
NZ_CP044455.1\|WP_005177339.1\|1758320_1759310_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	1.02712e-05
NZ_CP044455.1\|WP_005177351.1\|1750081_1750372_-\|1,2-phenylacetyl-CoA-epoxidase-subunit-B	gnl\|CDD\|237504	PRK13781, paaB, phenylacetate-CoA oxygenase subunit PaaB; Provisional.	5.76461e-63
NZ_CP044455.1\|WP_163146318.1\|1756427_1756826_-\|transposase	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.12042e-08

>NZ_CP044455.1|WP_005177343.1|1755619_1756114_+|DNA-starvation/stationary-phase-protection-protein
MAKMKKASMHIDIGISEDNRAKIVEGLSRLLADSYTLYLMTHNFHWNVTGPQFNSLHTMFMTQYTEQWNALDVIAERIRALGFPAPGTYKEFVKLASIEEVEGVPKANEMVELLVRAHETVARTARSIFDVVEEANDQPTADVLTQRLEVHEKTAWMLRSLLEE
>NZ_CP044455.1|WP_163145887.1|1753932_1755357_+|MFS-transporter
MNDKTLEIDAVERNIQPESKQFEAAHPIDLPATPSSQESSSTYQWYVVIICMVAYILSFVDRQILSLMIEPIKADLMLSDTQFSLLQGLAFSLFYAFMGVPIAALADKKSRIKIISIGIAFWSLATAACGLSKNFIQMFLARLSVGAGEAALSPAFYSIVADLFPKEKLGRALGVYAIGAFIGSGLAFLIGGYVIGLLKEADFVVLPIIGELKTWQLTFFIVGLPGVLLALVMILTVREPSRKGVKVGQDGEVVKASFKNSVAFIKLHKKTFFCHFIGFSFYTMMLYSLLGWAPAYYMRHFGLDASQTGYVLGCIILVANTAGALFCGWLIDFFSKRGYSDAAIRAGALGCAALIIPSVLFTQVDNLYLSFALIFVAMFFSTFPIPASAAATQMLTPNQLRAQVSAKFLLISNLIALGVGTTAVALITDNYFENTLMVGNSISIVNAVAGVIGVFLLYKGCRYYRDSIQHEKLN
>NZ_CP044455.1|WP_163145886.1|1751614_1753732_+|phenylacetic-acid-degradation-bifunctional-protein-PaaZ
MLELDTQTAQTESQATDYSSVRPALKTLSSLVYGQEFVASQDFRPVQHAITGETIYQVSSFGLDTRAVVDYAKQHGAAIASWTFHQRANALKQVAQYLLERKEDFYELAKATGCTRKDAWIDVEGGIGTLFAYSSLVRRELSDETAWVEDSWIPLSKHGAFGAKHVLSPKAGVAVHINAFNFPIWGMLEKIAPTLLAGVPCIVKPATEGAELTHAVVKAIHASGYLPEGALQLICGQTYDLFEQLNPQDTVTFTGSAATGQKLRAHPHLNQYSIPFSMEADSVNSAILTEQASDTAIDLFVREVFREMTSKAGQKCTAIRRAFVPRELLATVQERLIAKLQKVVVGNPELDQVTMGALAGLKQKQDVAAKVEQLSQEAQIVFGSHLRQDFSIQADQPELGAFYPPTVLVCEQPEQASSLHQIEAFGPVVTLMAYDHLAQLAGLVARGEGSLVASVVRDCEQNIEQLIAKIAPWHGRVHVLDEESAKESTGHGSPLPHLVHGGPGRAGGGEELGGLRAVKHYMQRTAIQGSPNAMTQIGHSWTAGAQVFEDRVHPFKKSFDELRVGERLLTARRTVTEADLVNFACLSGDYFYAHMDKIAAAESLFEERVAHGYFVVSAAAGLFVDAAPGPVIANYGMDNLRFVEPVKIGDTIQVELTCKQKTPKQQRDPSQKPHGVVVWDIKVKNQRNELVATYDILTLVERGEA
>NZ_CP044455.1|WP_104490639.1|1750408_1751353_-|1,2-phenylacetyl-CoA-epoxidase-subunit-A
MTNQLHSFEQAIEKDISIEPKNWMPEAYRKTLIRQIGQHAHSEVVGMLPEGNWITRAPSLKRKAVLLAKVQDEAGHALYLYSAAETLGADRDDMMDKLIAGRMKYSSIFNYPTLSWADVAAIGWLVDGAAIVNQVALCRTSYGPYARAMVRICKEESFHQRQGFEAMMQLANGTPEQKQMAQDAVNRFWWPALMMFGPSDDNSPNSAQSMAWKIKRFSNDELRQKFVDNTVPQVLQLGLSVPDPDLRFNQDTGHYEFGEINWTEFFDVIAGKGPCNHERIEARRKAWEGGKWVRDTAAVYAQKQQTQQQQQKVA
>NZ_CP044455.1|WP_005177351.1|1750081_1750372_-|1,2-phenylacetyl-CoA-epoxidase-subunit-B
MDNKNHWSLYEVFVRSKQGLSHRHVGSLRASDDEVALQNARDVYTRRNEGVSIWVVKSELITSSQPDEKPEFFDPSLDKVYRHPTFYNIPDGIEHM
>NZ_CP044455.1|WP_163145885.1|1749314_1750070_-|phenylacetate-CoA-oxygenase-subunit-PaaC
MNQTVLAQFLLHVGDSQLILSHRLAEWCGHAPELELDIALANIGLDLLGQARTALSLAGEIEGLGRDEDKLAYFRTEREYRNLLLCEQPNGDFAQTMVRQWLMDLYHLELFTALSQSQQADVAAFAVKSLKEVKYHLRFSTTWMERLSLGTAEAHEKTQQGLNQLWRFTAELFEQTADEQQLVAQGVLPDFAPLKAAWTAQVQTELQRFGLSLPDTGEYRSGAKQGLHTEHLGFILAELQYMQRSYPNMAW
>NZ_CP044455.1|WP_016658268.1|1748785_1749286_-|phenylacetate-CoA-oxygenase-subunit-PaaJ
MNLIRHCLDECWDALAQVSDPEIPVLSVLDLGMIRGVELNAQDEIVVRLTPTYSGCPATDLLKDEITAAFQSKGLTPVQVVVDLSEAWTTDWMSESGKQKLQQYGIAPPQGQSHQCGTHVALSDGIRCPHCHSQQTKLLSEFSSTACKALYKCQDCLEPFDYFKCI
>NZ_CP044455.1|WP_163145884.1|1747687_1748746_-|phenylacetate-CoA-oxygenase/reductase-subunit-PaaK
MSQFIPLTIKSIQPQTEQAICIAFDLAPEQADLFQYQPGQHLTIRHLTEQGEIRRCYSICSDRAEDMSIAIKKIDQGQFSTWANEHLKAGDVLEVMPPQGVFFQKAAKTGGQNYLGFAAGSGITPILSIVKSVLNHQPGAHFTLVYGNRSWKQTMFSEQIMDLKDRYKERLQLVNVFSRELNDSQLLNGRIDAEKLQQLFQAGLIHSQFDHCFACGPEEMMNAVETVLPELGIERSKIYTERFNTGTAPKASAAQIESRSEEKVNIILDGRELIVDVSKQDDSILDAALRAGADLPYACKGGVCATCKCKVLEGEVEMAINYSLEEDEVAKGYVLSCQARPTSANVRLSFDE
>NZ_CP044455.1|WP_163145883.1|1746892_1747663_-|enoyl-CoA-hydratase/isomerase-family-protein
MDYLKSSLAAPGVVLIELNRPEKRNALNNATLKELAGHLQQLDADSSVKAVVITGNPQCFAAGADLNELAQLDVVSIQQDQRPLLWKGIDEFSKPLIMAVNGYALGAGFELALHGDMIVTGENAQFALPEIGLGMLPGAGGTQRLARLVGQQLAMRWAMTGEMVSATTALQHGISSQVCPSGLTVQYALELATKIAAQAPLAIRAIKQSLKSIHEVTLSQGLKLERQHFVWLAATQDRQEGIQAFLEKRKPEFRGV
>NZ_CP044455.1|WP_005177370.1|1746101_1746893_-|2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA-isomerase
MDYQTIIVEEKNAVGYLTFNRPKQLNSFNETMHQEVSKVMKAWAKDSKIRAVVISAEGRGFCAGQDLNDRVVDPNADAPDLGLSIEKYYNPLIKLITDMPKPVLCAVNGVAAGAGANIALACDIVLAAKSASFIQAFCRLGLVPDSGGTWFLPRLVGRAQAMGLAMLGDKVSAEQALQLGMIWQVVEDDQLKAEAGKMAEHLAKQPTYGLSLIKKAIHAAADNNLDEQLILERDLQRLAGRSSDYKEGVQAFMQKRTPQYTGC
>NZ_CP044455.1|WP_163146318.1|1756427_1756826_-|transposase
MVGQQCRRTFTAEFKHQLIQQYQQPDTSVAKVTMQHQINANLLHKWIRQSRSMVSSLTTPSCPQTDFLPVILHPTPVKQEASPPPVPEKKATAHIRIPLHDEQGSVRDQMIEIEWPVESATELLLLLQGLIK
>NZ_CP044455.1|WP_005176703.1|1756829_1757981_-|IS4-family-transposase
MSHQNTVFHELIKPVVRQDFEQLAKVHHVGQKFRAASRWDQFIAILMSQFSCRQSLRDIQSNLECQQEKLSHLGAKSIPRSTLARINEQQPAALYQQLFYKLLKYYEHSKVAHKFRFKNPLYSLDASHIDLSLSLCEWAKVHDSKASMKLSIGLNHSNDIPEFVAVENGKENDMVQGRKFQFPAGSIVVFDKGYVDYQWYANLTAQNIGFVTRFRPKSVYQVIQQHPVLESKGILKDETIQLNSAHALKRKAPVLRRIEYRDQQSGKHFSFLSNNFHLAASTIAAIYKDRWKVELFFKAIKQNLKLKAFLGRSRNAIQTQIWIAMIAYLLVSFARHLGKTGWTVQRLLRIIQVNLFERRTLKALFSPDKIPIKQEEAQMSFLL
>NZ_CP044455.1|WP_005177339.1|1758320_1759310_-|helix-turn-helix-transcriptional-regulator
MSYQNDQLILPTYLAPALLIDLAEMYGVNPNRILKGTPVFIEGLISVNQCVSVEQLIHMIRNLHESIVHPEVQFLFGQRYIETLTHPALNAIAYSQNIKEAIQRYVEFHIYLSPWLTPVAYYSDHKIILFWLNSQERHATSLVISAMTAVRTILLNSTQEELKMNYHFVGAEPEFIEQFWEHLGENIQFNSLVNAIQIDIQECTQKQNYQTSAMRQAYYHQAKVLQQQSGLEQSFLQEVHHFLIRNIHQAPNLEECAEYFQISIASFKRRLNKHNTSYQQMLDQARLFTSIQLKTLFAYNDELVADYLNINDIHNFRRAFKRWSNVVVS
>NZ_CP044455.1|WP_163145888.1|1759306_1760230_-|diguanylate-cyclase
MLKPFFYYPRHFLLVMIMAIACLAFFMLSGNFKAHSEIQVIDVIGEGLACLLTLLWIYLILKSRPRGYVTRYFYWGLTFVFLALWMDVLDEFIAIPKTLVWDDLLESFTPPIGFIVLTIAMVNWHKEQLVLSRKLQTKEHVFRDHRLFDAITPLADAQYFKQQLQHEINQRHHSAKNIHLMMINIKDLSAINREFGFDTGNQVLSVIAQTISLNIRPCDLVCRLAGDKFILMLLDLADAQVEIIARELQKCIQSQIFYTHQDFQKFNIDCRYTISEVQQDSPATEIQKLYKQMKHQQIIKLRTRMSV
>NZ_CP044455.1|WP_163145889.1|1760547_1763007_+|TonB-dependent-receptor
MSTHCSNKTAAFTFKVSTLVLCMLATGHSLAAETATEYVRVIGQAASINEALKEQRKSDSISSVVHADAIAKLPDDNAAEALQRIPGVSTERDQGEGRFVTVRGLSTDLNAVTINGTLVPAPEASRRGVALDVLPAELVQSLTVVKTLTPDMDANSLGGTIQVESLSAFDHDGLFYTAAVEGGYDEKREEYSPKVSGAVSQKFSLGSGTDNFGVAAALSWQERTFGSDNVETGGKWEDGLLEETEMRQYDIERERLGAGLNFDFRPNKNSEYYLRTLYSRFQDNETRQAAGVEFSDPFAINTPGSAEVVRELKEREETQEIKSFVLGGKNRFDQWTLEAQLGYSEASEKNPGGIAGAGFVGEFDDLQYSSTRIPVVKGAASFYDPSQYELDEVEWEKSTAKDKEKNAKFDLSRDYLLNDYASIFKFGAKVSQRTKTNDTEIWKVEDLDTSPAHFGSNGHYELAQFGPTLSSGPIHNQLAQLNLNDWRDAEESVINDYKTSEDIHAAYVMNTIDFDRLRVIAGLRYEDTDFETQGYRILDGESSSVSTQNDYDHWLPSLHLKYQLSSDAILRAAWTNTVVRPNFEQSRPGIYIDGDEAEFGNPNLKALEASNFDLGVEKYFGDASVISMNAFYKDIDHFIYNANVAGTGDWIDFDEAMTFKNGSSAKIYGVELGYSQKWHNFIFGLNSTFSRAKADIDGMVDGELMTRTINFPSQSKVVGNAMIGWENDRVGLRLAANYKSRYLNEISGIDEPEKDLYTDDQVFVDLSGHVNFNKNIQLFFNAQNLTDEVYYNYNGNRHYNAQYEEYGPSYKVGLKFTHF
>NZ_CP044455.1|WP_163145890.1|1763065_1765033_+|phytase
MTMLFKLSTFCAALVALSGCTSSAHTQKNTISSPLHLEQTLSALDQPALPVEQIFKLPITVEDAHWIEIDGLNAQVLTSSKTQGLSLWNSNAQRVQHIPGSFSKIDYRSIGQQLIIQTTDLLQQRPVIFRFDLNTGTWAKPVYLAARSFKTEDNCLYLTPDQSLYSFLVGEEGIGEQWMIQSGGSNQISPHFIRSMSLPPNSGFCVVDDHHDKLYINEEDVGIWAYEADPEADLIRYPVDLNHPYGSILGNVSGLSLIDNALAAMDESKAVLYRYRIEGTSWHKLPPLSLQNVDEPERISLKGTQDQKQLLLVDDQIKLLNINWTTQALPPKKAGLAIPADVETDLVPSRGDAADDPAIWVNQANPRLSRVLGTDKQGGLAVYDLNGKQLQYLKVGRLNNVDIRPNFKLGQQTVDLAIATNRDQNSLHLFSIHQKTGQVKDLGELPTDLNNIYGFCMYQNRQGETFAIPNDKNGTFVQYKIQSKASGLSVEEVLRFKVSSQPEGCVVDDEHDRIYVGEEAKAVWTTRLDDPKQIQLQPVITVGEQVKADIEGLAIYKGQVRDYLVISSQGDDSYVVVDAAAPYQLRGKFKISADLNHEIDAVSETDGLEVTSANLGGIWKKGMLVVQDGRKRMPEGNQNYKYVAWEKIAQALGLE
>NZ_CP044455.1|WP_104472268.1|1765104_1765791_+|protein-TolQ
MSNPSAAQLSVWELISHASLLVQAVMLILLLASIISWYVIIKQSIRLRQETAANKVFLSQFRQQPFPLATTEPSEPKSGGLGQIYQAGLDEFHTLQHTSTRLSSAAVTDQVERRLLTSVSEQEEKLEKHLSFLATVGSVSPYIGLFGTVWGIMNSFIGLSQLEQATLSAVAPGIAEALIATAIGLFAAIPAVIAYNRLSARAEKISNSYYSFGNELQTRMLRFLQAGN
>NZ_CP044455.1|WP_075166740.1|1765797_1766244_+|protein-TolR
MQKRQKKHALNAEMNVVPYIDVMLVLLVIFMVTAPMLTQGIKVNLPNLEAETLVTPKEQKVITISIQEDGRYYWNVGESVDTAQVTDRATSLTEMKEKLSPLLQIHQDIQVFIRADRSANYELVAQTIGLLQQSGVEQLGLVTEEQDQ
>NZ_CP044455.1|WP_163145891.1|1766240_1767035_+|energy-transducer-TonB
MKSISRINPATAVAFSVTAFLHATLVYSVLNQNFDSPIQEVAPKSVQVKFVQLPKADISPQLQPEHAPTQEPAQSQVMPSAAAPVQSAPTQLAQSVKAKPASNQPAKARPEPNPQPKVASSPAVTDHTSTTMQTTAAVTHESPPAPAKPAATTQPAPSASKPIVAKNTQPPPVFDEKNYKPISKVKPDYPMRALENELEGNCTVEYSVNTQGQVVNPKALTDCDPIFVRPSLNAARQFKYQPRIVNGQAVEVAKIKNTFEYRIE
>NZ_CP044455.1|WP_163145892.1|1767606_1769760_+|TonB-dependent-siderophore-receptor
MSYIVHPSFKLSLLSLAILVSQQGFAEDTQQLATITMTAEPAKADQSSEHTQRYIIQNSATASKLDIPLKETPQTVNVVTRQQLDDFSLNNTRDVLRNSPGIMVSNQETERSSYLSRGFEISNVLVDGVGLPLEGYNYNNDNPDSFLFDRIEVVKGANALNNGIGNPGATINLIRKRPTQDFQAALNASYGSWNTQRYEADVSSALTEDGRIRGRLFGYQQTGDSYLERYSLEKNGVGAVLEADLTDTTLLTAGYSETQHQPNSVNWGSNPLINTEGEQLHYPQNYNYSPDWAYWDSNIKNYFAEIEQKLGGDWTAKLSYDEKRTKRDAKLLYLSGRPAADGTSGVFLYPGMYLDDNKQQQASLSFSGTYPLWGQRHEASVGYIWAENQLDELGYGGRFAQPLTTDLASFTPEEPSWDLSKTSGEMHIRQKNQSLYAATRLHLNDDLKVLLGANYVQAKSTGSSYGTDTIYDEDKVLPYAGLTYNFSPEYTGYLSYTSIFRPQTSKAADGNLNKPIEGESYEAGIKSSWLDDRLTATMAIFRTEQNNYPLRDSDGIPTLRKTQVSDLRSQGYEFSLAGQLSDHLNLSFGYTQFSLKDLINGGDARTFNPNQSFNLLTTYQVPQIPKLKLGLGLQWQDKTYLEVPETTTNGVTQQAGVIEQDAYALVNLMASYELNEHITLQANGNNLTNEKYLFNFPNQQGFYGAPANYSVAVKFKY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044455_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044455_4

2258528-2258611

Orphan

Consensus_repeat	Method
ACTCAGGCGCAGCCTTCACCTTGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044455_4

>merge|NZ_CP044455|4|2258528-2258611|CRISPRCasFinder
ACTCAGGCGCAGCCTTCACCTTGCGCTCGGGCAACGCAGTGCGTTGCTTTATCCTCTTTACTCAGGCGCAGCCTTCGCCTTGCG

>NZ_CP044455|4|3|2258528-2258611|CRISPRCasFinder
ACTCAGGCGCAGCCTTCACCTTGCG	CTCGGGCAACGCAGTGCGTTGCTTTATCCTCTTT
ACTCAGGCGCAGCCTTCGCCTTGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044455.1\|WP_160241549.1\|2265894_2267946_+\|site-specific-recombinase	unknown	unknown	gnl\|CDD\|378408
NZ_CP044455.1\|WP_016659896.1\|2260098_2261370_-\|serine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235461
NZ_CP044455.1\|WP_163142595.1\|2253629_2254289_+\|lipoyl(octanoyl)-transferase-LipB	unknown	unknown	gnl\|CDD\|237681
NZ_CP044455.1\|WP_163146064.1\|2261489_2262377_-\|DUF3298-domain-containing-protein	unknown	unknown	gnl\|CDD\|378702
NZ_CP044455.1\|WP_005176137.1\|2250035_2250560_-\|YecA-family-protein	unknown	unknown	gnl\|CDD\|377099
NZ_CP044455.1\|WP_005176119.1\|2256360_2257758_+\|APC-family-permease	unknown	unknown	gnl\|CDD\|223605
NZ_CP044455.1\|WP_005176089.1\|2268098_2268713_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP044455.1\|WP_163146063.1\|2258634_2260017_-\|uroporphyrinogen-III-C-methyltransferase	unknown	unknown	gnl\|CDD\|182606
NZ_CP044455.1\|WP_127799648.1\|2264898_2265876_+\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|182813
NZ_CP044455.1\|WP_005176121.1\|2254905_2256090_+\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341487
NZ_CP044455.1\|WP_152342212.1\|2253202_2253490_+\|DUF493-family-protein	unknown	unknown	gnl\|CDD\|377327
NZ_CP044455.1\|WP_016659900.1\|2249414_2249975_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379218
NZ_CP044455.1\|WP_005176105.1\|2264141_2264453_-\|50S-ribosomal-protein-L21	unknown	unknown	gnl\|CDD\|235510
NZ_CP044455.1\|WP_016659894.1\|2262959_2263652_-\|outer-membrane-lipoprotein-chaperone-LolA	unknown	unknown	gnl\|CDD\|178807
NZ_CP044455.1\|WP_005176106.1\|2263870_2264122_-\|50S-ribosomal-protein-L27	unknown	unknown	gnl\|CDD\|235464
NZ_CP044455.1\|WP_005176124.1\|2254370_2254904_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044455.1\|WP_005176117.1\|2257913_2258393_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|223297
NZ_CP044455.1\|WP_127799634.1\|2251210_2253103_+\|RNA-polymerase-sigma-factor-RpoD	unknown	unknown	gnl\|CDD\|235549
NZ_CP044455.1\|WP_005176086.1\|2268741_2270007_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|184990
NZ_CP044455.1\|WP_005176134.1\|2250629_2250836_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP044455.1\|WP_160241549.1\|2265894_2267946_+\|site-specific-recombinase	gnl\|CDD\|378408	pfam10136, SpecificRecomb, Site-specific recombinase. Members of this family of bacterial proteins are found in various putative site-specific recombinase transmembrane proteins.	0
NZ_CP044455.1\|WP_016659894.1\|2262959_2263652_-\|outer-membrane-lipoprotein-chaperone-LolA	gnl\|CDD\|178807	PRK00031, lolA, outer membrane lipoprotein chaperone LolA.	4.4735e-55
NZ_CP044455.1\|WP_005176119.1\|2256360_2257758_+\|APC-family-permease	gnl\|CDD\|223605	COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism].	1.01017e-45
NZ_CP044455.1\|WP_163142595.1\|2253629_2254289_+\|lipoyl(octanoyl)-transferase-LipB	gnl\|CDD\|237681	PRK14342, PRK14342, lipoyl(octanoyl) transferase LipB.	4.21467e-126
NZ_CP044455.1\|WP_005176137.1\|2250035_2250560_-\|YecA-family-protein	gnl\|CDD\|377099	pfam03695, UPF0149, Uncharacterized protein family (UPF0149). The protein in this family are about 190 amino acids long. The function of these proteins is unknown.	2.7056e-20
NZ_CP044455.1\|WP_005176089.1\|2268098_2268713_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	6.3794e-38
NZ_CP044455.1\|WP_163146063.1\|2258634_2260017_-\|uroporphyrinogen-III-C-methyltransferase	gnl\|CDD\|182606	PRK10637, cysG, siroheme synthase CysG.	0
NZ_CP044455.1\|WP_127799648.1\|2264898_2265876_+\|polyprenyl-synthetase-family-protein	gnl\|CDD\|182813	PRK10888, PRK10888, octaprenyl diphosphate synthase; Provisional.	1.61875e-102
NZ_CP044455.1\|WP_005176121.1\|2254905_2256090_+\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341487	cd14865, Fe-ADH-like, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains iron-containing alcohol dehydrogenase (Fe-ADH) which catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. Its activity requires iron ions. The protein structure represents a dehydroquinate synthase-like fold and is a member of the iron-activated alcohol dehydrogenase-like family. It is distinct from other alcohol dehydrogenases which contains different protein domains. Proteins of this family have not been characterized.	0
NZ_CP044455.1\|WP_152342212.1\|2253202_2253490_+\|DUF493-family-protein	gnl\|CDD\|377327	pfam04359, DUF493, Protein of unknown function (DUF493). This domain is likely to act in a regulatory capacity like pfam01842 domains. This domain has a remarkable property in that the C-terminal residue of every protein in the family lies up in the alignment. This suggests that the C-terminal residue plays some important functional role (Bateman A pers obs).	3.0812e-28
NZ_CP044455.1\|WP_016659900.1\|2249414_2249975_+\|hypothetical-protein	gnl\|CDD\|379218	pfam13488, Gly-zipper_Omp, Glycine zipper.	1.22483e-08
NZ_CP044455.1\|WP_005176105.1\|2264141_2264453_-\|50S-ribosomal-protein-L21	gnl\|CDD\|235510	PRK05573, rplU, 50S ribosomal protein L21; Validated.	5.44395e-56
NZ_CP044455.1\|WP_005176106.1\|2263870_2264122_-\|50S-ribosomal-protein-L27	gnl\|CDD\|235464	PRK05435, rpmA, 50S ribosomal protein L27; Validated.	1.59783e-51
NZ_CP044455.1\|WP_016659896.1\|2260098_2261370_-\|serine--tRNA-ligase	gnl\|CDD\|235461	PRK05431, PRK05431, seryl-tRNA synthetase; Provisional.	0
NZ_CP044455.1\|WP_005176117.1\|2257913_2258393_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	gnl\|CDD\|223297	COG0219, CspR, Predicted rRNA methylase (SpoU class) [Translation, ribosomal structure and biogenesis].	1.69841e-77
NZ_CP044455.1\|WP_127799634.1\|2251210_2253103_+\|RNA-polymerase-sigma-factor-RpoD	gnl\|CDD\|235549	PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated.	0
NZ_CP044455.1\|WP_005176086.1\|2268741_2270007_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|184990	PRK15030, PRK15030, multidrug efflux RND transporter periplasmic adaptor subunit AcrA.	1.78963e-99
NZ_CP044455.1\|WP_163146064.1\|2261489_2262377_-\|DUF3298-domain-containing-protein	gnl\|CDD\|378702	pfam11738, DUF3298, Protein of unknown function (DUF3298). This family of bacterial protein C-terminal regions is highly conserved but the function is not known. Several members are annotated as being endo-1,4-beta-xylanase-like, but this could not be confirmed, and the structure can be defined as a heat-shock cognate 70kd protein 44kd ATPase.	1.18806e-10

>NZ_CP044455.1|WP_005176117.1|2257913_2258393_-|tRNA-(cytidine(34)-2'-O)-methyltransferase
MIHVVLYEPEIPANTGNIIRLCANTGAQLHLVKPLGFELDDKKLKRAGLDYHEWARMQLWDSIEDCLANLASKGIGVDAVYPLTTKGTETPHTSDLNRPVALLMGPETRGLPEHVRLMFPQEHWIRLPMAENSRSLNLSNATAVIVYEAWRQQGFQPLS
>NZ_CP044455.1|WP_005176119.1|2256360_2257758_+|APC-family-permease
MTNISGTQSAAKLQKTLGLWHIIIIGLAYIQPMTLFDTFGLVSEESHFHVPTSYIFALVAILLTSLSYGHMIRRYPSSGSAYTYAQKSIHPNVGFMVGWSSWLDYLLSPMVNIILAVIYLEALFPDVNHWVWVIVLTAFMTGINLRGARFVANFNSLIVFIQLLVIAIFTWMVFTKLQAGFNADGPISAEQRYQLWSLEPFWNELTSVGALITGATLLCFSFTGFDSLSSLAEETKDTEKTLPKAIFLTALIAGIIFIVSTYFMQIYFPNEPGSYFKNIAETQPEILMLVGGSLFQSYVLTFAIVTVMASGISAHAGVSRLMYVMGRDGVINKKIFGHISPRNFTPSYNILIVGAVALTAGFMDLDFVISLISFGALTAFSFVNLSVISRYALRDGRTRNVKDILNFVVVPLCGFIAVFALWLEVDETSLKYGLWWAMAGILYLGYKTKGFKHPAPQHNEFDDKL
>NZ_CP044455.1|WP_005176121.1|2254905_2256090_+|iron-containing-alcohol-dehydrogenase
MAKPYYEFFCPVKVIAGNAALEHIPFELVTLGAKRPLIITDKGVRGNNLLAPVEAAFESTDAEIGYIFDDVPQDSSLDTVRKAAQLYRDHNCDAIIAVGGGSVIDTSKATNILVTEGGDDLLKYSGAHNLPKPLKPFFVIPTTSGTGSEVTMVAVVSDTEKNVKMPFASYYLMPHAAILDPRMTQTLPPHLTAMTAMDAMTHAVEAYSCMASNPISDAYATAAIKKISNNLFKVLDNPSDAYGRLELAQASTMAGIAFSNSMVGLVHSLGHALGAVAHLPHGLCMNLFLPYVLEYNKDVNGDKIAELLLPLAGPDIYAQTPAHLRADKAIATLLTMRDRLYAMTKLPRTLSETGKVTEAQLDEVAEKALNDGSIIYNPKEASLEDLKSILKKAW
>NZ_CP044455.1|WP_005176124.1|2254370_2254904_+|hypothetical-protein
MISSKTVKPALQQAYVKLMMDVIGRGLVMASQVDQEIKQEVAKFPANFILSMKVFPNGPAFIARVTEDHQLELLPELDGKPDLVITFKHLTHAFLVFSFQESTAQAFAHDRMIADGDLSYAIRLVRCLNKMEALILPKLLAELAVKQYPSELSLKEKLSGAAHIYLKVAQSYFQRSA
>NZ_CP044455.1|WP_163142595.1|2253629_2254289_+|lipoyl(octanoyl)-transferase-LipB
MTDALQKPTLIIRQYSQLTPYQDRFLEMKQLTEQRDANTPDELWILQHHEVLTQGQAGKAEHILIPSHIPVVQTDRGGQVTWHGPGQLVAYFLFDLNRLGWNVRTLVSYAENLMIALLKKYSIEAYAKADAPGVYVAERKIGSLGFKIRKGRSYHGLALNIDCDLSGFQTINPCGYAGLEMVRIQDLVPDYPSFETLCRDIIETLEHSGYFSEVQTIQA
>NZ_CP044455.1|WP_152342212.1|2253202_2253490_+|DUF493-family-protein
MIDRTPSRELQEHLWVFPMDYPIKLIGLAGAELRQAVNDIFVKHFPDFDGDKMTVIPSRTGKYHSITAQLRFEELEQVHAVYADLAACPLIKTAL
>NZ_CP044455.1|WP_127799634.1|2251210_2253103_+|RNA-polymerase-sigma-factor-RpoD
MSDMTSPTSQVAALISRGKEQGYLTYAEVNDHLPDSITESEQIEDIIQMLQDVGIPVHERAPESDDAMFEDTTEAADEVAEEEAAAVLASVENEPGRTTDPVRMYMREMGTVELLTREGEISIAKRIEEGIRDVLHSIAYWPNAVEVVLQEYKDYENGERRLADLLSGYLDPETDEEIPEVLEDEAVLDDEEESSSKSTKTKDVKLDDDDEEEESESDDDSEADSGPDPEIAKVRFAELTEAWKNTKDVIAKHGRNSKEAEAALQALASVFMMFKFAPRLFDIISEMIRGTHDQIRAAEREVMRYAVRRGRMDRTQFRTTFPGQESNPAWLDEQIAKAPAEMKGYLEKVRPDVLAFQQKIADIEKELGLNVKDIKDIAKRMAVGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKINRVSRQLLQEMGREPTPEELGERLEMDEVKVRKVLKIAKEPISMETPIGDDEDSHLGDFIEDSNITSPVDAATSEGLKEATREVLENLTEREAKVLKMRFGIDMPTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEHLRSFLEND
>NZ_CP044455.1|WP_005176134.1|2250629_2250836_-|hypothetical-protein
MSSTDFELDDNYGDDDVSFDEAAGKISAKESLEKRRLIDDLLAQRRLERDLKDFDYDFDEDDFDDEDD
>NZ_CP044455.1|WP_005176137.1|2250035_2250560_-|YecA-family-protein
MSALDLDLLSEYLDGDQNEYGLDFAATHGFLCAIAVGPQFDQWLDELFEGNQKKVPAEIVAQVKTWLESIRQNLANEEGIEFPFEIEEADVESSLGDWSVGFVDAMFLNEEAWFTPEFEEQLVDLTLPIMVFSGIDEEDPQMESFRRNGQLMDELAEEIPDNLNELYLMYHTPN
>NZ_CP044455.1|WP_016659900.1|2249414_2249975_+|hypothetical-protein
MTNPEIETQRQQEQKREQVKQLPKQQQQQLNANPKTGETGTHPVGTGVGAVGGAATGAAVGATTGPIGAVVGGTIGAVVGGLVGKTAAEAENPTEGDEDIYWREHSQSQPYYTSLQNTHPDLSYERDYQAAYRVGYAQRSRYEPGTRFEDVEPDLRSEWESTKGDTRLAWEDAKHAVRDAWNRMTR
>NZ_CP044455.1|WP_163146063.1|2258634_2260017_-|uroporphyrinogen-III-C-methyltransferase
MDIFPISLKLQQQRCLIVGGGHIAYRKAGLLQKAGAIIDVVAPDIDAALLELVQQSQGHYEDAAFNTEIPLRQYRLVIAATDDAAINRQVFEACEAENVLVNSVDDPPHCRFMVPAIVDRSPLLISVATNGASPVLSRQIRTQLETSIPHGMGKLVSFSGQWRAAVKAKIQNPDERRIFWENLYASPLKEQVFNDNLQEANRLIEQALQEWTTPKGEVYLVGAGPGDPELLTLKALRLMQQADVVIYDRLVSDPIMELCRRDAEKIYVGKARSNHAVPQEGINALLVKYAQEGKRVCRLKGGDPFIFGRGGEEIEELFAAGVAFQVVPGITAASGCSAYAGIPLTHRNYAQSVRFLTGHLKEGSPELPWSELVYENQTLVLYMGLVGLEKICQKLIAHGQRPDMPVALVSKGTTPEQKVVVGTLADIASKVTEHQIQAPTLTIIGEVVKLREQLQWHERG
>NZ_CP044455.1|WP_016659896.1|2260098_2261370_-|serine--tRNA-ligase
MIDPKLLRNNIEAVNLALAKRGVQLNVEEWASLEARRKEIQSKTEALQAERNAGAKQVGQIKKAGGDASEIMARMSAIGDEIKAAEVALNELQAEIETKSLTIPNLPHESVPEGKDEADNVEILTWGTPREFDFEIKDHTDLGEWMGGLEFETATKLTGSRFSVLKGPLARLQRALTQFMLDTHTLKNGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQGEKEFYLIPTAEVPVTNFVRDEIIDADRLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVKPEDSMQALEELTGHAEGILQALGLPYRKIILCGGDMGFGATKTYDLEVWVPSQNTYREISSCSNMGDFQARRMKARYRADQKKTEFVHTLNGSGLAVGRTLLAVMENYQRADGSIEVPEVLRPYMGGAEYID
>NZ_CP044455.1|WP_163146064.1|2261489_2262377_-|DUF3298-domain-containing-protein
MQHLKSNLLTTTIALTTALMLSACQPKQDAAPQVEAEQSQTQAAAIPVIQAKVVPVELKQQQRCDEEGCTEYDIQTVNTNVPWINAYFMQRIKKADPIAFSEDAASTASASSASSASSASSASSASSASSASSASSASSASEANSTEEPNRLSLSSTYVRYIGQHGRLATFSMQSYSYPAGAAHGMHHQEFVTFDLNSKKRLALQDILLPNSEAKLVQELFNHNYNWLNEHDIQRDKLRLSDNFYYGANGLVFVYPLYELASYAEGMPELELPYYAVDKLIKAEYLPSLPKYPAQ
>NZ_CP044455.1|WP_016659894.1|2262959_2263652_-|outer-membrane-lipoprotein-chaperone-LolA
MKMLRQTMCAMALGAATLAPVMSTTVYAAPVAASEQQATANLVKQLSHIKSMTANFEQTTKTSGKAPKNKGLTAQHMNQEFKGVMKVARPGKFYWETTSPAKQTIVTSGKTVWIYDPDLQQAVRQNLDEQVANTPALLLSGNTNQIMQSYRVTQPNKGKTYYTLYPKSDDGAFQSLTISFGANKAPSLMILEDSLGQTTYVRFNNVKVNPNIANSTFNFTPPKGTDIIDQ
>NZ_CP044455.1|WP_005176106.1|2263870_2264122_-|50S-ribosomal-protein-L27
MASKKAGGSTKNGRDSNPKMLGVKVYGGQTVTAGNIIVRQRGTEFHAGANVGMGRDHTLFATADGVVKFEVKGQFGRRYVSVE
>NZ_CP044455.1|WP_005176105.1|2264141_2264453_-|50S-ribosomal-protein-L21
MYAVIQSGGKQHRVVEGETLKVELLKAETGATITFDDVLMLVNGDSIQIGAPVVAGAKVTAEVVGHGRHDKIRIIKMRRRKHYRKQQGHRQWFTELKITGISG
>NZ_CP044455.1|WP_127799648.1|2264898_2265876_+|polyprenyl-synthetase-family-protein
MTIDFKQDILAPVASDFAAMDQFINEGITSKVALVMAVSKHVVEAGGKRMRPIMCLLAAKACGAEDLEQARRLAAIIEMLHTATLVHDDVVDESGLRRGRPTANATWNNQTAVLVGDFLISRAFDLLVDLNNMTLLKDFSTGTCEIAEGEVLQLQSQHQPDTTEQTYLDIIHGKTSRLFELATEGAAILTNKPEYREPLRVFAGHFGNAFQIIDDILDYTSDAETLGKNIGDDLMEGKPTLPLIAALKNTTGAQHEIIRRSIATGGTSDLAQVIEIVQTSGALDYCQQRATEETEAAIAALNALPDTIYRQALVNLAKLALHRIQ
>NZ_CP044455.1|WP_160241549.1|2265894_2267946_+|site-specific-recombinase
MHIKFYDLFLNMQDQLETTPADLDEQLLIELVNRIRPANTENSEEIQEKFQAFLHALLITPNAANTLQSFVLCLISQYKQTSLYADTGILSLDGFWSQLFQRLGAHFLPLINDQSQLQDLLRRIFHQRSDKYWLDDIEDQQWQQLFRLLNQGHRNQDDKKLIRQEIIKAITVLSYRVSGIGLYPEFINAHPELTEYESPFLVQNREINDFIVQYKNLHQSADKFEAVIPPDASQALVMIDQCRNVSHKIRRATKRIGVSVSLTYLLSLLEQCLDRIELLLNLIVEEDDVRYSAMGELLVDITTALYSERSVRSLLATNSELMALQVTENASKTGEHYVSTDKAGFLEMYKSAAGAGVIIATMATLKVLAARLTLAPLMQAFINSMNYSLGFMLIHVLHFTVATKQPAMTAAALASTVQHRKGSKMAQIAELAALIINIIRTQFIAILGNISIAIPVAALIAFMWDAALHEPLMNHAKASKMLHDLNPFTSLAIPHAAIAGVCLFLSGLIAGYFDNMAVYRKVGPRLQAHAKLKKWMSQERLDRFAAYIERNLGALAGNFLFGVMLGSMGTIGYILGLPLDIRHIAFASANFIQGLMNVNGSPEIGLIIVSFLGVLLIGLTNLFVSFTLTIIVALRARRVRFEQWKPLAKLVMTHFLTRPSDFFWPPKQPVEVEEQSGPAKGHH
>NZ_CP044455.1|WP_005176089.1|2268098_2268713_+|phosphatase-PAP2-family-protein
MPNFLLYLGGLLCFFSVLMLYVPALTALDSAIVDWFSQHRNEMLNSLMTGLSVVGGMPFVLFLSSLWCLYLARQKEYANIVLVSIGLMGSFATAWILKYLIARERPPEMYHLVNSYGASFPSAHSFYAATLGCLAIYVSMQHPAHKAIVICAVMWMLLMGISRVYLGVHFPSDVLSGWSISFIWITLLYLILIKYSQRKPMNNF
>NZ_CP044455.1|WP_005176086.1|2268741_2270007_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MMSAKLWAPALTACALATSIALVGCSKDPNDAQQAAAQQQMPPTEVGVIVVQPQSVEQSVELSGRTTAFEISEVRPQTSGVVQKRLFTEGSYVREGQALYEIDSRTNRASVDSARAALARQQANLNVLRVKEGRYRQLVGSNAISKQEYDDIVAQVKLAEADVAATRAELRNAEINLGYSTVRAPISGQTNRSTVTAGALVTASQQEPLVTIQRLDPIYVDINQSSAELLRLRQQLSKGDLNSSNNTTVKLKLEDGSYYPVEGRLAFSDASVNPDTGTVTLRAVFPNPNHLLLPGMFATAQIVQGVIPNAVLIPQAAITRTPTGQAMAMLVNAKGVVEPRPVTTAGIQGKDWIVTEGLQTGDKVIVEGIAKVKPEQKVVAKPYQPQAAAPQGAQQPAASDKAKQPADQADAQAEQKATSNT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP044455_2	2.50\|1142833\|30\|NZ_CP044455\|CRT	1142833-1142862	30	NZ_CP044455.1	1138231-1138260	2	0.933
NZ_CP044455_2	2.53\|1143001\|30\|NZ_CP044455\|CRT	1143001-1143030	30	NZ_CP044455.1	1138231-1138260	2	0.933
NZ_CP044455_2	2.54\|1143049\|30\|NZ_CP044455\|CRT	1143049-1143078	30	NZ_CP044455.1	1138231-1138260	2	0.933

1. spacer 2.50|1142833|30|NZ_CP044455|CRT matches to position: 1138231-1138260, mismatch: 2, identity: 0.933

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgactctgatagcgacagcga	Protospacer
*******************  *********

2. spacer 2.53|1143001|30|NZ_CP044455|CRT matches to position: 1138231-1138260, mismatch: 2, identity: 0.933

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgactctgatagcgacagcga	Protospacer
*******************  *********

3. spacer 2.54|1143049|30|NZ_CP044455|CRT matches to position: 1138231-1138260, mismatch: 2, identity: 0.933

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgactctgatagcgacagcga	Protospacer
*******************  *********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154685-154708	1	0.958
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154703-154726	1	0.958
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154901-154924	1	0.958
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155099-155122	1	0.958
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155333-155356	1	0.958
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2168-2191	1	0.958
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1316-1339	1	0.958
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19037-19060	1	0.958
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18521-18544	1	0.958
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1316-1339	1	0.958
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19037-19060	1	0.958
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18521-18544	1	0.958
NZ_CP044455_2	2.31\|1141663\|24\|NZ_CP044455\|CRT	1141663-1141686	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16169-16192	2	0.917
NZ_CP044455_2	2.31\|1141663\|24\|NZ_CP044455\|CRT	1141663-1141686	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16187-16210	2	0.917
NZ_CP044455_2	2.31\|1141663\|24\|NZ_CP044455\|CRT	1141663-1141686	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16301-16324	2	0.917
NZ_CP044455_2	2.31\|1141663\|24\|NZ_CP044455\|CRT	1141663-1141686	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16319-16342	2	0.917
NZ_CP044455_2	2.31\|1141663\|24\|NZ_CP044455\|CRT	1141663-1141686	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16433-16456	2	0.917
NZ_CP044455_2	2.31\|1141663\|24\|NZ_CP044455\|CRT	1141663-1141686	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17111-17134	2	0.917
NZ_CP044455_2	2.31\|1141663\|24\|NZ_CP044455\|CRT	1141663-1141686	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19763-19786	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151550-151573	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151586-151609	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154061-154084	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156809-156832	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156977-157000	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151622-151645	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151862-151885	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151988-152011	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153191-153214	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153311-153334	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154721-154744	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154757-154780	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154919-154942	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155117-155140	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155153-155176	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155351-155374	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155387-155410	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155867-155890	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155921-155944	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156395-156418	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	47-70	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	65-88	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1310-1333	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1328-1351	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1832-1855	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2294-2317	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2654-2677	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2708-2731	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2912-2935	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3188-3211	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	11-34	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	29-52	2	0.917
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19043-19066	2	0.917
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2984-3013	2	0.933
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1304-1333	2	0.933
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1358-1387	2	0.933
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1808-1837	2	0.933
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3446-3475	2	0.933
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151670-151699	2	0.933
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154301-154330	2	0.933
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157331-157360	2	0.933
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1034-1063	2	0.933
NZ_CP044455_2	2.37\|1141975\|24\|NZ_CP044455\|CRT	1141975-1141998	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153839-153862	2	0.917
NZ_CP044455_2	2.37\|1141975\|24\|NZ_CP044455\|CRT	1141975-1141998	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156113-156136	2	0.917
NZ_CP044455_2	2.37\|1141975\|24\|NZ_CP044455\|CRT	1141975-1141998	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156587-156610	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	53-76	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1370-1393	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1424-1447	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1682-1705	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1820-1843	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2000-2023	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2174-2197	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2300-2323	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2582-2605	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2714-2737	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2864-2887	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2900-2923	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2918-2941	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3422-3445	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16601-16624	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16667-16690	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16913-16936	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17027-17050	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18269-18292	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19841-19864	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20057-20080	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154313-154336	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154691-154714	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154709-154732	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154763-154786	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154907-154930	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155105-155128	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155159-155182	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155213-155236	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155339-155362	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155393-155416	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	17-40	2	0.917
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1046-1069	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19967-19990	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16139-16162	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16271-16294	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16403-16426	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16529-16552	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16715-16738	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17081-17104	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17207-17230	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17429-17452	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17483-17506	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17549-17572	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17711-17734	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18011-18034	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18209-18232	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18395-18418	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18473-18496	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18743-18766	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18797-18820	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18953-18976	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19115-19138	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19193-19216	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19493-19516	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19691-19714	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155693-155716	2	0.917
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156155-156178	2	0.917
NZ_CP044455_2	2.50\|1142833\|30\|NZ_CP044455\|CRT	1142833-1142862	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151267-151296	2	0.933
NZ_CP044455_2	2.50\|1142833\|30\|NZ_CP044455\|CRT	1142833-1142862	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3578-3607	2	0.933
NZ_CP044455_2	2.53\|1143001\|30\|NZ_CP044455\|CRT	1143001-1143030	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151267-151296	2	0.933
NZ_CP044455_2	2.53\|1143001\|30\|NZ_CP044455\|CRT	1143001-1143030	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3578-3607	2	0.933
NZ_CP044455_2	2.54\|1143049\|30\|NZ_CP044455\|CRT	1143049-1143078	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151267-151296	2	0.933
NZ_CP044455_2	2.54\|1143049\|30\|NZ_CP044455\|CRT	1143049-1143078	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3578-3607	2	0.933
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18515-18544	2	0.933
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151261-151290	2	0.933
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19835-19858	2	0.917
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19883-19906	2	0.917
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19835-19858	2	0.917
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19883-19906	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	53-76	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1370-1393	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1424-1447	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1682-1705	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1820-1843	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2000-2023	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2174-2197	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2300-2323	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2582-2605	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2714-2737	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2864-2887	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2900-2923	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2918-2941	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3422-3445	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16601-16624	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16667-16690	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16913-16936	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17027-17050	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18269-18292	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19841-19864	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20057-20080	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154313-154336	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154691-154714	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154709-154732	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154763-154786	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154907-154930	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155105-155128	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155159-155182	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155213-155236	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155339-155362	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155393-155416	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	17-40	2	0.917
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1046-1069	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19967-19990	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16139-16162	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16271-16294	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16403-16426	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16529-16552	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16715-16738	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17081-17104	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17207-17230	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17429-17452	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17483-17506	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17549-17572	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17711-17734	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18011-18034	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18209-18232	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18395-18418	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18473-18496	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18743-18766	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18797-18820	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18953-18976	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19115-19138	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19193-19216	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19493-19516	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19691-19714	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155693-155716	2	0.917
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156155-156178	2	0.917
NZ_CP044455_2	2.31\|1141663\|24\|NZ_CP044455\|CRT	1141663-1141686	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17345-17368	3	0.875
NZ_CP044455_2	2.31\|1141663\|24\|NZ_CP044455\|CRT	1141663-1141686	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18623-18646	3	0.875
NZ_CP044455_2	2.31\|1141663\|24\|NZ_CP044455\|CRT	1141663-1141686	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18659-18682	3	0.875
NZ_CP044455_2	2.31\|1141663\|24\|NZ_CP044455\|CRT	1141663-1141686	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19973-19996	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151406-151429	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151514-151537	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153275-153298	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153293-153316	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153527-153550	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153635-153658	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153755-153778	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153773-153796	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153893-153916	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153953-153976	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154775-154798	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155045-155068	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155171-155194	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155225-155248	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155279-155302	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155405-155428	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156047-156070	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156203-156226	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156755-156778	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156905-156928	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156941-156964	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157283-157306	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157319-157342	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157607-157630	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1220-1243	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1346-1369	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1418-1441	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1796-1819	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2222-2245	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2390-2413	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2576-2599	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2822-2845	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2990-3013	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3590-3613	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3782-3805	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1058-1081	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16091-16114	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16223-16246	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16355-16378	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16631-16654	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16763-16786	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16805-16828	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16943-16966	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17033-17056	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17381-17404	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17597-17620	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17639-17662	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17759-17782	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17801-17824	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18257-18280	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18299-18322	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18599-18622	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18695-18718	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18845-18868	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18887-18910	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19241-19264	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19283-19306	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19739-19762	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19799-19822	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19973-19996	3	0.875
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20045-20068	3	0.875
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1106-1135	3	0.9
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1412-1441	3	0.9
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2570-2599	3	0.9
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3272-3301	3	0.9
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3776-3805	3	0.9
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2480-2509	3	0.9
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157097-157126	3	0.9
NZ_CP044455_2	2.37\|1141975\|24\|NZ_CP044455\|CRT	1141975-1141998	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156167-156190	3	0.875
NZ_CP044455_2	2.37\|1141975\|24\|NZ_CP044455\|CRT	1141975-1141998	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19043-19066	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	17-40	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1478-1501	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1802-1825	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2996-3019	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3458-3481	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151285-151308	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151628-151651	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151682-151705	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153317-153340	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155477-155500	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156257-156280	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156401-156424	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157343-157366	3	0.875
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1100-1123	3	0.875
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152030-152053	3	0.875
NZ_CP044455_2	2.40\|1142125\|24\|NZ_CP044455\|CRT	1142125-1142148	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155783-155806	3	0.875
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16133-16162	3	0.9
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16265-16294	3	0.9
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16397-16426	3	0.9
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16709-16738	3	0.9
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17075-17104	3	0.9
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17423-17452	3	0.9
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17543-17572	3	0.9
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17705-17734	3	0.9
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18737-18766	3	0.9
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18947-18976	3	0.9
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19187-19216	3	0.9
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19961-19990	3	0.9
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1316-1345	3	0.9
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16847-16870	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17273-17296	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18407-18430	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18917-18940	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19031-19054	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19127-19150	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19853-19876	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16127-16150	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16259-16282	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16391-16414	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17069-17092	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17327-17350	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17417-17440	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17699-17722	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18569-18592	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18731-18754	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19181-19204	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20009-20032	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151267-151290	3	0.875
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3578-3601	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16847-16870	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17273-17296	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18407-18430	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18917-18940	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19031-19054	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19127-19150	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19853-19876	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16127-16150	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16259-16282	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16391-16414	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17069-17092	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17327-17350	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17417-17440	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17699-17722	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18569-18592	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18731-18754	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19181-19204	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20009-20032	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151267-151290	3	0.875
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3578-3601	3	0.875
NZ_CP044455_2	2.74\|1144207\|30\|NZ_CP044455\|CRT	1144207-1144236	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16553-16582	3	0.9
NZ_CP044455_2	2.74\|1144207\|30\|NZ_CP044455\|CRT	1144207-1144236	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17231-17260	3	0.9
NZ_CP044455_2	2.74\|1144207\|30\|NZ_CP044455\|CRT	1144207-1144236	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18035-18064	3	0.9
NZ_CP044455_2	2.74\|1144207\|30\|NZ_CP044455\|CRT	1144207-1144236	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18977-19006	3	0.9
NZ_CP044455_2	2.74\|1144207\|30\|NZ_CP044455\|CRT	1144207-1144236	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19517-19546	3	0.9
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	17-40	3	0.875
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1478-1501	3	0.875
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1802-1825	3	0.875
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2996-3019	3	0.875
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3458-3481	3	0.875
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151285-151308	3	0.875
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151628-151651	3	0.875
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151682-151705	3	0.875
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153317-153340	3	0.875
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155477-155500	3	0.875
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156257-156280	3	0.875
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156401-156424	3	0.875
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157343-157366	3	0.875
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1100-1123	3	0.875
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152030-152053	3	0.875
NZ_CP044455_2	2.80\|1144543\|24\|NZ_CP044455\|CRT	1144543-1144566	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155783-155806	3	0.875
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	944-973	4	0.867
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	980-1009	4	0.867
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155681-155710	4	0.867
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151796-151825	4	0.867
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16145-16168	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16277-16300	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16409-16432	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16721-16744	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17087-17110	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17435-17458	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17555-17578	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17717-17740	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18017-18040	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18215-18238	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18479-18502	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18527-18550	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18749-18772	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18959-18982	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19199-19222	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19499-19522	4	0.833
NZ_CP044455_2	2.32\|1141705\|24\|NZ_CP044455\|CRT	1141705-1141728	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19697-19720	4	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2438-2467	4	0.867
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155681-155710	4	0.867
NZ_CP044455_2	2.39\|1142083\|24\|NZ_CP044455\|CRT	1142083-1142106	24	NC_009444	Pseudomonas fluorescens SBW25 plasmid pQBR103, complete sequence	145876-145899	4	0.833
NZ_CP044455_2	2.50\|1142833\|30\|NZ_CP044455\|CRT	1142833-1142862	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	974-1003	4	0.867
NZ_CP044455_2	2.50\|1142833\|30\|NZ_CP044455\|CRT	1142833-1142862	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	938-967	4	0.867
NZ_CP044455_2	2.53\|1143001\|30\|NZ_CP044455\|CRT	1143001-1143030	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	974-1003	4	0.867
NZ_CP044455_2	2.53\|1143001\|30\|NZ_CP044455\|CRT	1143001-1143030	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	938-967	4	0.867
NZ_CP044455_2	2.54\|1143049\|30\|NZ_CP044455\|CRT	1143049-1143078	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	974-1003	4	0.867
NZ_CP044455_2	2.54\|1143049\|30\|NZ_CP044455\|CRT	1143049-1143078	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	938-967	4	0.867
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157055-157084	4	0.867
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3440-3469	4	0.867
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16661-16690	4	0.867
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154565-154594	4	0.867
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156527-156556	4	0.867
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1820-1849	4	0.867
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1316-1345	4	0.867
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2090-2119	4	0.867
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1370-1399	4	0.867
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2000-2029	4	0.867
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2174-2203	4	0.867
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154313-154342	4	0.867
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16097-16120	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16229-16252	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16361-16384	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16637-16660	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16811-16834	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16949-16972	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17039-17062	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17387-17410	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17441-17464	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17645-17668	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17807-17830	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18305-18328	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18605-18628	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18701-18724	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18755-18778	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18893-18916	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19049-19072	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19289-19312	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19805-19828	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19979-20002	4	0.833
NZ_CP044455_2	2.70\|1144003\|24\|NZ_CP044455\|CRT	1144003-1144026	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154571-154594	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16097-16120	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16229-16252	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16361-16384	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16637-16660	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16811-16834	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16949-16972	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17039-17062	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17387-17410	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17441-17464	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17645-17668	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17807-17830	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18305-18328	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18605-18628	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18701-18724	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18755-18778	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18893-18916	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19049-19072	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19289-19312	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19805-19828	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19979-20002	4	0.833
NZ_CP044455_2	2.72\|1144117\|24\|NZ_CP044455\|CRT	1144117-1144140	24	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154571-154594	4	0.833
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19031-19060	4	0.867
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21023-21052	4	0.867
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15410-15439	4	0.867
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9545-9574	4	0.867
NZ_CP044455_2	2.79\|1144501\|24\|NZ_CP044455\|CRT	1144501-1144524	24	NC_009444	Pseudomonas fluorescens SBW25 plasmid pQBR103, complete sequence	145876-145899	4	0.833
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17939-17968	5	0.833
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19421-19450	5	0.833
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19973-20002	5	0.833
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151273-151302	5	0.833
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155465-155494	5	0.833
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156143-156172	5	0.833
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156245-156274	5	0.833
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151796-151825	5	0.833
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16745-16774	5	0.833
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17741-17770	5	0.833
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18503-18532	5	0.833
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19223-19252	5	0.833
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	944-973	5	0.833
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	980-1009	5	0.833
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1808-1837	5	0.833
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154535-154564	5	0.833
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154805-154834	5	0.833
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155681-155710	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151273-151302	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151364-151393	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16145-16174	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16277-16306	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16409-16438	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16475-16504	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16721-16750	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17087-17116	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17153-17182	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17555-17584	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17717-17746	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18017-18046	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18215-18244	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18479-18508	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18527-18556	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18959-18988	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19199-19228	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19499-19528	5	0.833
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19697-19726	5	0.833
NZ_CP044455_2	2.50\|1142833\|30\|NZ_CP044455\|CRT	1142833-1142862	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153221-153250	5	0.833
NZ_CP044455_2	2.50\|1142833\|30\|NZ_CP044455\|CRT	1142833-1142862	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153701-153730	5	0.833
NZ_CP044455_2	2.50\|1142833\|30\|NZ_CP044455\|CRT	1142833-1142862	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155459-155488	5	0.833
NZ_CP044455_2	2.50\|1142833\|30\|NZ_CP044455\|CRT	1142833-1142862	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156239-156268	5	0.833
NZ_CP044455_2	2.50\|1142833\|30\|NZ_CP044455\|CRT	1142833-1142862	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2306-2335	5	0.833
NZ_CP044455_2	2.51\|1142881\|30\|NZ_CP044455\|CRT	1142881-1142910	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	974-1003	5	0.833
NZ_CP044455_2	2.51\|1142881\|30\|NZ_CP044455\|CRT	1142881-1142910	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	938-967	5	0.833
NZ_CP044455_2	2.53\|1143001\|30\|NZ_CP044455\|CRT	1143001-1143030	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153221-153250	5	0.833
NZ_CP044455_2	2.53\|1143001\|30\|NZ_CP044455\|CRT	1143001-1143030	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153701-153730	5	0.833
NZ_CP044455_2	2.53\|1143001\|30\|NZ_CP044455\|CRT	1143001-1143030	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155459-155488	5	0.833
NZ_CP044455_2	2.53\|1143001\|30\|NZ_CP044455\|CRT	1143001-1143030	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156239-156268	5	0.833
NZ_CP044455_2	2.53\|1143001\|30\|NZ_CP044455\|CRT	1143001-1143030	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2306-2335	5	0.833
NZ_CP044455_2	2.54\|1143049\|30\|NZ_CP044455\|CRT	1143049-1143078	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153221-153250	5	0.833
NZ_CP044455_2	2.54\|1143049\|30\|NZ_CP044455\|CRT	1143049-1143078	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153701-153730	5	0.833
NZ_CP044455_2	2.54\|1143049\|30\|NZ_CP044455\|CRT	1143049-1143078	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155459-155488	5	0.833
NZ_CP044455_2	2.54\|1143049\|30\|NZ_CP044455\|CRT	1143049-1143078	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156239-156268	5	0.833
NZ_CP044455_2	2.54\|1143049\|30\|NZ_CP044455\|CRT	1143049-1143078	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2306-2335	5	0.833
NZ_CP044455_2	2.55\|1143097\|30\|NZ_CP044455\|CRT	1143097-1143126	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	974-1003	5	0.833
NZ_CP044455_2	2.55\|1143097\|30\|NZ_CP044455\|CRT	1143097-1143126	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	938-967	5	0.833
NZ_CP044455_2	2.62\|1143553\|42\|NZ_CP044455\|CRT	1143553-1143594	42	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19037-19078	5	0.881
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154439-154468	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156173-156202	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156629-156658	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157037-157066	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157091-157120	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1352-1381	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1802-1831	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17021-17050	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16751-16780	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17747-17776	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19229-19258	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16793-16822	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17627-17656	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17789-17818	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17831-17860	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18875-18904	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19031-19060	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19271-19300	5	0.833
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19313-19342	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151538-151567	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151574-151603	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151850-151879	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151976-152005	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153179-153208	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154673-154702	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154889-154918	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155087-155116	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155321-155350	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155855-155884	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156797-156826	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156965-156994	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157271-157300	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	35-64	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2432-2461	5	0.833
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2696-2725	5	0.833
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1820-1849	5	0.833
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1316-1345	5	0.833
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2090-2119	5	0.833
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154565-154594	5	0.833
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156527-156556	5	0.833
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19031-19060	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	53-82	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1424-1453	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1682-1711	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1820-1849	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2582-2611	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2714-2743	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2864-2893	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2900-2929	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2918-2947	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3422-3451	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154691-154720	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154709-154738	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154763-154792	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154907-154936	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155105-155134	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155159-155188	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155213-155242	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155339-155368	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155393-155422	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19031-19060	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17021-17050	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18263-18292	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20051-20080	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	17-46	5	0.833
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1046-1075	5	0.833
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1820-1849	5	0.833
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1316-1345	5	0.833
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2090-2119	5	0.833
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154565-154594	5	0.833
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156527-156556	5	0.833
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19031-19060	5	0.833
NZ_CP044455_2	2.74\|1144207\|30\|NZ_CP044455\|CRT	1144207-1144236	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19643-19672	5	0.833
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16595-16624	5	0.833
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16661-16690	5	0.833
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16907-16936	5	0.833
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19883-19912	5	0.833
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154565-154594	5	0.833
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2090-2119	5	0.833
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2324-2353	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3584-3613	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2984-3013	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1304-1333	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1808-1837	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3446-3475	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16655-16684	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16697-16726	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16865-16894	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16967-16996	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17435-17464	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17825-17854	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17867-17896	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18323-18352	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18347-18376	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18749-18778	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18935-18964	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19067-19096	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19307-19336	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19349-19378	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154535-154564	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154805-154834	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151670-151699	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154301-154330	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157331-157360	6	0.8
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20111-20140	6	0.8
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16787-16816	6	0.8
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17621-17650	6	0.8
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17783-17812	6	0.8
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18869-18898	6	0.8
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19265-19294	6	0.8
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20027-20056	6	0.8
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1766-1795	6	0.8
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155771-155800	6	0.8
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156143-156172	6	0.8
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155843-155872	6	0.8
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156785-156814	6	0.8
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157259-157288	6	0.8
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3584-3613	6	0.8
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1214-1243	6	0.8
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2324-2353	6	0.8
NZ_CP044455_2	2.50\|1142833\|30\|NZ_CP044455\|CRT	1142833-1142862	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1196-1225	6	0.8
NZ_CP044455_2	2.51\|1142881\|30\|NZ_CP044455\|CRT	1142881-1142910	30	NZ_CP010312	Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence	64179-64208	6	0.8
NZ_CP044455_2	2.53\|1143001\|30\|NZ_CP044455\|CRT	1143001-1143030	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1196-1225	6	0.8
NZ_CP044455_2	2.54\|1143049\|30\|NZ_CP044455\|CRT	1143049-1143078	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1196-1225	6	0.8
NZ_CP044455_2	2.55\|1143097\|30\|NZ_CP044455\|CRT	1143097-1143126	30	NZ_CP010312	Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence	64179-64208	6	0.8
NZ_CP044455_2	2.58\|1143271\|30\|NZ_CP044455\|CRT	1143271-1143300	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156155-156184	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151664-151693	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151718-151747	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153353-153382	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153407-153436	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154295-154324	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155675-155704	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155963-155992	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157217-157246	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157235-157264	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157325-157354	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157451-157480	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	53-82	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1100-1129	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1424-1453	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1460-1489	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1664-1693	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1682-1711	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2474-2503	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2582-2611	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2714-2743	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2900-2929	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2978-3007	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3266-3295	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3422-3451	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3596-3625	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3734-3763	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3770-3799	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18587-18616	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16127-16156	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16259-16288	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16391-16420	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17069-17098	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17327-17356	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17417-17446	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17699-17728	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18731-18760	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19181-19210	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20009-20038	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	17-46	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1028-1057	6	0.8
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1046-1075	6	0.8
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19031-19060	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	35-64	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2432-2461	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2696-2725	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151538-151567	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151574-151603	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151850-151879	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151976-152005	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153179-153208	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154673-154702	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154889-154918	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155087-155116	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155321-155350	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155855-155884	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156797-156826	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156965-156994	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157271-157300	6	0.8
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP010312	Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence	64173-64202	6	0.8
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16595-16624	6	0.8
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16661-16690	6	0.8
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16907-16936	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	35-64	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2432-2461	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2696-2725	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151538-151567	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151574-151603	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151850-151879	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151976-152005	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153179-153208	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154673-154702	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154889-154918	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155087-155116	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155321-155350	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155855-155884	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156797-156826	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156965-156994	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157271-157300	6	0.8
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP010312	Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence	64173-64202	6	0.8
NZ_CP044455_2	2.74\|1144207\|30\|NZ_CP044455\|CRT	1144207-1144236	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18545-18574	6	0.8
NZ_CP044455_2	2.74\|1144207\|30\|NZ_CP044455\|CRT	1144207-1144236	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151802-151831	6	0.8
NZ_CP044455_2	2.74\|1144207\|30\|NZ_CP044455\|CRT	1144207-1144236	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154541-154570	6	0.8
NZ_CP044455_2	2.74\|1144207\|30\|NZ_CP044455\|CRT	1144207-1144236	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154811-154840	6	0.8
NZ_CP044455_2	2.74\|1144207\|30\|NZ_CP044455\|CRT	1144207-1144236	30	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1524524-1524553	6	0.8
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17021-17050	6	0.8
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18263-18292	6	0.8
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20051-20080	6	0.8
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16847-16876	6	0.8
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17273-17302	6	0.8
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18407-18436	6	0.8
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18917-18946	6	0.8
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19127-19156	6	0.8
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19853-19882	6	0.8
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1820-1849	6	0.8
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9833-9862	6	0.8
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1106-1135	7	0.767
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1412-1441	7	0.767
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2570-2599	7	0.767
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2852-2881	7	0.767
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3272-3301	7	0.767
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3776-3805	7	0.767
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155201-155230	7	0.767
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157097-157126	7	0.767
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2984-3013	7	0.767
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21011-21040	7	0.767
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15398-15427	7	0.767
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9533-9562	7	0.767
NZ_CP044455_2	2.36\|1141927\|30\|NZ_CP044455\|CRT	1141927-1141956	30	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	2292436-2292465	7	0.767
NZ_CP044455_2	2.50\|1142833\|30\|NZ_CP044455\|CRT	1142833-1142862	30	NZ_CP010312	Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence	64179-64208	7	0.767
NZ_CP044455_2	2.51\|1142881\|30\|NZ_CP044455\|CRT	1142881-1142910	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154319-154348	7	0.767
NZ_CP044455_2	2.51\|1142881\|30\|NZ_CP044455\|CRT	1142881-1142910	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154571-154600	7	0.767
NZ_CP044455_2	2.51\|1142881\|30\|NZ_CP044455\|CRT	1142881-1142910	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1322-1351	7	0.767
NZ_CP044455_2	2.51\|1142881\|30\|NZ_CP044455\|CRT	1142881-1142910	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2180-2209	7	0.767
NZ_CP044455_2	2.53\|1143001\|30\|NZ_CP044455\|CRT	1143001-1143030	30	NZ_CP010312	Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence	64179-64208	7	0.767
NZ_CP044455_2	2.54\|1143049\|30\|NZ_CP044455\|CRT	1143049-1143078	30	NZ_CP010312	Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence	64179-64208	7	0.767
NZ_CP044455_2	2.55\|1143097\|30\|NZ_CP044455\|CRT	1143097-1143126	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154319-154348	7	0.767
NZ_CP044455_2	2.55\|1143097\|30\|NZ_CP044455\|CRT	1143097-1143126	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154571-154600	7	0.767
NZ_CP044455_2	2.55\|1143097\|30\|NZ_CP044455\|CRT	1143097-1143126	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1322-1351	7	0.767
NZ_CP044455_2	2.55\|1143097\|30\|NZ_CP044455\|CRT	1143097-1143126	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2180-2209	7	0.767
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16703-16732	7	0.767
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18941-18970	7	0.767
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP044307	Escherichia coli strain C27A plasmid pC27A-2, complete sequence	43742-43771	7	0.767
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP039853	Salinimonas sp. KX18D6 plasmid plas12, complete sequence	52583-52612	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16097-16126	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16229-16258	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16361-16390	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16637-16666	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16769-16798	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16811-16840	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16949-16978	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17039-17068	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17387-17416	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17603-17632	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17645-17674	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17765-17794	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17807-17836	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18305-18334	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18701-18730	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18851-18880	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18893-18922	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19049-19078	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19247-19276	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19289-19318	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19805-19834	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19979-20008	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-28	7	0.767
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP010312	Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence	64173-64202	7	0.767
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16847-16876	7	0.767
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17273-17302	7	0.767
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18407-18436	7	0.767
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18917-18946	7	0.767
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19127-19156	7	0.767
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19853-19882	7	0.767
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17441-17470	7	0.767
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18605-18634	7	0.767
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18755-18784	7	0.767
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	NZ_CP010312	Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence	64173-64202	7	0.767
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16847-16876	7	0.767
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17273-17302	7	0.767
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18407-18436	7	0.767
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18917-18946	7	0.767
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19127-19156	7	0.767
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19853-19882	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16097-16126	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16229-16258	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16361-16390	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16637-16666	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16811-16840	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16949-16978	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17039-17068	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17387-17416	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17645-17674	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17807-17836	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18305-18334	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18701-18730	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18893-18922	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19049-19078	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19289-19318	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19805-19834	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19979-20008	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16127-16156	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16259-16288	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16391-16420	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16871-16900	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16973-17002	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17069-17098	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17327-17356	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17417-17446	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17699-17728	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17873-17902	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17945-17974	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18329-18358	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18353-18382	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18731-18760	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19073-19102	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19181-19210	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19355-19384	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19427-19456	7	0.767
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20009-20038	7	0.767
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2198-2227	8	0.733
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2552-2581	8	0.733
NZ_CP044455_2	2.30\|1141615\|30\|NZ_CP044455\|CRT	1141615-1141644	30	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2798-2827	8	0.733
NZ_CP044455_2	2.51\|1142881\|30\|NZ_CP044455\|CRT	1142881-1142910	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156533-156562	8	0.733
NZ_CP044455_2	2.55\|1143097\|30\|NZ_CP044455\|CRT	1143097-1143126	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156533-156562	8	0.733
NZ_CP044455_2	2.56\|1143145\|36\|NZ_CP044455\|CRT	1143145-1143180	36	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19637-19672	8	0.778
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17537-17566	8	0.733
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16847-16876	8	0.733
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17273-17302	8	0.733
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18407-18436	8	0.733
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18917-18946	8	0.733
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19127-19156	8	0.733
NZ_CP044455_2	2.65\|1143715\|30\|NZ_CP044455\|CRT	1143715-1143744	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19853-19882	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16097-16126	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16229-16258	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16361-16390	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16637-16666	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16769-16798	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16811-16840	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16949-16978	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17039-17068	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17387-17416	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17603-17632	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17645-17674	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17765-17794	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17807-17836	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18305-18334	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18701-18730	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18851-18880	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18893-18922	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19049-19078	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19247-19276	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19289-19318	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19805-19834	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19979-20008	8	0.733
NZ_CP044455_2	2.66\|1143763\|30\|NZ_CP044455\|CRT	1143763-1143792	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-28	8	0.733
NZ_CP044455_2	2.69\|1143955\|30\|NZ_CP044455\|CRT	1143955-1143984	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-28	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16097-16126	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16229-16258	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16361-16390	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16637-16666	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16769-16798	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16811-16840	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16949-16978	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17039-17068	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17387-17416	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17603-17632	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17645-17674	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17765-17794	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17807-17836	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18305-18334	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18701-18730	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18851-18880	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18893-18922	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19049-19078	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19247-19276	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19289-19318	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19805-19834	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19979-20008	8	0.733
NZ_CP044455_2	2.73\|1144159\|30\|NZ_CP044455\|CRT	1144159-1144188	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-28	8	0.733
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16679-16708	8	0.733
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16769-16798	8	0.733
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17603-17632	8	0.733
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17765-17794	8	0.733
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18851-18880	8	0.733
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19247-19276	8	0.733
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	LC589952	Enterobacter phage vB_EkoM5VN DNA, complete genome	25016-25045	8	0.733
NZ_CP044455_2	2.28\|1141531\|30\|NZ_CP044455\|CRT	1141531-1141560	30	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151364-151393	9	0.7
NZ_CP044455_2	2.64\|1143667\|30\|NZ_CP044455\|CRT	1143667-1143696	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-28	9	0.7
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-28	9	0.7
NZ_CP044455_2	2.78\|1144453\|30\|NZ_CP044455\|CRT	1144453-1144482	30	MH823906	Citrobacter phage Maroon, complete genome	154921-154950	9	0.7

1. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.958

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactcggattccga	Protospacer
*************** ********

2. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.958

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactcggattccga	Protospacer
*************** ********

3. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.958

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactcggattccga	Protospacer
*************** ********

4. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.958

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactcggattccga	Protospacer
*************** ********

5. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.958

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactcggattccga	Protospacer
*************** ********

6. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.958

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactcggattccga	Protospacer
*************** ********

7. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.958

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactctga	Protospacer
*** ********************

8. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.958

ctctgattccgacagcgactctga	CRISPR spacer
ctctgattcagacagcgactctga	Protospacer
********* **************

9. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.958

ctctgatagcgacagcgactctga	CRISPR spacer
ctctgacagcgacagcgactctga	Protospacer
******.*****************

10. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.958

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactctga	Protospacer
*** ********************

11. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.958

ctctgattccgacagcgactctga	CRISPR spacer
ctctgattcagacagcgactctga	Protospacer
********* **************

12. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.958

ctctgatagcgacagcgactctga	CRISPR spacer
ctctgacagcgacagcgactctga	Protospacer
******.*****************

13. spacer 2.31|1141663|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

tagcgacagcgactctgatagcga	CRISPR spacer
tagcgacagcgattcagatagcga	Protospacer
************.** ********

14. spacer 2.31|1141663|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

tagcgacagcgactctgatagcga	CRISPR spacer
tagcgacagcgattcagatagcga	Protospacer
************.** ********

15. spacer 2.31|1141663|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

tagcgacagcgactctgatagcga	CRISPR spacer
tagcgacagcgattcagatagcga	Protospacer
************.** ********

16. spacer 2.31|1141663|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

tagcgacagcgactctgatagcga	CRISPR spacer
tagcgacagcgattcagatagcga	Protospacer
************.** ********

17. spacer 2.31|1141663|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

tagcgacagcgactctgatagcga	CRISPR spacer
tagcgacagcgattcagatagcga	Protospacer
************.** ********

18. spacer 2.31|1141663|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

tagcgacagcgactctgatagcga	CRISPR spacer
tagcgacagcgattcagatagcga	Protospacer
************.** ********

19. spacer 2.31|1141663|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

tagcgacagcgactctgatagcga	CRISPR spacer
tagcgacagcgattcagatagcga	Protospacer
************.** ********

20. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattccga	Protospacer
.************** ********

21. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattccga	Protospacer
.************** ********

22. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattccga	Protospacer
.************** ********

23. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattccga	Protospacer
.************** ********

24. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattccga	Protospacer
.************** ********

25. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactcggattcgga	Protospacer
*************** ***** **

26. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttcggacagcgactcggattccga	Protospacer
*** *********** ********

27. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttcggacagcgactcggattccga	Protospacer
*** *********** ********

28. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttcggacagcgactcggattccga	Protospacer
*** *********** ********

29. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactcggactccga	Protospacer
*************** **.*****

30. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttcggacagcgactcggattccga	Protospacer
*** *********** ********

31. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactcggactccga	Protospacer
*************** **.*****

32. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttcggacagcgactcggattccga	Protospacer
*** *********** ********

33. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttcggacagcgactcggattccga	Protospacer
*** *********** ********

34. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactcggactccga	Protospacer
*************** **.*****

35. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttcggacagcgactcggattccga	Protospacer
*** *********** ********

36. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactcggactccga	Protospacer
*************** **.*****

37. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttcggacagcgactcggattccga	Protospacer
*** *********** ********

38. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttcggacagcgactcggattccga	Protospacer
*** *********** ********

39. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactcggactccga	Protospacer
*************** **.*****

40. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttctgacagcgactctgactccga	Protospacer
***.**************.*****

41. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactccgattctga	Protospacer
***************.*****.**

42. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactctgactcgga	Protospacer
******************.** **

43. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagtgactcggattccga	Protospacer
*********.***** ********

44. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttctgacagcgactccgattccga	Protospacer
***.***********.********

45. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactcggattctga	Protospacer
*************** *****.**

46. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgattcggattccga	Protospacer
************.** ********

47. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttctgacagcgactctgactccga	Protospacer
***.**************.*****

48. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttcggacagcgactctgactccga	Protospacer
*** **************.*****

49. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagtgactccgattccga	Protospacer
*********.*****.********

50. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttctgacagcgactctgactccga	Protospacer
***.**************.*****

51. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttccgacagcgactccgattctga	Protospacer
***************.*****.**

52. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ttccgacagcgactctgattccga	CRISPR spacer
ttcagacagcgactctgattcaga	Protospacer
*** ***************** **

53. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.933

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ctccgacagcgactctgactctgacagcga	Protospacer
.***********************.*****

54. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.933

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ttccgacagcgactctgactcggacagcga	Protospacer
********************* **.*****

55. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.933

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ttcggacagcgactctgactctgacagcga	Protospacer
*** ********************.*****

56. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.933

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ttccgacagcgattctgactctgacagcga	Protospacer
************.***********.*****

57. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.933

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ttccgacagtgactctgactctgacagcga	Protospacer
*********.**************.*****

58. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.933

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ttccgacagcgactcggactctgacagcga	Protospacer
*************** ********.*****

59. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.933

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ttccgacagcgactcggactctgacagcga	Protospacer
*************** ********.*****

60. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.933

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ttccgacagcgactcggactctgacagcga	Protospacer
*************** ********.*****

61. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.933

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ttctgacagcgactctgactctgacagcga	Protospacer
***.********************.*****

62. spacer 2.37|1141975|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttcagacagcgactctgatagcga	CRISPR spacer
ttcagacagcgactccgacagcga	Protospacer
***************.**.*****

63. spacer 2.37|1141975|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttcagacagcgactctgatagcga	CRISPR spacer
ttcagacagcgactccgacagcga	Protospacer
***************.**.*****

64. spacer 2.37|1141975|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ttcagacagcgactctgatagcga	CRISPR spacer
ttcagacagcgactccgacagcga	Protospacer
***************.**.*****

65. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattctgacagcgactctga	Protospacer
***.*****.**************

66. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattcggacagcgactctga	Protospacer
***.***** **************

67. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgactccgacagcgactctga	Protospacer
***.**.*****************

68. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattctgacagcgactctga	Protospacer
*** *****.**************

69. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattccgacagcgattctga	Protospacer
***.**************.*****

70. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattcggacagcgactctga	Protospacer
***.***** **************

71. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

72. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattccgacagcgactcgga	Protospacer
***.***************** **

73. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcagactccgacagcgactctga	Protospacer
*** **.*****************

74. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattctgacagcgactctga	Protospacer
***.*****.**************

75. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

76. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgactccgacagcgactcgga	Protospacer
******.************** **

77. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattcggacagcgactctga	Protospacer
***.***** **************

78. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattctgacagcgactctga	Protospacer
***.*****.**************

79. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgattcagatagcgactctga	Protospacer
********* **.***********

80. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgactcagacagcgactctga	Protospacer
******.** **************

81. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgattcagatagcgactctga	Protospacer
********* **.***********

82. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgactcagacagcgactctga	Protospacer
******.** **************

83. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgattcagatagcgactctga	Protospacer
********* **.***********

84. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgattcagatagcgactctga	Protospacer
********* **.***********

85. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgattcagatagcgactctga	Protospacer
********* **.***********

86. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

87. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

88. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

89. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

90. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

91. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

92. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

93. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

94. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

95. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

96. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattctgacagcgactctga	Protospacer
***.*****.**************

97. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattctgacagcgactctga	Protospacer
*** *****.**************

98. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ttcagatagcgacagcgactctga	Protospacer
.** ********************

99. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

100. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

101. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

102. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagatagcgatagcgactctga	Protospacer
*** ********.***********

103. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

104. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

105. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagatagcgatagcgactctga	Protospacer
*** ********.***********

106. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

107. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagatagcgatagcgactctga	Protospacer
*** ********.***********

108. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

109. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

110. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

111. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

112. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagatagcgatagcgactctga	Protospacer
*** ********.***********

113. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

114. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

115. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagatagcgatagcgactctga	Protospacer
*** ********.***********

116. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

117. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagatagcgatagcgactctga	Protospacer
*** ********.***********

118. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

119. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

120. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

121. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcggatagcgacagcgactcgga	Protospacer
*** ***************** **

122. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcggatagcgacagcgactcgga	Protospacer
*** ***************** **

123. spacer 2.50|1142833|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.933

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgactctgactctgacagcga	Protospacer
******************.**.********

124. spacer 2.50|1142833|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.933

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgactccgattcggacagcga	Protospacer
***************.***** ********

125. spacer 2.53|1143001|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.933

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgactctgactctgacagcga	Protospacer
******************.**.********

126. spacer 2.53|1143001|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.933

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgactccgattcggacagcga	Protospacer
***************.***** ********

127. spacer 2.54|1143049|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.933

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgactctgactctgacagcga	Protospacer
******************.**.********

128. spacer 2.54|1143049|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.933

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgactccgattcggacagcga	Protospacer
***************.***** ********

129. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ttctgactctgatagcgacagcgactctga	CRISPR spacer
ttcagactctgacagcgacagcgactctga	Protospacer
*** ********.*****************

130. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.933

ttctgactctgactctgacagcgactctga	CRISPR spacer
ctctgactctgactctgacagcgactcgga	Protospacer
.************************** **

131. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ttctgactctgattcagacagcga	CRISPR spacer
ttcagactctgattcagatagcga	Protospacer
*** **************.*****

132. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ttctgactctgattcagacagcga	CRISPR spacer
ttcagactctgattcagatagcga	Protospacer
*** **************.*****

133. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ttctgactctgattcagacagcga	CRISPR spacer
ttcagactctgattcagatagcga	Protospacer
*** **************.*****

134. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ttctgactctgattcagacagcga	CRISPR spacer
ttcagactctgattcagatagcga	Protospacer
*** **************.*****

135. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattctgacagcgactctga	Protospacer
***.*****.**************

136. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattcggacagcgactctga	Protospacer
***.***** **************

137. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgactccgacagcgactctga	Protospacer
***.**.*****************

138. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattctgacagcgactctga	Protospacer
*** *****.**************

139. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattccgacagcgattctga	Protospacer
***.**************.*****

140. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattcggacagcgactctga	Protospacer
***.***** **************

141. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

142. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattccgacagcgactcgga	Protospacer
***.***************** **

143. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcagactccgacagcgactctga	Protospacer
*** **.*****************

144. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattctgacagcgactctga	Protospacer
***.*****.**************

145. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

146. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgactccgacagcgactcgga	Protospacer
******.************** **

147. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattcggacagcgactctga	Protospacer
***.***** **************

148. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattctgacagcgactctga	Protospacer
***.*****.**************

149. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgattcagatagcgactctga	Protospacer
********* **.***********

150. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgactcagacagcgactctga	Protospacer
******.** **************

151. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgattcagatagcgactctga	Protospacer
********* **.***********

152. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgactcagacagcgactctga	Protospacer
******.** **************

153. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgattcagatagcgactctga	Protospacer
********* **.***********

154. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgattcagatagcgactctga	Protospacer
********* **.***********

155. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctctgattcagatagcgactctga	Protospacer
********* **.***********

156. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

157. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

158. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

159. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

160. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

161. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

162. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

163. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

164. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

165. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattccgacagcgactcgga	Protospacer
*** ***************** **

166. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctccgattctgacagcgactctga	Protospacer
***.*****.**************

167. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgattccgacagcgactctga	CRISPR spacer
ctcggattctgacagcgactctga	Protospacer
*** *****.**************

168. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ttcagatagcgacagcgactctga	Protospacer
.** ********************

169. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

170. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

171. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

172. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagatagcgatagcgactctga	Protospacer
*** ********.***********

173. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

174. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

175. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagatagcgatagcgactctga	Protospacer
*** ********.***********

176. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

177. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagatagcgatagcgactctga	Protospacer
*** ********.***********

178. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

179. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

180. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

181. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

182. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagatagcgatagcgactctga	Protospacer
*** ********.***********

183. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

184. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

185. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagatagcgatagcgactctga	Protospacer
*** ********.***********

186. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

187. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagatagcgatagcgactctga	Protospacer
*** ********.***********

188. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

189. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

190. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcagacagcgacagcgactctga	Protospacer
*** **.*****************

191. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcggatagcgacagcgactcgga	Protospacer
*** ***************** **

192. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.917

ctctgatagcgacagcgactctga	CRISPR spacer
ctcggatagcgacagcgactcgga	Protospacer
*** ***************** **

193. spacer 2.31|1141663|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

tagcgacagcgactctgatagcga	CRISPR spacer
cagcgacagcgattcagatagcga	Protospacer
.***********.** ********

194. spacer 2.31|1141663|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

tagcgacagcgactctgatagcga	CRISPR spacer
cagcgacagcgattcagatagcga	Protospacer
.***********.** ********

195. spacer 2.31|1141663|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

tagcgacagcgactctgatagcga	CRISPR spacer
cagcgacagcgattcagatagcga	Protospacer
.***********.** ********

196. spacer 2.31|1141663|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

tagcgacagcgactctgatagcga	CRISPR spacer
tagcgacagcgactctgattcaga	Protospacer
*******************   **

197. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattcgga	Protospacer
.************** ***** **

198. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattcgga	Protospacer
.************** ***** **

199. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactccgattctga	Protospacer
.**************.*****.**

200. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggactccga	Protospacer
.************** **.*****

201. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattctga	Protospacer
.************** *****.**

202. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgattcggattccga	Protospacer
.***********.** ********

203. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactccgattctga	Protospacer
.**************.*****.**

204. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggactccga	Protospacer
.************** **.*****

205. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattcgga	Protospacer
.************** ***** **

206. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactcggattccga	Protospacer
.**.*********** ********

207. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactcggattccga	Protospacer
.**.*********** ********

208. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattctga	Protospacer
.************** *****.**

209. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactcggattccga	Protospacer
.**.*********** ********

210. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactcggattccga	Protospacer
.**.*********** ********

211. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattctga	Protospacer
.************** *****.**

212. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactcggattccga	Protospacer
.**.*********** ********

213. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggactccga	Protospacer
.************** **.*****

214. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattctga	Protospacer
.************** *****.**

215. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactccgattctga	Protospacer
.**************.*****.**

216. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactccgattctga	Protospacer
.**************.*****.**

217. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattctga	Protospacer
.************** *****.**

218. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcggacagcgactccgattccga	Protospacer
.** ***********.********

219. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactccgattccga	Protospacer
.**.***********.********

220. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactccgattccga	Protospacer
.**.***********.********

221. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattctga	Protospacer
.************** *****.**

222. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactccgattccga	Protospacer
.**.***********.********

223. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactctgactcgga	Protospacer
.*****************.** **

224. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactctgactccga	Protospacer
.**.**************.*****

225. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcagactccga	Protospacer
.************** **.*****

226. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattctga	Protospacer
.************** *****.**

227. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactctgactcgga	Protospacer
.*****************.** **

228. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggactccga	Protospacer
.************** **.*****

229. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactctgactctga	Protospacer
.*****************.**.**

230. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcggacagcgactctgactccga	Protospacer
.** **************.*****

231. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactctgactcgga	Protospacer
.*****************.** **

232. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctccgacagcgactcggattctga	Protospacer
.************** *****.**

233. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

234. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

235. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

236. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

237. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactctgattctga	Protospacer
.**.*****************.**

238. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactctgattcaga	Protospacer
.**.***************** **

239. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

240. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

241. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

242. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattctga	Protospacer
.** *****************.**

243. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactctgattcaga	Protospacer
.**.***************** **

244. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactctgattctga	Protospacer
.**.*****************.**

245. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactctgattcaga	Protospacer
.**.***************** **

246. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

247. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

248. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

249. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

250. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattctga	Protospacer
.** *****************.**

251. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactctgattcaga	Protospacer
.**.***************** **

252. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactctgattctga	Protospacer
.**.*****************.**

253. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctctgacagcgactctgattcaga	Protospacer
.**.***************** **

254. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

255. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

256. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
tagcgacagcgactctgattcaga	Protospacer
*  ****************** **

257. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttccgacagcgactctgattccga	CRISPR spacer
ctcagacagcgactctgattcaga	Protospacer
.** ***************** **

258. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.9

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ctccgacagcgactcggactctgacagcga	Protospacer
.************** ********.*****

259. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.9

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ctccgacagcgactctgactcggacagcga	Protospacer
.******************** **.*****

260. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.9

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ctccgacagcgactctgactcggacagcga	Protospacer
.******************** **.*****

261. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.9

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ctccgacagcgactcggactctgacagcga	Protospacer
.************** ********.*****

262. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.9

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ctccgacagcgactctgactcggacagcga	Protospacer
.******************** **.*****

263. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.9

ttccgacagcgactctgactctgatagcga	CRISPR spacer
tgctgacagcgactctgactctgacagcga	Protospacer
* *.********************.*****

264. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.9

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ctccgacagtgactctgactctgacagcga	Protospacer
.********.**************.*****

265. spacer 2.37|1141975|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttcagacagcgactctgatagcga	CRISPR spacer
ctctgacagcgactcggatagcga	Protospacer
.** *********** ********

266. spacer 2.37|1141975|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttcagacagcgactctgatagcga	CRISPR spacer
ttcagacagcgactctgattcaga	Protospacer
*******************   **

267. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttcggattctgacagcgactctga	Protospacer
.** *****.**************

268. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttcggattcggacagcgactctga	Protospacer
.** ***** **************

269. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttctgactctgacagcgactctga	Protospacer
.*****.**.**************

270. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttcggactccgacagcgactctga	Protospacer
.** **.*****************

271. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttcggattccgacagtgactctga	Protospacer
.** ***********.********

272. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttcggattctgacagcgactctga	Protospacer
.** *****.**************

273. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattccgacagcgactcgga	Protospacer
.**.***************** **

274. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattccgacagcgactcgga	Protospacer
.**.***************** **

275. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattccgacagcgactcgga	Protospacer
.**.***************** **

276. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattctgacagcgactctga	Protospacer
.**.*****.**************

277. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattctgacagcgactctga	Protospacer
.**.*****.**************

278. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattccgacagcgactcgga	Protospacer
.**.***************** **

279. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattccgacagcgactcgga	Protospacer
.**.***************** **

280. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttcggattctgacagcgactctga	Protospacer
.** *****.**************

281. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgatagcgacagcgactctga	CRISPR spacer
ttcggatagcgacagcgactcgga	Protospacer
.** ***************** **

282. spacer 2.40|1142125|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgatagcgacagcgactctga	CRISPR spacer
ttcggatagcgacagcgattctga	Protospacer
.** **************.*****

283. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ttctgactctgatagcgacagcgactctga	CRISPR spacer
ctctgactcagacagcgacagcgactctga	Protospacer
.******** **.*****************

284. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ttctgactctgatagcgacagcgactctga	CRISPR spacer
ctctgactcagacagcgacagcgactctga	Protospacer
.******** **.*****************

285. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ttctgactctgatagcgacagcgactctga	CRISPR spacer
ctctgactcagacagcgacagcgactctga	Protospacer
.******** **.*****************

286. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ttctgactctgatagcgacagcgactctga	CRISPR spacer
ctctgactcagacagcgacagcgactctga	Protospacer
.******** **.*****************

287. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ttctgactctgatagcgacagcgactctga	CRISPR spacer
ctctgactcagacagcgacagcgactctga	Protospacer
.******** **.*****************

288. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ttctgactctgatagcgacagcgactctga	CRISPR spacer
ctctgactcagacagcgacagcgactctga	Protospacer
.******** **.*****************

289. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ttctgactctgatagcgacagcgactctga	CRISPR spacer
ctctgactcagacagcgacagcgactctga	Protospacer
.******** **.*****************

290. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ttctgactctgatagcgacagcgactctga	CRISPR spacer
ctctgactcagacagcgacagcgactctga	Protospacer
.******** **.*****************

291. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ttctgactctgatagcgacagcgactctga	CRISPR spacer
ctctgactcagacagcgacagcgactctga	Protospacer
.******** **.*****************

292. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ttctgactctgatagcgacagcgactctga	CRISPR spacer
ctctgactcagacagcgacagcgactctga	Protospacer
.******** **.*****************

293. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ttctgactctgatagcgacagcgactctga	CRISPR spacer
ctctgactcagacagcgacagcgactctga	Protospacer
.******** **.*****************

294. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ttctgactctgatagcgacagcgactctga	CRISPR spacer
ctctgattcagatagcgacagcgactctga	Protospacer
.*****.** ********************

295. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.9

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagtgactcggattccgacagcgactctga	Protospacer
*  ****** ********************

296. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

297. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

298. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

299. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

300. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

301. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

302. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

303. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

304. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

305. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

306. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

307. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

308. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

309. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

310. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctctgactcagactcagacagcga	Protospacer
.******** **.***********

311. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

312. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

313. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

314. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctctgactctgactctgacagcga	Protospacer
.***********.** ********

315. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctctgactccgattcggacagcga	Protospacer
.********.*****.********

316. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

317. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

318. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

319. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

320. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

321. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

322. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
tagcgactctgattcagacagcga	Protospacer
*  .********************

323. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

324. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

325. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

326. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

327. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

328. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

329. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

330. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctctgactcagactcagacagcga	Protospacer
.******** **.***********

331. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

332. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

333. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctcagactctgactcagacagcga	Protospacer
.** ********.***********

334. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctctgactctgactctgacagcga	Protospacer
.***********.** ********

335. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ttctgactctgattcagacagcga	CRISPR spacer
ctctgactccgattcggacagcga	Protospacer
.********.*****.********

336. spacer 2.74|1144207|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ctctgatagcgacagcgattccgacagcga	CRISPR spacer
ttcagatagcgacagcgattcagacagcga	Protospacer
.** ***************** ********

337. spacer 2.74|1144207|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ctctgatagcgacagcgattccgacagcga	CRISPR spacer
ttcagatagcgacagcgattcagacagcga	Protospacer
.** ***************** ********

338. spacer 2.74|1144207|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ctctgatagcgacagcgattccgacagcga	CRISPR spacer
ttcagatagcgacagcgattcagacagcga	Protospacer
.** ***************** ********

339. spacer 2.74|1144207|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ctctgatagcgacagcgattccgacagcga	CRISPR spacer
ttcagatagcgacagcgattcagacagcga	Protospacer
.** ***************** ********

340. spacer 2.74|1144207|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ctctgatagcgacagcgattccgacagcga	CRISPR spacer
ttcagatagcgacagcgattcagacagcga	Protospacer
.** ***************** ********

341. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttcggattctgacagcgactctga	Protospacer
.** *****.**************

342. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttcggattcggacagcgactctga	Protospacer
.** ***** **************

343. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttctgactctgacagcgactctga	Protospacer
.*****.**.**************

344. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttcggactccgacagcgactctga	Protospacer
.** **.*****************

345. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttcggattccgacagtgactctga	Protospacer
.** ***********.********

346. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttcggattctgacagcgactctga	Protospacer
.** *****.**************

347. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattccgacagcgactcgga	Protospacer
.**.***************** **

348. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattccgacagcgactcgga	Protospacer
.**.***************** **

349. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattccgacagcgactcgga	Protospacer
.**.***************** **

350. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattctgacagcgactctga	Protospacer
.**.*****.**************

351. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattctgacagcgactctga	Protospacer
.**.*****.**************

352. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattccgacagcgactcgga	Protospacer
.**.***************** **

353. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttccgattccgacagcgactcgga	Protospacer
.**.***************** **

354. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.875

ctctgattccgacagcgactctga	CRISPR spacer
ttcggattctgacagcgactctga	Protospacer
.** *****.**************

355. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgatagcgacagcgactctga	CRISPR spacer
ttcggatagcgacagcgactcgga	Protospacer
.** ***************** **

356. spacer 2.80|1144543|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.875

ctctgatagcgacagcgactctga	CRISPR spacer
ttcggatagcgacagcgattctga	Protospacer
.** **************.*****

357. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.867

tagcgacagcgactctgactctgattccga	CRISPR spacer
ctccgacagcgactcggactctgattccga	Protospacer
.  ************ **************

358. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.867

tagcgacagcgactctgactctgattccga	CRISPR spacer
ctccgacagcgactcggactctgattccga	Protospacer
.  ************ **************

359. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.867

tagcgacagcgactctgactctgattccga	CRISPR spacer
tagcgacagcgactcggactctgacagcga	Protospacer
*************** ********.  ***

360. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.867

tagcgacagcgattctgactctgattccga	CRISPR spacer
tagcgacagcgattcggactctgacagcga	Protospacer
*************** ********.  ***

361. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

362. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

363. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

364. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

365. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

366. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

367. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

368. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

369. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

370. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

371. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

372. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

373. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

374. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

375. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

376. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

377. spacer 2.32|1141705|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttccgacagcgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcaga	Protospacer
.  ****************** **

378. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.867

ttccgacagcgactctgactctgatagcga	CRISPR spacer
tgctgacagcgactctgactccgacagcga	Protospacer
* *.*****************.**.*****

379. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.867

ttccgacagcgactctgactctgatagcga	CRISPR spacer
tagcgacagcgactcggactctgacagcga	Protospacer
*  ************ ********.*****

380. spacer 2.39|1142083|24|NZ_CP044455|CRT matches to NC_009444 (Pseudomonas fluorescens SBW25 plasmid pQBR103, complete sequence) position: , mismatch: 4, identity: 0.833

ctctgattccgacagcgactctga	CRISPR spacer
tgctgattccgacagcgactcggt	Protospacer
. ******************* *

381. spacer 2.50|1142833|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.867

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactcggactctgattccgattccga	Protospacer
********* **************.  ***

382. spacer 2.50|1142833|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.867

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactcggactctgattccgattccga	Protospacer
********* **************.  ***

383. spacer 2.53|1143001|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.867

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactcggactctgattccgattccga	Protospacer
********* **************.  ***

384. spacer 2.53|1143001|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.867

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactcggactctgattccgattccga	Protospacer
********* **************.  ***

385. spacer 2.54|1143049|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.867

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactcggactctgattccgattccga	Protospacer
********* **************.  ***

386. spacer 2.54|1143049|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.867

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactcggactctgattccgattccga	Protospacer
********* **************.  ***

387. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.867

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagtgactctgactctgacagtgactctga	Protospacer
.  ******************.********

388. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.867

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagtgactctgactctgacagcgactccga	Protospacer
.  ************************.**

389. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

ttctgactctgactctgacagcgactctga	CRISPR spacer
tagcgactctgactcagacagcgactctga	Protospacer
*  .*********** **************

390. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.867

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagtgactctgattcggacagcgattcgga	Protospacer
*  ************ *********** **

391. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.867

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagtgactcggattccgacagcgattccga	Protospacer
*  ****** *****************.**

392. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.867

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactccgattccgacagcgattctga	Protospacer
*  .*****.********************

393. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.867

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagtgactcggattccgacagcgactctga	Protospacer
*  ****** **************.*****

394. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.867

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagtgactcggattctgacagcgattctga	Protospacer
*  ****** *****.**************

395. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.867

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagtgactccgattcggacagcgactctga	Protospacer
*  ******.***** **************

396. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.867

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagtgactccgattcggacagcgactctga	Protospacer
*  ******.***** **************

397. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.867

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagtgactcggattccgacagcgactcgga	Protospacer
*  ****** ***************** **

398. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.867

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagtgactcggattccgacagcgactcgga	Protospacer
*  ****** ***************** **

399. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

400. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

401. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

402. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

403. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

404. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

405. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

406. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

407. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

408. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

409. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

410. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

411. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

412. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

413. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

414. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

415. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

416. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

417. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

418. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

419. spacer 2.70|1144003|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagtgactctgattcggacagcga	Protospacer
.  ************.********

420. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

421. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

422. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

423. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

424. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

425. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

426. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

427. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

428. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

429. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

430. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

431. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

432. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

433. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

434. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

435. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

436. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

437. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

438. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

439. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagcgactctgattcagacagcga	Protospacer
.  .********************

440. spacer 2.72|1144117|24|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.833

ttctgactctgattcagacagcga	CRISPR spacer
cagtgactctgattcggacagcga	Protospacer
.  ************.********

441. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgactctga	Protospacer
*  .********************.*****

442. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.867

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagtgattccgattcagacagcgattctga	Protospacer
*  ***.**.********************

443. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.867

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagtgattcagattcagacagcgattctga	Protospacer
*  ***.** ********************

444. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.867

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagtgattccgattcagacagcgattctga	Protospacer
*  ***.**.********************

445. spacer 2.79|1144501|24|NZ_CP044455|CRT matches to NC_009444 (Pseudomonas fluorescens SBW25 plasmid pQBR103, complete sequence) position: , mismatch: 4, identity: 0.833

ctctgattccgacagcgactctga	CRISPR spacer
tgctgattccgacagcgactcggt	Protospacer
. ******************* *

446. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

tagcgacagcgactctgactctgattccga	CRISPR spacer
tagcgatagcgactctgactcagacagcga	Protospacer
******.************** **.  ***

447. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

tagcgacagcgactctgactctgattccga	CRISPR spacer
tagcgatagcgactctgactcagacagcga	Protospacer
******.************** **.  ***

448. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

tagcgacagcgactctgactctgattccga	CRISPR spacer
tagcgacagcgactctgattcagacagcga	Protospacer
******************.** **.  ***

449. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

tagcgacagcgactctgactctgattccga	CRISPR spacer
ttctgacagcgactctgactctgactctga	Protospacer
*  .********************.**.**

450. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

tagcgacagcgactctgactctgattccga	CRISPR spacer
ttctgacagcgactctgacagtgattccga	Protospacer
*  .***************  *********

451. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

tagcgacagcgactctgactctgattccga	CRISPR spacer
tagcgacagcgactcggactctgacagtga	Protospacer
*************** ********.  .**

452. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

tagcgacagcgactctgactctgattccga	CRISPR spacer
ttctgacagcgactctgacagtgattccga	Protospacer
*  .***************  *********

453. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

tagcgacagcgactctgactctgattccga	CRISPR spacer
tagcgacagcgattcggactctgacagcga	Protospacer
************.** ********.  ***

454. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

tagcgacagcgattctgactctgattccga	CRISPR spacer
tagcgacagtgattcagactctgacagcga	Protospacer
*********.***** ********.  ***

455. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

tagcgacagcgattctgactctgattccga	CRISPR spacer
tagcgacagtgattcagactctgacagcga	Protospacer
*********.***** ********.  ***

456. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

tagcgacagcgattctgactctgattccga	CRISPR spacer
tagcgacagtgattcagactctgacagcga	Protospacer
*********.***** ********.  ***

457. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

tagcgacagcgattctgactctgattccga	CRISPR spacer
tagcgacagtgattcagactctgacagcga	Protospacer
*********.***** ********.  ***

458. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 5, identity: 0.833

tagcgacagcgattctgactctgattccga	CRISPR spacer
ctccgacagcgactcggactctgattccga	Protospacer
.  *********.** **************

459. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

tagcgacagcgattctgactctgattccga	CRISPR spacer
ctccgacagcgactcggactctgattccga	Protospacer
.  *********.** **************

460. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

tagcgacagcgattctgactctgattccga	CRISPR spacer
ttccgacagcgattctgactctgacagcga	Protospacer
*  *********************.  ***

461. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

tagcgacagcgattctgactctgattccga	CRISPR spacer
tagcgacagcgattcggactctgacagtga	Protospacer
*************** ********.  .**

462. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

tagcgacagcgattctgactctgattccga	CRISPR spacer
tagcgacagcgattcggactctgacagtga	Protospacer
*************** ********.  .**

463. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

tagcgacagcgattctgactctgattccga	CRISPR spacer
tagcgacagcgactcggactctgacagcga	Protospacer
************.** ********.  ***

464. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ttctgacagcgactctgactctgactctga	Protospacer
***.********************.  .**

465. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ctccgacagcgactcggactctgacagtgg	Protospacer
.************** ********.**.*.

466. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

467. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

468. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

469. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgatagcgactctgactcagatagcga	Protospacer
.  ***.************** ********

470. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

471. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

472. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgatagcgactctgactcagatagcga	Protospacer
.  ***.************** ********

473. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

474. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

475. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

476. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

477. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

478. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

479. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

480. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

481. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

482. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttccgacagcgactctgactctgatagcga	CRISPR spacer
cagcgacagcgactctgattcagatagcga	Protospacer
.  ***************.** ********

483. spacer 2.50|1142833|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
ttccgactctgactcggactccgacagcga	Protospacer
.  ************ **.***********

484. spacer 2.50|1142833|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
ttccgactctgactcggactccgacagcga	Protospacer
.  ************ **.***********

485. spacer 2.50|1142833|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgacagtgattccgactctga	Protospacer
*************  **********  .**

486. spacer 2.50|1142833|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgacagtgattccgactctga	Protospacer
*************  **********  .**

487. spacer 2.50|1142833|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
ctctgactccgactccgattccgacagcga	Protospacer
*  .*****.*****.**************

488. spacer 2.51|1142881|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

cagcgattctgactctgattccgacagcga	CRISPR spacer
cagcgactcggactctgattccgattccga	Protospacer
******.** **************.  ***

489. spacer 2.51|1142881|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 5, identity: 0.833

cagcgattctgactctgattccgacagcga	CRISPR spacer
cagcgactcggactctgattccgattccga	Protospacer
******.** **************.  ***

490. spacer 2.53|1143001|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
ttccgactctgactcggactccgacagcga	Protospacer
.  ************ **.***********

491. spacer 2.53|1143001|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
ttccgactctgactcggactccgacagcga	Protospacer
.  ************ **.***********

492. spacer 2.53|1143001|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgacagtgattccgactctga	Protospacer
*************  **********  .**

493. spacer 2.53|1143001|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgacagtgattccgactctga	Protospacer
*************  **********  .**

494. spacer 2.53|1143001|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
ctctgactccgactccgattccgacagcga	Protospacer
*  .*****.*****.**************

495. spacer 2.54|1143049|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
ttccgactctgactcggactccgacagcga	Protospacer
.  ************ **.***********

496. spacer 2.54|1143049|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
ttccgactctgactcggactccgacagcga	Protospacer
.  ************ **.***********

497. spacer 2.54|1143049|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgacagtgattccgactctga	Protospacer
*************  **********  .**

498. spacer 2.54|1143049|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
cagcgactctgacagtgattccgactctga	Protospacer
*************  **********  .**

499. spacer 2.54|1143049|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

cagcgactctgactctgattccgacagcga	CRISPR spacer
ctctgactccgactccgattccgacagcga	Protospacer
*  .*****.*****.**************

500. spacer 2.55|1143097|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

cagcgattctgactctgattccgacagcga	CRISPR spacer
cagcgactcggactctgattccgattccga	Protospacer
******.** **************.  ***

501. spacer 2.55|1143097|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 5, identity: 0.833

cagcgattctgactctgattccgacagcga	CRISPR spacer
cagcgactcggactctgattccgattccga	Protospacer
******.** **************.  ***

502. spacer 2.62|1143553|42|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.881

ctctgattccgacagcgactctgattccgacagcgattctga	CRISPR spacer
ctctgattcagacagcgactctgattcagacagcgatagcga	Protospacer
********* ***************** *********  .**

503. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagtgactctgactctgacagcgattcgga	Protospacer
.  *********************.** **

504. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagtgactccgactctgacagcgactcgga	Protospacer
.  ******.***************** **

505. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagtgactccgactctgacagcgactcgga	Protospacer
.  ******.***************** **

506. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagtgactctgactctgacagcgattcgga	Protospacer
.  *********************.** **

507. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagtgactctgactctgacagcgattcgga	Protospacer
.  *********************.** **

508. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactctgactctgacagcgactccga	Protospacer
.  .***********************.**

509. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgattctgactctgacagcgactctga	Protospacer
.  .**.***********************

510. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactctgactcagacagcgactctga	Protospacer
.  .*********** **************

511. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagtgattcagactctgacagcgactctga	Protospacer
.  ***.** ********************

512. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagtgattcagactctgacagcgactctga	Protospacer
.  ***.** ********************

513. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagtgattcagactctgacagcgactctga	Protospacer
.  ***.** ********************

514. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
tagcgattcagactctgacagcgactctga	Protospacer
*  .**.** ********************

515. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
tagcgattcagactctgacagcgactctga	Protospacer
*  .**.** ********************

516. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
tagcgattcagactctgacagcgactctga	Protospacer
*  .**.** ********************

517. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
tagcgactctgactcagacagcgactcaga	Protospacer
*  .*********** *********** **

518. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
tagcgattcagactctgacagcgactctga	Protospacer
*  .**.** ********************

519. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
tagcgactctgattcagacagcgactctga	Protospacer
*  .********.** **************

520. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
tagcgattcagactctgacagcgactctga	Protospacer
*  .**.** ********************

521. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgactctgacagcgactctga	CRISPR spacer
tagcgactctgactcagacagcgactcaga	Protospacer
*  .*********** *********** **

522. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
*  .***** *****************.**

523. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
*  .***** *****************.**

524. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
*  .***** ***************** **

525. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
*  .***** ***************** **

526. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
*  .***** ***************** **

527. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
*  .***** ***************** **

528. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
*  .***** ***************** **

529. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
*  .***** ***************** **

530. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
*  .***** ***************** **

531. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
*  .***** *****************.**

532. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
*  .***** *****************.**

533. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
*  .***** *****************.**

534. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactccgattccgacagcgattcgga	Protospacer
*  .*****.***************** **

535. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgactccgacagcgattcgga	Protospacer
*  .********.************** **

536. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgactccgacagcgattcgga	Protospacer
*  .********.************** **

537. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgactccgacagcgattcgga	Protospacer
*  .********.************** **

538. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactccgattccgacagcgattctga	Protospacer
.  .*****.********************

539. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagtgactcggattccgacagcgactctga	Protospacer
.  ****** **************.*****

540. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagtgactcggattctgacagcgattctga	Protospacer
.  ****** *****.**************

541. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagtgactctgattcggacagcgattcgga	Protospacer
.  ************ *********** **

542. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagtgactcggattccgacagcgattccga	Protospacer
.  ****** *****************.**

543. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgactctga	Protospacer
*  .*********** ********.*****

544. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactccgattctgacagcgactctga	Protospacer
*  .*****.*****.**************

545. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactccgactccgacagcgactctga	Protospacer
*  .*****.**.*****************

546. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactcggattctgacagcgactctga	Protospacer
*  .***** *****.**************

547. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactccgattccgacagcgattctga	Protospacer
*  .*****.**************.*****

548. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactcagactccgacagcgactctga	Protospacer
*  .***** **.*****************

549. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactccgattctgacagcgactctga	Protospacer
*  .*****.*****.**************

550. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactcggattccgacagcgactcgga	Protospacer
*  .***** ***************** **

551. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactctgactccgacagcgactcgga	Protospacer
*  .********.************** **

552. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactccgattcggacagcgactctga	Protospacer
*  .*****.***** **************

553. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactccgattctgacagcgactctga	Protospacer
*  .*****.*****.**************

554. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactcggattccgacagcgactcgga	Protospacer
*  .***** ***************** **

555. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactcggattccgacagcgactcgga	Protospacer
*  .***** ***************** **

556. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactcggattccgacagcgactcgga	Protospacer
*  .***** ***************** **

557. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactcggattccgacagcgactcgga	Protospacer
*  .***** ***************** **

558. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactcggattccgacagcgactcgga	Protospacer
*  .***** ***************** **

559. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactcggattccgacagcgactcgga	Protospacer
*  .***** ***************** **

560. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactcggattccgacagcgactcgga	Protospacer
*  .***** ***************** **

561. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactcggattccgacagcgactcgga	Protospacer
*  .***** ***************** **

562. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactcggattccgacagcgactcgga	Protospacer
*  .***** ***************** **

563. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
tagcgactctgattcagacagcgactctga	Protospacer
.  .*********** **************

564. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactctgactcagacagcgactctga	Protospacer
*  .********.** **************

565. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactctgattcagatagcgactctga	Protospacer
*  .*********** **.***********

566. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactctgattcagatagcgactctga	Protospacer
*  .*********** **.***********

567. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactccgattctgacagcgactctga	Protospacer
*  .*****.*****.**************

568. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 5, identity: 0.833

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactcggattctgacagcgactctga	Protospacer
*  .***** *****.**************

569. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactccgattccgacagcgattctga	Protospacer
.  .*****.********************

570. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagtgactcggattccgacagcgactctga	Protospacer
.  ****** **************.*****

571. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagtgactcggattctgacagcgattctga	Protospacer
.  ****** *****.**************

572. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagtgactctgattcggacagcgattcgga	Protospacer
.  ************ *********** **

573. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagtgactcggattccgacagcgattccga	Protospacer
.  ****** *****************.**

574. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgactctga	Protospacer
*  .*********** ********.*****

575. spacer 2.74|1144207|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ctctgatagcgacagcgattccgacagcga	CRISPR spacer
ctcagatagcgacagcgattcagactcaga	Protospacer
*** ***************** ***   **

576. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgattcagatagcgactctga	Protospacer
*  .**************.*****.*****

577. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgactcagacagcgactctga	Protospacer
*  .********.***********.*****

578. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgattcagatagcgactctga	Protospacer
*  .**************.*****.*****

579. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ttctgactctgattcagacagcgattctga	CRISPR spacer
ttcagactctgattcagatagcgacagtga	Protospacer
*** **************.*****.  ***

580. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.833

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagtgactctgattcggacagcgattcgga	Protospacer
.  ************.*********** **

581. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.833

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagtgactcggattctgacagcgattctga	Protospacer
.  ****** ***** **************

582. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
ctcggacagcgactcggactctgactccga	Protospacer
.   *********** ********.*****

583. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
ctcggacagcgactctgactccgattcgga	Protospacer
.   *****************.***** **

584. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
ctccgacagcgactctgactctgacagcga	Protospacer
.  *********************.  ***

585. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
ttccgacagcgactctgactcggacagcga	Protospacer
*  ****************** **.  ***

586. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
ttccgacagcgattctgactctgacagcga	Protospacer
*  *********.***********.  ***

587. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
ttccgacagtgactctgactctgacagcga	Protospacer
*  ******.**************.  ***

588. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgatagcgactctgactcagacagcga	Protospacer
.*****.************** **.  ***

589. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgatagcgactctgactcagacagcga	Protospacer
.*****.************** **.  ***

590. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgatagcgactctgactcagacagcga	Protospacer
.*****.************** **.  ***

591. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgatagcgactctgactcagacagcga	Protospacer
.*****.************** **.  ***

592. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcagacagcga	Protospacer
.*****************.** **.  ***

593. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgatagcgactctgactcagacagcga	Protospacer
.*****.************** **.  ***

594. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgatagcgactctgactcagacagcga	Protospacer
.*****.************** **.  ***

595. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgatagcgactctgactcagacagcga	Protospacer
.*****.************** **.  ***

596. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgatagcgactctgactcagacagcga	Protospacer
.*****.************** **.  ***

597. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgacagcgactctgattcagacagcga	Protospacer
.*****************.** **.  ***

598. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgatagcgactctgactcagacagcga	Protospacer
.*****.************** **.  ***

599. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgatagcgactctgactcagacagcga	Protospacer
.*****.************** **.  ***

600. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgatagcgactctgactcagacagcga	Protospacer
.*****.************** **.  ***

601. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
cagcgatagcgactctgactcagacagcga	Protospacer
.*****.************** **.  ***

602. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
tagcgacagcgattcggactctgacagtga	Protospacer
************.** ********.  .**

603. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
tagcgacagcgattcggactctgacagtga	Protospacer
************.** ********.  .**

604. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
ttccgacagcgactcggactctgacagcga	Protospacer
*  ************ ********.  ***

605. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
ttccgacagcgactcggactctgacagcga	Protospacer
*  ************ ********.  ***

606. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

tagcgacagcgactctgactctgattccga	CRISPR spacer
ttccgacagcgactcggactctgacagcga	Protospacer
*  ************ ********.  ***

607. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgattctgactctgattccga	CRISPR spacer
cagcgacagcgattcagactcagataaaga	Protospacer
.************** ***** ***   **

608. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgattctgactctgattccga	CRISPR spacer
cagcgatagcgattcagactctgacagcga	Protospacer
.*****.******** ********.  ***

609. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgattctgactctgattccga	CRISPR spacer
cagcgatagcgattcagactctgacagcga	Protospacer
.*****.******** ********.  ***

610. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgattctgactctgattccga	CRISPR spacer
cagcgatagcgattcagactctgacagcga	Protospacer
.*****.******** ********.  ***

611. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgattctgactctgattccga	CRISPR spacer
cagcgatagcgattcagactctgacagcga	Protospacer
.*****.******** ********.  ***

612. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgattctgactctgattccga	CRISPR spacer
cagcgatagcgattcagactctgacagcga	Protospacer
.*****.******** ********.  ***

613. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgacagcgattctgactctgattccga	CRISPR spacer
cagcgacagcgattcagactcagacagcga	Protospacer
.************** ***** **.  ***

614. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

tagcgacagcgattctgactctgattccga	CRISPR spacer
cagcgacagtgattcggactctgacagcga	Protospacer
.********.***** ********.  ***

615. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

tagcgacagcgattctgactctgattccga	CRISPR spacer
tagcgacagcgattctgacgccgacagtga	Protospacer
******************* *.**.  .**

616. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

tagcgacagcgattctgactctgattccga	CRISPR spacer
tagcgacagcgactcggactctgacagtga	Protospacer
************.** ********.  .**

617. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

tagcgacagcgattctgactctgattccga	CRISPR spacer
ttccgacagcgattccgactctgacagcga	Protospacer
*  ************.********.  ***

618. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

tagcgacagcgattctgactctgattccga	CRISPR spacer
ttccgacagcgattccgactctgacagcga	Protospacer
*  ************.********.  ***

619. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

tagcgacagcgattctgactctgattccga	CRISPR spacer
ttccgacagcgattcggactctgacagcga	Protospacer
*  ************ ********.  ***

620. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ctcggacagcgactctgactccgattcgga	Protospacer
.** *****************.***   **

621. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ctccgacagcgactcggattctgactccga	Protospacer
.************** **.*****.  ***

622. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ctcggacagcgactcggactctgactccga	Protospacer
.** *********** ********.  ***

623. spacer 2.50|1142833|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

cagcgactctgactctgattccgacagcga	CRISPR spacer
ttctgactccgactctgattccgacagtga	Protospacer
.  .*****.*****************.**

624. spacer 2.51|1142881|30|NZ_CP044455|CRT matches to NZ_CP010312 (Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence) position: , mismatch: 6, identity: 0.8

cagcgattctgactctgattccgacagcga	CRISPR spacer
cgataattctgagtctaattccgacagcga	Protospacer
*....******* ***.*************

625. spacer 2.53|1143001|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

cagcgactctgactctgattccgacagcga	CRISPR spacer
ttctgactccgactctgattccgacagtga	Protospacer
.  .*****.*****************.**

626. spacer 2.54|1143049|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

cagcgactctgactctgattccgacagcga	CRISPR spacer
ttctgactccgactctgattccgacagtga	Protospacer
.  .*****.*****************.**

627. spacer 2.55|1143097|30|NZ_CP044455|CRT matches to NZ_CP010312 (Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence) position: , mismatch: 6, identity: 0.8

cagcgattctgactctgattccgacagcga	CRISPR spacer
cgataattctgagtctaattccgacagcga	Protospacer
*....******* ***.*************

628. spacer 2.58|1143271|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgatagcgacagcgactctga	CRISPR spacer
cagcgactcggatagcgacagcgactcgga	Protospacer
.  .***** ***************** **

629. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggactctgacagcgactcgga	Protospacer
.  .***** ***************** **

630. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggactctgacagcgactcgga	Protospacer
.  .***** ***************** **

631. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggactctgacagcgactcgga	Protospacer
.  .***** ***************** **

632. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggactctgacagcgactcgga	Protospacer
.  .***** ***************** **

633. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggactctgacagcgactccga	Protospacer
.  .***** *****************.**

634. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggactctgacagcgactcgga	Protospacer
.  .***** ***************** **

635. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggactctgacagcgactcgga	Protospacer
.  .***** ***************** **

636. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggactctgacagcgactcgga	Protospacer
.  .***** ***************** **

637. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggactctgacagcgactcgga	Protospacer
.  .***** ***************** **

638. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggactctgacagcgactccga	Protospacer
.  .***** *****************.**

639. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggactctgacagcgactcgga	Protospacer
.  .***** ***************** **

640. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactccgattctgacagcgactctga	Protospacer
.  .*****.**.*****************

641. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggactctgacagcgactcgga	Protospacer
.  .***** ***************** **

642. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactccgactccgacagcgactctga	Protospacer
.  .*****.*****.**************

643. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactctgactcggacagcgactcgga	Protospacer
.  .*********** *********** **

644. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactctgactcggacagcgactcgga	Protospacer
.  .*********** *********** **

645. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggattctgacagcgactctga	Protospacer
.  .***** **.*****************

646. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactctgactctgacagcgacagtga	Protospacer
.  .*********************  ***

647. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcagactccgacagcgactctga	Protospacer
.  .***** *****.**************

648. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactccgattctgacagcgactctga	Protospacer
.  .*****.**.*****************

649. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactctgactccgacagcgactcgga	Protospacer
.  .***********.*********** **

650. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactctgactctgacagcgattcgga	Protospacer
.  .********************.** **

651. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggactctgacagcgactccga	Protospacer
.  .***** *****************.**

652. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactccgattctgacagcgactctga	Protospacer
.  .*****.**.*****************

653. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactccgactcggacagcgactctga	Protospacer
.  .*****.***** **************

654. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgattctgactctgacagcgactccga	Protospacer
.  .**.********************.**

655. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactctgactcggacagcgactccga	Protospacer
.  .*********** ***********.**

656. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcagactcagacagcgactctga	Protospacer
.  .***** ***** **************

657. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** *********** *********  .**

658. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** *********** *********  .**

659. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** *********** *********  .**

660. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** *********** *********  .**

661. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** *********** *********  .**

662. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** *********** *********  .**

663. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** *********** *********  .**

664. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** *********** *********  .**

665. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** *********** *********  .**

666. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** *********** *********  .**

667. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactccgattctgacagcgactctga	Protospacer
.  .*****.**.*****************

668. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactctgactctgacagcgattcgga	Protospacer
.  .********************.** **

669. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactcggattctgacagcgactctga	Protospacer
.  .***** **.*****************

670. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ctctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgactctga	Protospacer
.  .*********** ********.*****

671. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgactccgacagcgattcgga	Protospacer
.  .********.************** **

672. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgactccgacagcgattcgga	Protospacer
.  .********.************** **

673. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgactccgacagcgattcgga	Protospacer
.  .********.************** **

674. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
.  .***** *****************.**

675. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
.  .***** *****************.**

676. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

677. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

678. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

679. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

680. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

681. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

682. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

683. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
.  .***** *****************.**

684. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
.  .***** *****************.**

685. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
.  .***** *****************.**

686. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactccgattccgacagcgattcgga	Protospacer
.  .*****.***************** **

687. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP010312 (Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
ttctgagtctaattccgacagcgaaaacga	Protospacer
****** ***.*************   .**

688. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ctctgactctgattccgacagcgactctga	CRISPR spacer
tagcgactctgattcagatagcgactctga	Protospacer
.  .*********** **.***********

689. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ctctgactctgattccgacagcgactctga	CRISPR spacer
tagcgactctgactcagacagcgactctga	Protospacer
.  .********.** **************

690. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ctctgactctgattccgacagcgactctga	CRISPR spacer
tagcgactctgattcagatagcgactctga	Protospacer
.  .*********** **.***********

691. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgactccgacagcgattcgga	Protospacer
.  .********.************** **

692. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgactccgacagcgattcgga	Protospacer
.  .********.************** **

693. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgactccgacagcgattcgga	Protospacer
.  .********.************** **

694. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
.  .***** *****************.**

695. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
.  .***** *****************.**

696. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

697. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

698. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

699. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

700. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

701. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

702. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattcgga	Protospacer
.  .***** ***************** **

703. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
.  .***** *****************.**

704. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
.  .***** *****************.**

705. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactcggattccgacagcgattccga	Protospacer
.  .***** *****************.**

706. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactccgattccgacagcgattcgga	Protospacer
.  .*****.***************** **

707. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP010312 (Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgattccgacagcgattctga	CRISPR spacer
ttctgagtctaattccgacagcgaaaacga	Protospacer
****** ***.*************   .**

708. spacer 2.74|1144207|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ctctgatagcgacagcgattccgacagcga	CRISPR spacer
ttcagatagcgacagcgattcagactctga	Protospacer
.** ***************** ***  .**

709. spacer 2.74|1144207|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ctctgatagcgacagcgattccgacagcga	CRISPR spacer
ttcggatagcgacagcgattcggactctga	Protospacer
.** ***************** ***  .**

710. spacer 2.74|1144207|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ctctgatagcgacagcgattccgacagcga	CRISPR spacer
ttcggatagcgacagcgattcggactctga	Protospacer
.** ***************** ***  .**

711. spacer 2.74|1144207|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.8

ctctgatagcgacagcgattccgacagcga	CRISPR spacer
ttcggatagcgacagcgattcggactctga	Protospacer
.** ***************** ***  .**

712. spacer 2.74|1144207|30|NZ_CP044455|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 6, identity: 0.8

ctctgatagcgacagcgattccgacagcga	CRISPR spacer
caccctgagcgacagcgagtccgacagcga	Protospacer
* *.   *********** ***********

713. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgactcagacagcgactctga	Protospacer
.  .********.***********.*****

714. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagatagcgactctga	Protospacer
.  .**************.*****.*****

715. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagatagcgactctga	Protospacer
.  .**************.*****.*****

716. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********************  .**

717. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********************  .**

718. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********************  .**

719. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********************  .**

720. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********************  .**

721. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********************  .**

722. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.8

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactccgattccgacagcgattctga	Protospacer
.  .*****.***** **************

723. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 6, identity: 0.8

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactcagattcagacagcgattcaga	Protospacer
.  .***** ***************** **

724. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.767

tagcgacagcgactctgactctgattccga	CRISPR spacer
ctccgacagcgactcggactctgacagcga	Protospacer
.  ************ ********.  ***

725. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.767

tagcgacagcgactctgactctgattccga	CRISPR spacer
ctccgacagcgactctgactcggacagcga	Protospacer
.  ****************** **.  ***

726. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.767

tagcgacagcgactctgactctgattccga	CRISPR spacer
ctccgacagcgactctgactcggacagcga	Protospacer
.  ****************** **.  ***

727. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.767

tagcgacagcgactctgactctgattccga	CRISPR spacer
ttccgacagcgactcggactctgacagtga	Protospacer
*  ************ ********.  .**

728. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.767

tagcgacagcgactctgactctgattccga	CRISPR spacer
ctccgacagcgactcggactctgacagcga	Protospacer
.  ************ ********.  ***

729. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.767

tagcgacagcgactctgactctgattccga	CRISPR spacer
ctccgacagcgactctgactcggacagcga	Protospacer
.  ****************** **.  ***

730. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.767

tagcgacagcgactctgactctgattccga	CRISPR spacer
ttccgacagcgactcggactctgacagtga	Protospacer
*  ************ ********.  .**

731. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.767

tagcgacagcgactctgactctgattccga	CRISPR spacer
ctccgacagtgactctgactctgacagcga	Protospacer
.  ******.**************.  ***

732. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.767

tagcgacagcgattctgactctgattccga	CRISPR spacer
ctccgacagcgactctgactctgacagcga	Protospacer
.  *********.***********.  ***

733. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 7, identity: 0.767

tagcgacagcgattctgactctgattccga	CRISPR spacer
ttcagacagcgattctgaatctgataaaga	Protospacer
*   ************** ******   **

734. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tagcgacagcgattctgactctgattccga	CRISPR spacer
ttcagacagcgattctgaatctgataaaga	Protospacer
*   ************** ******   **

735. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 7, identity: 0.767

tagcgacagcgattctgactctgattccga	CRISPR spacer
ttcagacagcgattctgaatctgataaaga	Protospacer
*   ************** ******   **

736. spacer 2.36|1141927|30|NZ_CP044455|CRT matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 7, identity: 0.767

ttccgacagcgactctgactctgatagcga	CRISPR spacer
ttccgaccgcgactctcactctgcggtcca	Protospacer
******* ******** ******  . * *

737. spacer 2.50|1142833|30|NZ_CP044455|CRT matches to NZ_CP010312 (Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence) position: , mismatch: 7, identity: 0.767

cagcgactctgactctgattccgacagcga	CRISPR spacer
cgataattctgagtctaattccgacagcga	Protospacer
*....*.***** ***.*************

738. spacer 2.51|1142881|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.767

cagcgattctgactctgattccgacagcga	CRISPR spacer
ctctgacagtgactcggattccgacagcga	Protospacer
*  .**.  ****** **************

739. spacer 2.51|1142881|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.767

cagcgattctgactctgattccgacagcga	CRISPR spacer
ctctgacagtgactctgattcggacagcga	Protospacer
*  .**.  ************ ********

740. spacer 2.51|1142881|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.767

cagcgattctgactctgattccgacagcga	CRISPR spacer
ttccgacagtgactcggattccgacagcga	Protospacer
.  ***.  ****** **************

741. spacer 2.51|1142881|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.767

cagcgattctgactctgattccgacagcga	CRISPR spacer
ctctgacagtgactcggattccgacagcga	Protospacer
*  .**.  ****** **************

742. spacer 2.53|1143001|30|NZ_CP044455|CRT matches to NZ_CP010312 (Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence) position: , mismatch: 7, identity: 0.767

cagcgactctgactctgattccgacagcga	CRISPR spacer
cgataattctgagtctaattccgacagcga	Protospacer
*....*.***** ***.*************

743. spacer 2.54|1143049|30|NZ_CP044455|CRT matches to NZ_CP010312 (Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence) position: , mismatch: 7, identity: 0.767

cagcgactctgactctgattccgacagcga	CRISPR spacer
cgataattctgagtctaattccgacagcga	Protospacer
*....*.***** ***.*************

744. spacer 2.55|1143097|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.767

cagcgattctgactctgattccgacagcga	CRISPR spacer
ctctgacagtgactcggattccgacagcga	Protospacer
*  .**.  ****** **************

745. spacer 2.55|1143097|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.767

cagcgattctgactctgattccgacagcga	CRISPR spacer
ctctgacagtgactctgattcggacagcga	Protospacer
*  .**.  ************ ********

746. spacer 2.55|1143097|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.767

cagcgattctgactctgattccgacagcga	CRISPR spacer
ttccgacagtgactcggattccgacagcga	Protospacer
.  ***.  ****** **************

747. spacer 2.55|1143097|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.767

cagcgattctgactctgattccgacagcga	CRISPR spacer
ctctgacagtgactcggattccgacagcga	Protospacer
*  .**.  ****** **************

748. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgactctgacagcgactctga	CRISPR spacer
tagcgactctgactcagacagcgacagcga	Protospacer
*  .*********** *********  .**

749. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgactctgacagcgactctga	CRISPR spacer
tagcgactctgactcagacagcgacagcga	Protospacer
*  .*********** *********  .**

750. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP044307 (Escherichia coli strain C27A plasmid pC27A-2, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgactctgacagcgactctga	CRISPR spacer
ttctgactctgactctggctgcgtatcctc	Protospacer
*****************.* ***  **.

751. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP039853 (Salinimonas sp. KX18D6 plasmid plas12, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgactctgacagcgactctga	CRISPR spacer
ttcagactttgactctgacagcgttcttgt	Protospacer
*** ****.************** ...**

752. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

753. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

754. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

755. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

756. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
*  .***********.*********  .**

757. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

758. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

759. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

760. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

761. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
*  .***********.*********  .**

762. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

763. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
*  .***********.*********  .**

764. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

765. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

766. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

767. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
*  .***********.*********  .**

768. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

769. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

770. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
*  .***********.*********  .**

771. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

772. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

773. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

774. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgactccgacagcgattcg--	Protospacer
*  .********.**************

775. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP010312 (Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgattctga	CRISPR spacer
ttctgagtctaattccgacagcgaaaacga	Protospacer
.***** ***.*************   .**

776. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

777. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

778. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

779. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

780. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

781. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

782. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactctgattcagacagcgacagcga	Protospacer
*  .*********** *********  .**

783. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactctgattcagacagcgacagcga	Protospacer
*  .*********** *********  .**

784. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactctgattcagacagcgacagcga	Protospacer
*  .*********** *********  .**

785. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to NZ_CP010312 (Geoalkalibacter subterraneus strain Red1 plasmid pGSUB1, complete sequence) position: , mismatch: 7, identity: 0.767

ctctgactctgattccgacagcgactctga	CRISPR spacer
ttctgagtctaattccgacagcgaaaacga	Protospacer
.***** ***.*************   .**

786. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

787. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

788. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

789. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

790. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

791. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
*  .*********** *********  .**

792. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

793. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

794. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

795. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

796. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

797. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

798. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

799. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

800. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

801. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

802. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

803. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

804. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

805. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

806. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

807. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

808. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********************  .**

809. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** ********.***********.  .**

810. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** ********.***********.  .**

811. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** ********.***********.  .**

812. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgactcagacagcgatagcga	Protospacer
*  .********.************  .**

813. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgactcagacagcgatagcga	Protospacer
*  .********.************  .**

814. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** ********.***********.  .**

815. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** ********.***********.  .**

816. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** ********.***********.  .**

817. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** ********.***********.  .**

818. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgactcagacagcgatagcga	Protospacer
*  .********.************  .**

819. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgactcagacagcgatagcga	Protospacer
*  .********.************  .**

820. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgactcagacagcgatagcga	Protospacer
*  .********.************  .**

821. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgactcagacagcgatagcga	Protospacer
*  .********.************  .**

822. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** ********.***********.  .**

823. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgactcagacagcgatagcga	Protospacer
*  .********.************  .**

824. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** ********.***********.  .**

825. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgactcagacagcgatagcga	Protospacer
*  .********.************  .**

826. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
tagcgactctgactcagacagcgatagcga	Protospacer
*  .********.************  .**

827. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ttctgactctgattcagacagcgattctga	CRISPR spacer
ctcagactctgactcagacagcgacagcga	Protospacer
.** ********.***********.  .**

828. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.733

tagcgacagcgactctgactctgattccga	CRISPR spacer
ctccgacagcgactcggactctgacagtga	Protospacer
.  ************ ********.  .**

829. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.733

tagcgacagcgattctgactctgattccga	CRISPR spacer
ctcggacagcgattcggactctgatagtga	Protospacer
.   *********** *********  .**

830. spacer 2.30|1141615|30|NZ_CP044455|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.733

tagcgacagcgattctgactctgattccga	CRISPR spacer
ctccgacagcgattccgactctgacagtga	Protospacer
.  ************.********.  .**

831. spacer 2.51|1142881|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.733

cagcgattctgactctgattccgacagcga	CRISPR spacer
ttctgacagtgactcggattccgacagcga	Protospacer
.  .**.  ****** **************

832. spacer 2.55|1143097|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.733

cagcgattctgactctgattccgacagcga	CRISPR spacer
ttctgacagtgactcggattccgacagcga	Protospacer
.  .**.  ****** **************

833. spacer 2.56|1143145|36|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.778

cagcgactctgatagcgacagcgattccgacagcga	CRISPR spacer
ctcagactcagatagcgacagcgattcagactcaga	Protospacer
*   ***** ***************** ***   **

834. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactctgactcagacagcgacagcga	Protospacer
.  .*********** *********  .**

835. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ctctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

836. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ctctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

837. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ctctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

838. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ctctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

839. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ctctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

840. spacer 2.65|1143715|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ctctgactctgattccgacagcgattctga	CRISPR spacer
tagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

841. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

842. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

843. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

844. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

845. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .***********.*********  .**

846. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

847. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

848. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

849. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

850. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .***********.*********  .**

851. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

852. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .***********.*********  .**

853. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

854. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

855. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

856. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .***********.*********  .**

857. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

858. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

859. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .***********.*********  .**

860. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

861. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

862. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

863. spacer 2.66|1143763|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgactccgacagcgattcg--	Protospacer
.  .********.**************

864. spacer 2.69|1143955|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 8, identity: 0.733

ctctgactctgattccgacagcgactctga	CRISPR spacer
cagcgactctgactccgacagcgattcg--	Protospacer
*  .********.***********.**

865. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

866. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

867. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

868. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

869. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .***********.*********  .**

870. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

871. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

872. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

873. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

874. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .***********.*********  .**

875. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

876. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .***********.*********  .**

877. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

878. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

879. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

880. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .***********.*********  .**

881. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

882. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

883. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .***********.*********  .**

884. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

885. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

886. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgattcagacagcgatagcga	Protospacer
.  .*********** *********  .**

887. spacer 2.73|1144159|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattccgacagcgattctga	CRISPR spacer
cagcgactctgactccgacagcgattcg--	Protospacer
.  .********.**************

888. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgactcagacagcgatagcga	Protospacer
.  .********.************  .**

889. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .*********** *********  .**

890. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .*********** *********  .**

891. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .*********** *********  .**

892. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .*********** *********  .**

893. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgattctgacagcgatagcga	Protospacer
.  .*********** *********  .**

894. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to LC589952 (Enterobacter phage vB_EkoM5VN DNA, complete genome) position: , mismatch: 8, identity: 0.733

ttctgactctgattcagacagcgattctga	CRISPR spacer
atgagcgcatgattcagaaagcgattctga	Protospacer
 *  *  . ********* ***********

895. spacer 2.28|1141531|30|NZ_CP044455|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.7

tagcgacagcgactctgactctgattccga	CRISPR spacer
ctccgacagcgactcggactctgacagtgg	Protospacer
.  ************ ********.  .*.

896. spacer 2.64|1143667|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 9, identity: 0.7

ttctgactctgactctgacagcgactctga	CRISPR spacer
cagcgactctgactccgacagcgattcg--	Protospacer
.  .***********.********.**

897. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 9, identity: 0.7

ttctgactctgattcagacagcgattctga	CRISPR spacer
cagcgactctgactccgacagcgattcg--	Protospacer
.  .********.** ***********

898. spacer 2.78|1144453|30|NZ_CP044455|CRT matches to MH823906 (Citrobacter phage Maroon, complete genome) position: , mismatch: 9, identity: 0.7

ttctgactctgattcagacagcgattctga	CRISPR spacer
atgaacgcatgattcagaaagcgattctga	Protospacer
 *  .  . ********* ***********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8431 : 45278

Helicobacter_phage(22.22%)

tRNA,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163145339.1\|8431_9031_+\|transposase	IS607 family transposase	Q331V0	Clostridium_botulinum_C_phage	7.1e-60	56.5
WP_159153749.1\|9034_10417_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	NA	NA	NA	NA
WP_004911237.1\|10527_11733_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.1e-87	80.3
WP_163145340.1\|11815_13753_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.8e-64	30.8
WP_163145341.1\|13985_14642_+	RND transporter	NA	NA	NA	NA
WP_171294843.1\|14672_15122_-\|transposase	IS200/IS605 family transposase	A0A1S5RHE3	Helicobacter_phage	2.1e-32	50.0
WP_163145342.1\|15194_16586_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A2I7RKG5	Vibrio_phage	1.2e-06	22.9
WP_104472697.1\|17244_18255_+	RND transporter	NA	NA	NA	NA
WP_171065126.1\|18599_19568_+	hypothetical protein	NA	NA	NA	NA
WP_005181144.1\|19690_20026_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	1.2e-24	51.5
WP_005181147.1\|20099_21227_-	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_005181149.1\|21290_22523_+\|tRNA	tyrosine--tRNA ligase	NA	NA	NA	NA
WP_163145343.1\|23014_23287_+	hypothetical protein	NA	NA	NA	NA
WP_163145344.1\|23394_25299_+	5'-nucleotidase C-terminal domain-containing protein	NA	NA	NA	NA
WP_016658670.1\|31513_32863_+	aromatic acid/H+ symport family MFS transporter	NA	NA	NA	NA
WP_035363502.1\|33047_33917_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_163145345.1\|34213_35380_+	PQQ-dependent sugar dehydrogenase	NA	NA	NA	NA
WP_163145346.1\|35883_36426_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_005181033.1\|36564_37047_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_005181030.1\|37039_37579_-	signal peptidase II	NA	NA	NA	NA
WP_163145347.1\|37571_40418_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.5e-78	27.1
WP_163140771.1\|40479_41484_-	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
WP_162182856.1\|41779_42349_+	5'-nucleosidase	NA	NA	NA	NA
WP_005181018.1\|42392_43046_-	TetR family transcriptional regulator C-terminal domain-containing protein	NA	NA	NA	NA
WP_016659040.1\|43509_44667_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A7P9	Microcystis_virus	2.7e-55	36.9
WP_152342396.1\|44663_45278_-\|transposase	IS607 family transposase	A0A1S5RGS9	Helicobacter_phage	3.5e-62	62.7

DBSCAN-SWA_2

253143 : 311393

Paenibacillus_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152342556.1\|253143_254448_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_127800954.1\|254489_257066_-	penicillin-binding protein PBP1a	NA	NA	NA	NA
WP_099046172.1\|257202_257954_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.5e-22	41.2
WP_160232596.1\|258091_259114_+	type IV pilus assembly protein PilM	NA	NA	NA	NA
WP_005180516.1\|259113_259749_+	PilN domain-containing protein	NA	NA	NA	NA
WP_127800755.1\|259745_260465_+	type 4a pilus biogenesis protein PilO	NA	NA	NA	NA
WP_045795346.1\|260464_260992_+	pilus assembly protein PilP	NA	NA	NA	NA
WP_171499848.1\|261052_263188_+	type IV pilus secretin PilQ family protein	NA	NA	NA	NA
WP_075167858.1\|263224_263767_+	shikimate kinase AroK	NA	NA	NA	NA
WP_127800753.1\|263789_264872_+	3-dehydroquinate synthase	NA	NA	NA	NA
WP_127800751.1\|264884_265721_+	hypothetical protein	NA	NA	NA	NA
WP_127800749.1\|266159_270635_+	glutamate synthase large subunit	NA	NA	NA	NA
WP_104483916.1\|270708_272130_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_005180484.1\|273421_274012_+	LemA family protein	NA	NA	NA	NA
WP_127800747.1\|274038_275103_+	TPM domain-containing protein	NA	NA	NA	NA
WP_127800745.1\|275096_275657_+	TPM domain-containing protein	NA	NA	NA	NA
WP_127800743.1\|275918_276434_-	pilin	NA	NA	NA	NA
WP_152342555.1\|276509_277260_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.3e-22	41.2
WP_127800795.1\|277590_279231_+	O-antigen ligase family protein	NA	NA	NA	NA
WP_005180468.1\|279342_279807_-	bacterioferritin	NA	NA	NA	NA
WP_171065121.1\|280033_280216_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_005180461.1\|280382_280766_-	RidA family protein	NA	NA	NA	NA
WP_075174935.1\|280837_282937_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	J9Q7H7	Salmonella_phage	2.4e-09	37.2
WP_004809957.1\|283160_283442_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_045795273.1\|283518_284142_-	guanylate kinase	A0A240FAU9	Liberibacter_phage	4.7e-14	32.9
WP_127800797.1\|284277_285228_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_004809941.1\|287342_287600_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_127800499.1\|287628_288177_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_127800497.1\|288203_288944_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_003792460.1\|289150_289525_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_127800495.1\|290451_291426_-	triacylglycerol lipase	NA	NA	NA	NA
WP_127800493.1\|291513_292500_-	triacylglycerol lipase	NA	NA	NA	NA
WP_005180409.1\|292911_293940_-	lipase secretion chaperone	NA	NA	NA	NA
WP_127801824.1\|294372_295341_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_099046172.1\|296336_297088_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.5e-22	41.2
WP_127800907.1\|297331_298237_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_104473447.1\|298273_299041_+	TSUP family transporter	NA	NA	NA	NA
WP_075168265.1\|299200_299659_+	hemerythrin domain-containing protein	NA	NA	NA	NA
WP_034598244.1\|299728_300601_-	EamA family transporter	NA	NA	NA	NA
WP_005180400.1\|300747_301623_-	EamA family transporter	NA	NA	NA	NA
WP_005180397.1\|301859_303092_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	4.5e-101	47.1
WP_127800910.1\|303218_303425_+	hypothetical protein	NA	NA	NA	NA
WP_045795292.1\|303446_304856_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_016658494.1\|305008_305380_+	hypothetical protein	NA	NA	NA	NA
WP_127801601.1\|305611_306841_+	MFS transporter	S4TR35	Salmonella_phage	1.2e-13	23.7
WP_045795347.1\|306955_307255_-	DUF3817 domain-containing protein	NA	NA	NA	NA
WP_104471529.1\|307541_308087_-	superoxide dismutase family protein	Q9MC02	Salmonella_phage	5.3e-38	54.5
WP_163143403.1\|308192_309320_-	AI-2E family transporter	NA	NA	NA	NA
WP_005180385.1\|309456_310101_-	ParA family protein	NA	NA	NA	NA
WP_127800916.1\|310220_310688_+	endonuclease	NA	NA	NA	NA
WP_171457094.1\|310985_311393_-\|transposase	IS200/IS605 family transposase	A0A1S5RHE3	Helicobacter_phage	3.7e-28	48.8

DBSCAN-SWA_3

393586 : 458526

Tupanvirus(10.0%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016659040.1\|393586_394744_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A7P9	Microcystis_virus	2.7e-55	36.9
WP_075167936.1\|394740_395355_-\|transposase	IS607 family transposase	A0A1S5RGS9	Helicobacter_phage	2.7e-62	63.2
WP_163145412.1\|395400_396432_-	DUF4105 domain-containing protein	NA	NA	NA	NA
WP_127800203.1\|396461_396974_-	dihydrofolate reductase	A0A1B2IBQ4	Erwinia_phage	2.4e-24	44.1
WP_005180203.1\|397074_397917_-	thymidylate synthase	A6M9A2	Geobacillus_virus	2.1e-97	60.7
WP_075167417.1\|398118_398610_-	lipocalin family protein	A0A2I2L3Y4	Orpheovirus	1.1e-13	32.1
WP_104503620.1\|398794_399169_-	hypothetical protein	NA	NA	NA	NA
WP_127800199.1\|399169_399547_-	hypothetical protein	NA	NA	NA	NA
WP_016658551.1\|399630_400440_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_163146296.1\|400534_401317_+	NRDE family protein	A0A0M3ZEJ9	Turkeypox_virus	1.8e-18	27.6
WP_104505419.1\|401375_403622_-	PhoX family phosphatase	NA	NA	NA	NA
WP_005180188.1\|403802_404585_-	twin-arginine translocase subunit TatC	NA	NA	NA	NA
WP_104489799.1\|404581_405028_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_005180185.1\|405047_405272_-	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
WP_163145413.1\|405432_406314_+	permease	NA	NA	NA	NA
WP_016658557.1\|406546_407173_-	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	A0A0P0A2M4	Ugandan_cassava_brown_streak_virus	6.1e-14	33.2
WP_171260924.1\|407278_407821_-	sel1 repeat family protein	NA	NA	NA	NA
WP_005180178.1\|407865_408459_-	methionine biosynthesis protein MetW	NA	NA	NA	NA
WP_163145414.1\|408458_409619_-	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_005180175.1\|409703_411401_-	2-isopropylmalate synthase	NA	NA	NA	NA
WP_171524622.1\|411656_412766_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_005180172.1\|412765_413449_-	Fe2+-dependent dioxygenase	A0A127KM56	Cyanophage	7.4e-21	32.0
WP_163145416.1\|413556_415791_-	catecholate siderophore receptor Fiu	NA	NA	NA	NA
WP_163145417.1\|416112_418251_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	8.3e-10	31.0
WP_075167430.1\|418496_419828_+	trigger factor	NA	NA	NA	NA
WP_152342556.1\|419934_421239_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_005180162.1\|421421_422027_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.2e-62	61.0
WP_127800438.1\|422054_423365_+\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.4e-129	54.7
WP_005180158.1\|423534_424248_+	DUF2846 domain-containing protein	NA	NA	NA	NA
WP_163145418.1\|424318_425845_-	fumarate hydratase	NA	NA	NA	NA
WP_143217961.1\|426341_426719_-	hypothetical protein	NA	NA	NA	NA
WP_099046172.1\|426750_427502_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.5e-22	41.2
WP_163145419.1\|427551_428418_-	hypothetical protein	NA	NA	NA	NA
WP_075167434.1\|428423_428897_-	hypothetical protein	NA	NA	NA	NA
WP_163145420.1\|429094_431233_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_005180151.1\|431283_432504_-	acetate kinase	NA	NA	NA	NA
WP_005180148.1\|432818_433223_-	hypothetical protein	NA	NA	NA	NA
WP_016658571.1\|433338_434604_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.8e-98	48.4
WP_005180145.1\|434911_436234_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_163145421.1\|436308_437163_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_016658574.1\|437257_438280_-	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	4.4e-09	38.5
WP_075167440.1\|438475_440668_+	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	2.1e-186	50.1
WP_163145422.1\|440947_443008_+	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	6.7e-17	33.3
WP_163145423.1\|445660_447250_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	2.1e-10	31.9
WP_163145424.1\|447329_448154_+	hypothetical protein	NA	NA	NA	NA
WP_163145425.1\|448210_449185_+	DUF3298 domain-containing protein	NA	NA	NA	NA
WP_163145426.1\|449184_450003_+	TatD family hydrolase	NA	NA	NA	NA
WP_075167522.1\|450110_450884_+\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	A0A291ATS8	Pandoravirus	6.8e-23	34.9
WP_163145427.1\|450941_451964_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_163146297.1\|452510_452942_+	hypothetical protein	NA	NA	NA	NA
WP_163145428.1\|453060_455187_-	catalase HPII	A0A2K9L572	Tupanvirus	2.1e-138	46.3
WP_127801927.1\|455205_456621_-	hypothetical protein	NA	NA	NA	NA
WP_163145429.1\|456857_457325_+	nicotinamide-nucleotide amidohydrolase family protein	A0A218MNG4	uncultured_virus	1.6e-38	50.6
WP_127801807.1\|457464_458526_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_4

997220 : 1049451

Acinetobacter_phage(63.41%)

head,holin,transposase,integrase,terminase,coat

attL 998398:998414|attR 1049630:1049646

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005179107.1\|997220_998156_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.4e-22	33.2
998398:998414	attL	NA	NA	NA	NA
WP_045795619.1\|998494_998761_-	hypothetical protein	A0A1B1P9G0	Acinetobacter_phage	3.4e-22	56.8
WP_163145608.1\|998757_999072_-	hypothetical protein	NA	NA	NA	NA
WP_163145609.1\|999064_999301_-	hypothetical protein	NA	NA	NA	NA
WP_163145610.1\|999293_999539_-	hypothetical protein	NA	NA	NA	NA
WP_163145611.1\|999538_999883_-	hypothetical protein	NA	NA	NA	NA
WP_163145612.1\|999882_1000209_-	hypothetical protein	NA	NA	NA	NA
WP_163145613.1\|1000208_1000523_-	hypothetical protein	NA	NA	NA	NA
WP_163145614.1\|1000519_1001137_-	YqaJ viral recombinase family protein	A0A2H4J882	uncultured_Caudovirales_phage	1.1e-84	73.2
WP_163145615.1\|1001117_1001966_-	phage recombination protein Bet	B5AX97	Iodobacteriophage	8.5e-51	54.1
WP_163145616.1\|1001977_1002985_-	hypothetical protein	Q9MC69	Pseudomonas_phage	1.1e-15	31.6
WP_163145617.1\|1002981_1003329_-	hypothetical protein	NA	NA	NA	NA
WP_163145618.1\|1003325_1003886_-	hypothetical protein	A0A2D0W9R1	Bordetella_phage	1.4e-17	35.9
WP_163145619.1\|1003882_1004134_-	hypothetical protein	NA	NA	NA	NA
WP_156190915.1\|1004606_1005086_-	hypothetical protein	A0A127KNL4	Pseudomonas_phage	5.4e-10	30.7
WP_163145620.1\|1005139_1005445_+	hypothetical protein	NA	NA	NA	NA
WP_163145621.1\|1005711_1006413_-	peptidase S24	A0A0R6PJ00	Moraxella_phage	1.8e-30	36.8
WP_163145622.1\|1006524_1006734_+	Cro/Cl family transcriptional regulator	NA	NA	NA	NA
WP_163145623.1\|1006785_1007244_+	phage regulatory CII family protein	A0A2H4J3D5	uncultured_Caudovirales_phage	1.3e-58	71.5
WP_163146305.1\|1007374_1008199_+	replication protein	NA	NA	NA	NA
WP_163145624.1\|1008195_1008948_+	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	4.8e-82	61.1
WP_075175320.1\|1009201_1009495_+	hypothetical protein	NA	NA	NA	NA
WP_163145625.1\|1009572_1009974_+	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	4.0e-35	57.9
WP_104499044.1\|1009981_1010485_+	hypothetical protein	A0A0P0IY98	Acinetobacter_phage	2.5e-18	31.7
WP_104499043.1\|1010712_1011132_+	hypothetical protein	NA	NA	NA	NA
WP_163145626.1\|1011823_1012048_+	hypothetical protein	NA	NA	NA	NA
WP_163145627.1\|1012364_1012853_+	recombination protein NinB	A0A2H4JB76	uncultured_Caudovirales_phage	1.2e-49	55.1
WP_163145628.1\|1012914_1013157_+	hypothetical protein	NA	NA	NA	NA
WP_163145629.1\|1013196_1013853_+\|transposase	transposase	A0A1B1P9K3	Acinetobacter_phage	6.3e-110	83.6
WP_163145630.1\|1013899_1014427_+	DUF2280 domain-containing protein	A0A1B1P9C2	Acinetobacter_phage	1.9e-37	70.6
WP_163145631.1\|1014410_1015727_+\|terminase	terminase	A0A0N7IRE3	Acinetobacter_phage	2.8e-242	88.6
WP_163145632.1\|1015767_1017171_+	DUF4055 domain-containing protein	A0A0P0IDW1	Acinetobacter_phage	2.4e-199	76.1
WP_163145633.1\|1017136_1018246_+\|head	phage head morphogenesis protein	A0A1B1P9B7	Acinetobacter_phage	3.5e-97	50.5
WP_163145634.1\|1018242_1018479_+	hypothetical protein	NA	NA	NA	NA
WP_163145635.1\|1018615_1019341_+	hypothetical protein	A0A0P0J090	Acinetobacter_phage	9.1e-78	64.6
WP_163145636.1\|1019343_1020321_+\|coat	phage coat protein	A0A2H4JIE6	uncultured_Caudovirales_phage	5.2e-153	79.4
WP_163145637.1\|1020808_1021192_+	hypothetical protein	A0A0P0IVQ3	Acinetobacter_phage	7.5e-23	48.0
WP_163146306.1\|1021200_1021575_+	glutamate 5-kinase	A0A1B1P9E3	Acinetobacter_phage	5.4e-26	48.9
WP_171524601.1\|1021571_1021970_+	hypothetical protein	A0A0D4DBK8	Acinetobacter_phage	1.2e-39	65.6
WP_163145638.1\|1021944_1022322_+	hypothetical protein	A0A0D4DBN1	Acinetobacter_phage	2.4e-21	42.4
WP_163145639.1\|1022318_1022729_+	hypothetical protein	A0A1B1P9D6	Acinetobacter_phage	1.6e-10	29.6
WP_163145640.1\|1022730_1022952_+	hypothetical protein	A0A1B1P9D7	Acinetobacter_phage	1.0e-08	47.0
WP_163145641.1\|1023199_1023682_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_163145642.1\|1023671_1023935_+	hypothetical protein	A0A1B1P9E1	Acinetobacter_phage	4.8e-21	60.7
WP_163145643.1\|1024014_1024953_+	hypothetical protein	NA	NA	NA	NA
WP_163145644.1\|1025410_1025896_+	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	1.9e-39	56.8
WP_075174790.1\|1025898_1026165_+	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	6.6e-26	66.3
WP_163145645.1\|1026236_1026416_+	hypothetical protein	NA	NA	NA	NA
WP_163145646.1\|1026510_1027176_+	DUF1902 domain-containing protein	A0A0M4R2Z9	Salmonella_phage	9.7e-34	38.5
WP_163145647.1\|1027182_1027380_+	type II toxin-antitoxin system HicA family toxin	A0A0M4RCZ9	Salmonella_phage	1.4e-20	67.7
WP_163145648.1\|1027668_1028304_-	hypothetical protein	NA	NA	NA	NA
WP_163145650.1\|1029358_1029658_-	Arc family DNA-binding protein	NA	NA	NA	NA
WP_008304580.1\|1029771_1029933_+	hypothetical protein	NA	NA	NA	NA
WP_163145651.1\|1030011_1030851_+	hypothetical protein	G9L6D8	Escherichia_phage	1.5e-44	42.7
WP_163145652.1\|1030957_1031578_+	hypothetical protein	NA	NA	NA	NA
WP_163145653.1\|1031655_1032417_+	hypothetical protein	NA	NA	NA	NA
WP_163145654.1\|1032483_1036473_+	tape measure protein	A0A0D4DC37	Acinetobacter_phage	2.0e-97	29.0
WP_163145655.1\|1036551_1037295_+	hypothetical protein	J7HXF9	Acinetobacter_phage	3.2e-38	39.0
WP_163145656.1\|1037291_1037678_+	hypothetical protein	J7I476	Acinetobacter_phage	1.2e-20	41.9
WP_163145657.1\|1037731_1038208_+	hypothetical protein	NA	NA	NA	NA
WP_163145658.1\|1038207_1038705_+	DUF1833 family protein	A0A1B1P9F1	Acinetobacter_phage	1.0e-51	56.4
WP_163145659.1\|1038704_1039088_+	hypothetical protein	A0A1B1P9H4	Acinetobacter_phage	1.0e-51	77.9
WP_163145660.1\|1039053_1041867_+	hypothetical protein	A0A1B1P9G8	Acinetobacter_phage	1.5e-248	49.0
WP_163145661.1\|1045557_1046637_+	hypothetical protein	NA	NA	NA	NA
WP_104498821.1\|1046700_1046982_+\|holin	holin	C7BGD7	Burkholderia_phage	3.1e-18	49.4
WP_163146308.1\|1047260_1047776_+	peptidoglycan-binding protein	H9C0H1	Vibrio_phage	1.1e-56	60.2
WP_163145662.1\|1047885_1048302_-	hypothetical protein	NA	NA	NA	NA
WP_163145663.1\|1048464_1049451_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P9F9	Acinetobacter_phage	2.2e-135	71.0
1049630:1049646	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1058636 : 1068308

uncultured_Caudovirales_phage(44.44%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045794839.1\|1058636_1059770_+	toxic anion resistance protein	K4F9M7	Cronobacter_phage	2.8e-17	22.8
WP_104472513.1\|1059813_1060728_+	hypothetical protein	NA	NA	NA	NA
WP_163145666.1\|1060928_1062494_+	alkyl hydroperoxide reductase subunit F	A0A1W6JK46	Lactococcus_phage	1.5e-24	30.2
WP_005179080.1\|1062630_1062885_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	2.0e-16	46.6
WP_163145667.1\|1062888_1064280_-\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	6.1e-131	64.7
WP_099046172.1\|1064397_1065148_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.5e-22	41.2
WP_005179075.1\|1065242_1065671_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	7.6e-40	59.9
WP_005179068.1\|1065755_1066073_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	7.9e-26	64.4
WP_163145668.1\|1066077_1066551_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	2.3e-37	53.8
WP_163145669.1\|1066554_1067604_+	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_104501016.1\|1067603_1068308_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	8.2e-92	70.5

DBSCAN-SWA_6

1183905 : 1194473

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163145711.1\|1183905_1186044_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.1e-25	23.7
WP_005178811.1\|1186040_1187225_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_005178810.1\|1187328_1187928_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	5.0e-21	39.1
WP_171524626.1\|1187941_1188538_+	acyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	1.3e-08	49.2
WP_005178808.1\|1188674_1189517_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.3e-35	33.9
WP_005178807.1\|1189659_1190325_-	O-methyltransferase	S5YRC3	Mycobacterium_phage	5.0e-30	38.7
WP_005178806.1\|1190457_1191180_-	hypothetical protein	NA	NA	NA	NA
WP_005178805.1\|1191310_1191634_-	ferredoxin family protein	NA	NA	NA	NA
WP_104471029.1\|1191839_1194473_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	3.8e-33	23.6

DBSCAN-SWA_7

1532136 : 1566012

Vibrio_phage(50.0%)

holin,transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163145810.1\|1532136_1534173_-\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	2.1e-18	25.5
WP_034597681.1\|1534402_1534987_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_171524605.1\|1535004_1536480_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_127801582.1\|1536496_1538164_+\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	1.8e-52	30.4
WP_163145812.1\|1538323_1539097_+	hypothetical protein	NA	NA	NA	NA
WP_163145813.1\|1539121_1540513_-	sensor histidine kinase N-terminal domain-containing protein	NA	NA	NA	NA
WP_104471322.1\|1540515_1541187_-	response regulator transcription factor	NA	NA	NA	NA
WP_163145814.1\|1541296_1543279_+	protein-disulfide reductase DsbD	NA	NA	NA	NA
WP_104471320.1\|1543275_1544118_+	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_163145815.1\|1544130_1544871_+	thiol:disulfide interchange protein DsbG	NA	NA	NA	NA
WP_163145816.1\|1546337_1547345_-	OmpA family protein	NA	NA	NA	NA
WP_016658148.1\|1548005_1548992_+	DUF1852 domain-containing protein	NA	NA	NA	NA
WP_163145817.1\|1549020_1550049_+	methionine synthase	NA	NA	NA	NA
WP_005177877.1\|1550158_1550650_+	flavin reductase	NA	NA	NA	NA
WP_163145818.1\|1550691_1551492_+	TSUP family transporter	NA	NA	NA	NA
WP_163145819.1\|1551845_1554035_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_127801714.1\|1554297_1555623_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_075175237.1\|1555728_1556496_-	OmpA family protein	NA	NA	NA	NA
WP_005177824.1\|1556497_1557457_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_163145820.1\|1557488_1561304_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_127799563.1\|1561344_1562763_-	hypothetical protein	NA	NA	NA	NA
WP_163145821.1\|1562759_1563755_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_163145822.1\|1563718_1565524_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_127799557.1\|1565535_1566012_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

DBSCAN-SWA_8

1756427 : 1805236

Bacillus_phage(18.18%)

integrase,transposase

attL 1793621:1793635|attR 1807434:1807448

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163146318.1\|1756427_1756826_-\|transposase	transposase	NA	NA	NA	NA
WP_005176703.1\|1756829_1757981_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_005177339.1\|1758320_1759310_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_163145888.1\|1759306_1760230_-	diguanylate cyclase	NA	NA	NA	NA
WP_163145889.1\|1760547_1763007_+	TonB-dependent receptor	NA	NA	NA	NA
WP_163145890.1\|1763065_1765033_+	phytase	NA	NA	NA	NA
WP_104472268.1\|1765104_1765791_+	protein TolQ	NA	NA	NA	NA
WP_075166740.1\|1765797_1766244_+	protein TolR	NA	NA	NA	NA
WP_163145891.1\|1766240_1767035_+	energy transducer TonB	NA	NA	NA	NA
WP_163145892.1\|1767606_1769760_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_163145893.1\|1769824_1770436_+	DUF4198 domain-containing protein	NA	NA	NA	NA
WP_163145894.1\|1770476_1770761_+	hypothetical protein	NA	NA	NA	NA
WP_163145895.1\|1770764_1772324_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_005177306.1\|1772320_1772602_+	hypothetical protein	NA	NA	NA	NA
WP_163145896.1\|1772664_1773597_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	3.5e-58	39.9
WP_005177227.1\|1774274_1775633_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_163145897.1\|1777142_1778051_-	cation diffusion facilitator family transporter	NA	NA	NA	NA
WP_163145898.1\|1778586_1779189_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.7e-43	48.4
WP_163145899.1\|1779315_1780104_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_104851852.1\|1780100_1781312_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_163145900.1\|1781414_1782296_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_026438210.1\|1782415_1782988_+	hypothetical protein	NA	NA	NA	NA
WP_163145901.1\|1782963_1783464_+	chalcone isomerase family protein	NA	NA	NA	NA
WP_099046172.1\|1783477_1784229_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.5e-22	41.2
WP_005177281.1\|1784293_1784986_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-29	37.3
WP_171524631.1\|1784982_1786296_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_163142172.1\|1786344_1787394_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_163145903.1\|1787402_1788182_-	DUF1295 domain-containing protein	NA	NA	NA	NA
WP_163145904.1\|1788207_1789404_-	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	5.2e-46	33.6
WP_163146319.1\|1789400_1790195_-	DUF1365 family protein	NA	NA	NA	NA
WP_163145905.1\|1790204_1791488_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_163145906.1\|1791484_1792471_-	fatty acid desaturase	NA	NA	NA	NA
WP_163145907.1\|1792608_1793157_-	lipocalin family protein	A0A2P1EMA7	Moumouvirus	4.7e-18	38.3
WP_171524607.1\|1793257_1794031_-	NAD(+) diphosphatase	NA	NA	NA	NA
1793621:1793635	attL	NA	NA	NA	NA
WP_163145908.1\|1794413_1795937_+	cryptochrome/photolyase family protein	E3T4R9	Cafeteria_roenbergensis_virus	1.3e-44	28.0
WP_163145909.1\|1795940_1796075_+	DUF2256 domain-containing protein	NA	NA	NA	NA
WP_163145910.1\|1796089_1796344_-	TIGR03643 family protein	NA	NA	NA	NA
WP_163145911.1\|1796502_1796904_-	hydroxyisourate hydrolase	NA	NA	NA	NA
WP_171521832.1\|1796914_1797403_-	heme-binding protein	NA	NA	NA	NA
WP_005177241.1\|1797508_1798180_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	1.8e-35	36.7
WP_155756615.1\|1798176_1799559_+	heavy metal sensor histidine kinase	NA	NA	NA	NA
WP_163145912.1\|1799582_1800287_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.7e-34	37.0
WP_163142199.1\|1800279_1801503_-	ABC transporter permease	NA	NA	NA	NA
WP_171502409.1\|1801499_1802732_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_163145913.1\|1802817_1803893_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.6e-44	39.6
WP_171524608.1\|1803959_1804235_-	hypothetical protein	NA	NA	NA	NA
WP_163145915.1\|1804185_1804596_-	hypothetical protein	NA	NA	NA	NA
WP_163145916.1\|1804636_1805236_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A2H4JAT5	uncultured_Caudovirales_phage	5.5e-12	30.6
1807434:1807448	attR	NA	NA	NA	NA

DBSCAN-SWA_9

2014674 : 2025536

Acinetobacter_phage(37.5%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163145976.1\|2014674_2015607_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.6e-58	41.0
WP_127800987.1\|2015755_2016343_-	TerD family protein	K4JRX3	Caulobacter_phage	1.3e-13	31.2
WP_127800985.1\|2016370_2017087_-	TIGR00266 family protein	NA	NA	NA	NA
WP_127800983.1\|2017105_2018326_-	TerD family protein	NA	NA	NA	NA
WP_127801911.1\|2018440_2019019_-	TerD family protein	K4JRX3	Caulobacter_phage	8.7e-31	39.7
WP_127800979.1\|2019053_2020130_-	DUF475 domain-containing protein	A0A172Q0Y5	Acinetobacter_phage	1.6e-86	52.6
WP_127800977.1\|2020148_2020724_-	TerD family protein	A0A2P1N0L4	Streptomyces_phage	1.3e-07	37.5
WP_127800975.1\|2021109_2022231_+	phosphoribosyltransferase domain-containing protein	A0A172Q0Y1	Acinetobacter_phage	1.3e-33	28.7
WP_127800973.1\|2022223_2023003_+	hypothetical protein	NA	NA	NA	NA
WP_127800971.1\|2022995_2024144_+\|protease	cysteine protease StiP family protein	A0A172Q0S8	Acinetobacter_phage	5.7e-42	33.2
WP_171457099.1\|2024155_2025082_+	HpcH/HpaI aldolase/citrate lyase family protein	NA	NA	NA	NA
WP_127800966.1\|2025146_2025536_-\|transposase	IS200/IS605 family transposase	Q38463	Halobacterium_phage	3.1e-08	34.2

DBSCAN-SWA_10

2106450 : 2124028

Acinetobacter_phage(29.41%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163146007.1\|2106450_2107848_-	hypothetical protein	U6C697	Ralstonia_phage	2.9e-88	37.8
WP_163146008.1\|2107851_2108295_-	hypothetical protein	NA	NA	NA	NA
WP_163146009.1\|2108287_2108770_-	hypothetical protein	NA	NA	NA	NA
WP_171524611.1\|2108741_2109146_-	hypothetical protein	A0A0D4DBK8	Acinetobacter_phage	2.7e-39	63.1
WP_163146010.1\|2109164_2109593_-	hypothetical protein	NA	NA	NA	NA
WP_163146011.1\|2109658_2110921_-	hypothetical protein	U6C6F9	Ralstonia_phage	6.2e-90	46.3
WP_163146012.1\|2110931_2111828_-	hypothetical protein	U6C6Y4	Ralstonia_phage	7.9e-31	36.5
WP_163146013.1\|2111817_2113893_-	hypothetical protein	U6C855	Ralstonia_phage	5.3e-147	45.3
WP_163146014.1\|2113910_2115359_-	DNA packaging protein	Q2A0C1	Sodalis_phage	2.7e-182	62.4
WP_163146015.1\|2115336_2115894_-\|terminase	terminase small subunit	G0ZND3	Cronobacter_phage	1.4e-41	54.8
WP_163146016.1\|2115904_2116399_-	hypothetical protein	A0A2H4JDI9	uncultured_Caudovirales_phage	7.1e-82	89.3
WP_010116666.1\|2116831_2117005_-	hypothetical protein	NA	NA	NA	NA
WP_163146017.1\|2117752_2118193_-	hypothetical protein	A0A2H4J548	uncultured_Caudovirales_phage	1.4e-52	67.1
WP_163146018.1\|2118203_2118374_-	DUF1653 domain-containing protein	NA	NA	NA	NA
WP_163146019.1\|2118460_2118877_-	hypothetical protein	A0A0P0HSP6	Acinetobacter_phage	9.3e-51	73.0
WP_171524612.1\|2118884_2119361_-	HNH endonuclease	K7P7B7	Enterobacteria_phage	3.7e-27	49.2
WP_163145336.1\|2119347_2119554_-	hypothetical protein	NA	NA	NA	NA
WP_163146020.1\|2119550_2119787_-	hypothetical protein	A0A2H4J558	uncultured_Caudovirales_phage	7.9e-07	40.9
WP_163146021.1\|2119783_2119987_-	hypothetical protein	NA	NA	NA	NA
WP_163146022.1\|2119983_2120208_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_163146023.1\|2120216_2121542_-	AAA family ATPase	A0A2H4J6D5	uncultured_Caudovirales_phage	5.7e-195	86.2
WP_163146024.1\|2121541_2122315_-	helix-turn-helix domain-containing protein	E2GLZ1	Acinetobacter_phage	1.1e-25	50.7
WP_171524613.1\|2122311_2122473_-	hypothetical protein	A0A1B1P9H5	Acinetobacter_phage	2.0e-06	56.0
WP_075175048.1\|2122517_2122892_-	transcriptional regulator	A0A0N7IRF8	Acinetobacter_phage	3.5e-33	61.7
WP_163146329.1\|2123254_2124028_+	helix-turn-helix domain-containing protein	M4T3N8	Psychrobacter_phage	4.9e-21	31.2

DBSCAN-SWA_11

2127686 : 2137349

Acinetobacter_phage(55.56%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163146029.1\|2127686_2128631_+	hypothetical protein	A0A2H4JAZ0	uncultured_Caudovirales_phage	2.3e-150	88.4
WP_163146030.1\|2129442_2129673_+	hypothetical protein	A0A2H4J515	uncultured_Caudovirales_phage	4.8e-33	86.8
WP_163145611.1\|2129672_2130017_+	hypothetical protein	NA	NA	NA	NA
WP_163145610.1\|2130016_2130262_+	hypothetical protein	NA	NA	NA	NA
WP_163145609.1\|2130254_2130491_+	hypothetical protein	NA	NA	NA	NA
WP_163146031.1\|2130483_2130798_+	hypothetical protein	NA	NA	NA	NA
WP_163146032.1\|2130794_2131103_+	hypothetical protein	A0A2H4J8T6	uncultured_Caudovirales_phage	3.1e-11	46.7
WP_075175062.1\|2131099_2131303_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_171065072.1\|2131425_2132001_+	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A0P0IKJ1	Acinetobacter_phage	1.0e-103	93.7
WP_016659977.1\|2132020_2133067_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	5.2e-167	87.1
WP_005176475.1\|2133084_2133891_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.2e-126	85.1
WP_163146033.1\|2134097_2134781_+	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	5.4e-88	75.5
WP_005176473.1\|2134874_2135423_+	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	3.4e-93	95.1
WP_005176472.1\|2135519_2135876_+	DUF861 domain-containing protein	NA	NA	NA	NA
WP_163146034.1\|2135987_2137349_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.4e-17	37.2

DBSCAN-SWA_12

2487860 : 2543383

Enterobacteria_phage(14.29%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163146114.1\|2487860_2490482_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	4.6e-172	40.5
WP_005182353.1\|2490860_2491388_+	hypothetical protein	NA	NA	NA	NA
WP_163146115.1\|2491384_2492374_+	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_163146116.1\|2492492_2493836_+	MacA family efflux pump subunit	A0A140XAI1	Dickeya_phage	6.3e-08	59.2
WP_005182346.1\|2493838_2495818_+	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	5.6e-37	39.2
WP_163146117.1\|2495828_2497247_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_163146118.1\|2497276_2497921_-	hypothetical protein	NA	NA	NA	NA
WP_163146119.1\|2498056_2498812_-	hypothetical protein	NA	NA	NA	NA
WP_163146120.1\|2498814_2499192_-	hypothetical protein	NA	NA	NA	NA
WP_163146121.1\|2499341_2500277_-	hypothetical protein	NA	NA	NA	NA
WP_163146122.1\|2500298_2500457_-	hypothetical protein	NA	NA	NA	NA
WP_001988464.1\|2500708_2501734_+\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	5.7e-25	30.1
WP_004911237.1\|2502750_2503956_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.1e-87	80.3
WP_163146123.1\|2504102_2504621_-	SEL1-like repeat protein	NA	NA	NA	NA
WP_163146124.1\|2505225_2505969_-	SEL1-like repeat protein	NA	NA	NA	NA
WP_163146125.1\|2506134_2507013_-	SEL1-like repeat protein	NA	NA	NA	NA
WP_163146126.1\|2508534_2509470_-	hypothetical protein	NA	NA	NA	NA
WP_163146127.1\|2509550_2510387_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	5.4e-50	37.3
WP_163146128.1\|2510631_2511078_-	hypothetical protein	NA	NA	NA	NA
WP_001195446.1\|2511093_2511585_-	hypothetical protein	NA	NA	NA	NA
WP_035363502.1\|2513296_2514166_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_163146129.1\|2514162_2514681_-	SEL1-like repeat protein	NA	NA	NA	NA
WP_163146130.1\|2514785_2515655_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.0e-51	39.6
WP_163146131.1\|2515888_2516980_-	hypothetical protein	NA	NA	NA	NA
WP_163146132.1\|2516996_2517506_-	hypothetical protein	NA	NA	NA	NA
WP_163146133.1\|2518255_2518720_-	hypothetical protein	NA	NA	NA	NA
WP_163146134.1\|2518761_2519220_-	hypothetical protein	NA	NA	NA	NA
WP_163145337.1\|2519231_2520776_-	hypothetical protein	NA	NA	NA	NA
WP_163146135.1\|2520777_2523579_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	4.6e-287	56.2
WP_005182307.1\|2523721_2524525_-	enoyl-ACP reductase	NA	NA	NA	NA
WP_016659546.1\|2524673_2525408_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_005182297.1\|2525661_2526216_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	7.8e-29	40.7
WP_104490218.1\|2526341_2527400_+	small ribosomal subunit biogenesis GTPase RsgA	NA	NA	NA	NA
WP_005182291.1\|2527496_2527904_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_005182284.1\|2527924_2528182_+	glutaredoxin 3	A0A248SKD6	Salicola_phage	3.5e-08	41.5
WP_005182282.1\|2528222_2528681_+	protein-export chaperone SecB	NA	NA	NA	NA
WP_005182280.1\|2528754_2530029_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.0e-39	31.9
WP_005182279.1\|2530142_2530838_+	DNA repair protein RadC	NA	NA	NA	NA
WP_005182277.1\|2530908_2531820_+	bestrophin	NA	NA	NA	NA
WP_016659548.1\|2531869_2532745_-	PHP domain-containing protein	NA	NA	NA	NA
WP_005182273.1\|2532789_2533401_+	septation protein IspZ	NA	NA	NA	NA
WP_163146136.1\|2533432_2533735_+	hypothetical protein	NA	NA	NA	NA
WP_005182267.1\|2533740_2534223_+	hypothetical protein	NA	NA	NA	NA
WP_171524616.1\|2534253_2536131_+	FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC	NA	NA	NA	NA
WP_005182260.1\|2536318_2536633_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_005182257.1\|2536724_2537213_+	YajQ family cyclic di-GMP-binding protein	NA	NA	NA	NA
WP_104473309.1\|2537241_2537748_+	DUF4442 domain-containing protein	NA	NA	NA	NA
WP_005182243.1\|2537814_2538237_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_163146138.1\|2538254_2538686_-	thioredoxin TrxC	A0A1V0SD63	Indivirus	1.5e-11	33.3
WP_163146139.1\|2538686_2539583_-	alpha/beta fold hydrolase	A2RQC8	Archaeal_BJ1_virus	4.1e-27	33.1
WP_005182227.1\|2539707_2540043_+	TIGR01244 family phosphatase	NA	NA	NA	NA
WP_163146140.1\|2540035_2540458_+	hypothetical protein	NA	NA	NA	NA
WP_163145382.1\|2542363_2543383_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	2.8e-80	46.4

DBSCAN-SWA_13

2588146 : 2598693

Catovirus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005182090.1\|2588146_2590783_-	type I DNA topoisomerase	A0A1V0SB35	Catovirus	2.1e-92	33.7
WP_163146155.1\|2590816_2591266_-	ammonium transporter	NA	NA	NA	NA
WP_005182088.1\|2591336_2592359_-	hypothetical protein	NA	NA	NA	NA
WP_005182087.1\|2592579_2592825_-	SlyX family protein	NA	NA	NA	NA
WP_163146156.1\|2592860_2594771_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.3e-43	27.1
WP_163146157.1\|2594871_2595807_+	LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferase	A0A1W6JP29	Morganella_phage	2.2e-39	33.7
WP_034586922.1\|2595902_2596961_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0H3UZC2	Geobacillus_virus	4.8e-27	36.2
WP_104490858.1\|2596981_2597395_+\|transposase	IS200/IS605 family transposase	A0A1S5RHE3	Helicobacter_phage	2.3e-46	60.9
WP_004911237.1\|2597487_2598693_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.1e-87	80.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP044460

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044460_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044460_1

14985-15069

Orphan

Consensus_repeat	Method
TTATCTCTCGAGTTGTGGAAGATGAGAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044460_1

>merge|NZ_CP044460|1|14985-15069|CRISPRCasFinder
TTATCTCTCGAGTTGTGGAAGATGAGAGAAGTAAATTAAGGCTCCATACTCATTAAGTTATCTCTCGAATTGTGGAAGATGAGAG

>NZ_CP044460|1|1|14985-15069|CRISPRCasFinder
TTATCTCTCGAGTTGTGGAAGATGAGAG	AAGTAAATTAAGGCTCCATACTCATTAAG
TTATCTCTCGAATTGTGGAAGATGAGAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044460.1\|WP_004911237.1\|12642_13848_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP044460.1\|WP_004728244.1\|18060_18702_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|222854
NZ_CP044460.1\|WP_127801718.1\|10081_10591_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044460.1\|WP_163146727.1\|15383_15890_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044460.1\|WP_000877730.1\|1893_2322_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044460.1\|WP_127801920.1\|13919_14510_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239736
NZ_CP044460.1\|WP_163145943.1\|2532_3858_+\|ISNCY-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP044460.1\|WP_127801922.1\|16750_17716_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376986
NZ_CP044460.1\|WP_127801923.1\|18701_18992_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044460.1\|WP_000286964.1\|19724_20027_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|162974
NZ_CP044460.1\|WP_152342556.1\|5394_6699_+\|IS4-family-transposase	unknown	unknown	gnl\|CDD\|379017
NZ_CP044460.1\|WP_044109724.1\|20395_20938_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496
NZ_CP044460.1\|WP_000269911.1\|4406_4763_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|227028
NZ_CP044460.1\|WP_005174595.1\|16142_16703_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044460.1\|WP_000985610.1\|20027_20309_+\|putative-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|188241
NZ_CP044460.1\|WP_127801717.1\|6785_9182_-\|DUF1080-domain-containing-protein	unknown	unknown	gnl\|CDD\|176499
NZ_CP044460.1\|WP_001140620.1\|4755_5058_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775
NZ_CP044460.1\|WP_127801719.1\|10618_10954_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044460.1\|WP_127801924.1\|19215_19617_+\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|369049

Protein	Function_ID	Function_description	E-value
NZ_CP044460.1\|WP_004911237.1\|12642_13848_-\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	4.28328e-110
NZ_CP044460.1\|WP_127801924.1\|19215_19617_+\|PH-domain-containing-protein	gnl\|CDD\|369049	pfam06713, bPH_4, Bacterial PH domain. This family consists of several hypothetical proteins specific to Oceanobacillus and Bacillus species. Members of this family are typically around 130 residues in length. The function of this family is unknown. Members of this family have a PH domain like structure.	2.85549e-19
NZ_CP044460.1\|WP_127801920.1\|13919_14510_-\|recombinase-family-protein	gnl\|CDD\|239736	cd03767, SR_Res_par, Serine recombinase (SR) family, Partitioning (par)-Resolvase subfamily, catalytic domain; Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subgroup is composed of proteins similar to the E. coli resolvase found in the par region of the RP4 plasmid, which encodes a highly efficient partitioning system. This protein is part of a complex stabilization system involved in the resolution of plasmid dimers during cell division. Similar to Tn3 and other resolvases, members of this family may contain a C-terminal DNA binding domain.	5.33172e-64
NZ_CP044460.1\|WP_004728244.1\|18060_18702_+\|AAA-family-ATPase	gnl\|CDD\|222854	PHA02518, PHA02518, ParA-like protein; Provisional.	3.69204e-55
NZ_CP044460.1\|WP_127801922.1\|16750_17716_-\|replication-initiation-protein	gnl\|CDD\|376986	pfam03090, Replicase, Replicase family. This is a family of bacterial plasmid DNA replication initiator proteins. pfam01051 is a similar family. These RepA proteins exist as monomers and dimers in equilibrium: monomers bind directly to repeated DNA sequences and thus activate replication; dimers repress repA transcription by binding an inversely repeated DNA operator. Dimer dissociation can occur spontaneously or be mediated by Hsp70 chaperones.	1.47566e-41
NZ_CP044460.1\|WP_163145943.1\|2532_3858_+\|ISNCY-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	3.05764e-07
NZ_CP044460.1\|WP_152342556.1\|5394_6699_+\|IS4-family-transposase	gnl\|CDD\|379017	pfam13006, Nterm_IS4, Insertion element 4 transposase N-terminal. This family represents the N-terminal region of proteins carrying the transposase enzyme, DDE_Tnp_1 (that was Transposase_11), pfam01609, at the C-terminus. The full-length members are Insertion Element 4, IS4. Within the collection of E.coli strains, ECOR, the number of IS4 elements varies from zero to 14, with an average of 5 copies/strain.	3.70318e-23
NZ_CP044460.1\|WP_044109724.1\|20395_20938_-\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	2.54027e-57
NZ_CP044460.1\|WP_000269911.1\|4406_4763_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|227028	COG4683, COG4683, Uncharacterized protein conserved in bacteria [Function unknown].	3.35915e-45
NZ_CP044460.1\|WP_000985610.1\|20027_20309_+\|putative-addiction-module-antidote-protein	gnl\|CDD\|188241	TIGR02684, conserved_hypothetical_protein, probable addiction module antidote protein. Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the downstream member of a gene pair. It is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family pfam01381. These gene pairs, when found on the bacterial chromosome, are located often with prophage regions, but also both in integrated plasmid regions and in housekeeping gene regions. Analysis suggests that the gene pair may serve as an addiction module. [Mobile and extrachromosomal element functions, Other].	6.60629e-39
NZ_CP044460.1\|WP_127801717.1\|6785_9182_-\|DUF1080-domain-containing-protein	gnl\|CDD\|176499	cd08556, GDPD, Glycerophosphodiester phosphodiesterase domain as found in prokaryota and eukaryota, and similar proteins. The typical glycerophosphodiester phosphodiesterase domain (GDPD) consists of a TIM barrel and a small insertion domain named the GDPD-insertion (GDPD-I) domain, which is specific for GDPD proteins. This family corresponds to both typical GDPD domain and GDPD-like domain which lacks the GDPD-I region. Members in this family mainly consist of a large family of prokaryotic and eukaryotic glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46), and a number of uncharacterized homologs. Sphingomyelinases D (SMases D) (sphingomyelin phosphodiesterase D, EC 3.1.4.41) from spider venom, SMases D-like proteins, and phospholipase D (PLD) from several pathogenic bacteria are also included in this family. GDPD plays an essential role in glycerol metabolism and catalyzes the hydrolysis of glycerophosphodiesters to sn-glycerol-3-phosphate (G3P) and the corresponding alcohols are major sources of carbon and phosphate. Its catalytic mechanism is based on the metal ion-dependent acid-base reaction, which is similar to that of phosphoinositide-specific phospholipases C (PI-PLCs, EC 3.1.4.11). Both, GDPD related proteins and PI-PLCs, belong to the superfamily of PI-PLC-like phosphodiesterases.	3.64458e-45
NZ_CP044460.1\|WP_001140620.1\|4755_5058_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	2.88858e-08
NZ_CP044460.1\|WP_000286964.1\|19724_20027_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|162974	TIGR02683, Uncharacterized_protein_HI_1419, putative addiction module killer protein. Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the upstream member of a gene pair, where the downstream member is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family pfam01381. These gene pairs, when found on the bacterial chromosome, often are located with prophage regions, but also in both integrated plasmid regions and near housekeeping genes. Analysis suggests that the gene pair may serve as an addiction module.	8.00242e-51

>NZ_CP044460.1|WP_127801920.1|13919_14510_-|recombinase-family-protein
MIVRIYVRASTKEQDAERALSDLVEFSKSYSAGHVEYIENESGTKLTRPILNRLLNESEPGDILLVESVDRLSRLEQADFDILKQQIKSKGLRLVVADLPTTHVVNSGMTGEILNVINSMLIDLLATMAKLDNDKRRERIKQGLERSGYKPAGKKANTAKHERIKQLLKAENMTKEEVAKAVGVGIATVYRVQRTI
>NZ_CP044460.1|WP_004911237.1|12642_13848_-|IS256-family-transposase
MANNFDFEAALKQLQSGQPLTGENGILTPLIKQLTEAALNAEIENYLEENPKPSNRRNGYSRKTVKSSSGSFELETPRDRTGDFEPQLVKKNQTKLSEEIDSKVISLFALGMSYRDIQKHIADMYALDISEGAITNITDKLIPELRAWQQRPLDAVYPFVWLDAIHYKIKDEGRYVNKAVYTVLGLNTEGHKELLGLYLSESEGANYWLSVLTDLQNRGIQDILIACVDGLKGFPEAIAAIFPQTEVQLCIIHQIRNSLRYVASKDQKAFMADLKPVYRADTKQAAEMALDELEAKWGDKYEKVIRSWREKWHLLSAYFKYPKAVRKPIYTTNAVEAVHRQFRKLTKTKGAFPNENSLLKLLYIGIQQASEKWTMPVTNWGQTITQLSIYFEGRLDDIIKL
>NZ_CP044460.1|WP_127801719.1|10618_10954_+|hypothetical-protein
MKNFKVLPLLFASLFVGCGTVGNMVIQDQTLEQKAAFALNTTSDKVAISNRQGSIDGTINFVATVGKKSHQCYITTVGGAISSQAVCSGSNSVKQSSDNQCNALLKAAGRC
>NZ_CP044460.1|WP_127801718.1|10081_10591_+|hypothetical-protein
MKIFFLTLIALALTACSKPHDKYIGYWQLEDTKYPRVLEIYKEGKETYIVNENILSETDWFGNKKSGTVLEKKEKELGVNNGLAVITFNLSDDGKILRISDQRYTKISEDDAKQMITNKKNCESLRLKYREEAKAFNIFARDAQKVEQDKIKDNYRELQKEIPNCSFGI
>NZ_CP044460.1|WP_127801717.1|6785_9182_-|DUF1080-domain-containing-protein
MTKLTSLSLAILLAFNLTACNDNDDKDESSALPETPTTPAPEPETPEEEVPVPKVYLDENFDQLTALPAAWTTLRSNAGTVEVKDGSLFIDGRANDTQMTTLMLSPEYQKLRNYRIDIEFTYLERNNGGRWGSIIYRAADSYAEPAFTPYYQFAIRADAAGASGLELALRQPTNAWNVLHKSAYKENMEVNKSYKATVIVHGQRVRHYIDDNLVLDTTLPYNLDQGAIGLSTAGLLMKVDAIKITEQLDPLPESNRVTEIIDHNLPVSMAPTIAQPAPVNGISSTAATHIAYQLDEQLNLLNTEQEKVMALRDYLNDSTRRTLPLLRIQNEQTINKLKTLGESYDLADITLLSDQPELLRKARIAIPALRTALDYSKQTGLSSSTKDIVTIAHNTNSSLAKIVILPKHLVQTEVVSHLQRLLITPWANLDSSSPLTAAEFLSTGVNGIYTEQPDSVLSIMKLMAPNTLLRKPLITGHRGIPALEDENTLEGTLKAIQVGADAVEYDVYLSKDNHVVVMHDSTTTRTTGVNAKIEDLTLAEIQNLRTIPNGRKVPTMDEILAAVKQYPNVTNFIEIKSSKPEIVPKIKELLDKHNAYDQAIVISFVGDQILHMKNEIPGVSTGYLTSTPTAQSNIVNTRRILDAAQKYSSTFNPSFSGLNKELMMMASQRGVTFWPWTFRLNKDDFYRMYVQGTHGLTTDYAHESSNLAVKLNTASQLIATAGKPVEINAEIQTQIGTKSNYLVKNMLVLPNSAKYTQNGQGLTFTEKGTAYVMPSYQYTMAPNYTYTIYAKPVTVTIQ
>NZ_CP044460.1|WP_152342556.1|5394_6699_+|IS4-family-transposase
MSLSEHLESTLEHALPSLNHFCELIDLNWIETSLHQTGKASIRRRKLPAEHVVWLVLGLALFRNQPISYVVEQLKLVFGTTDYCVPSAAVQARQRLGREPLAALFSLISQAWFDESQQQYSSFQGLSVCAVDGVVWSMPLTEENFNHFGSSKGKTAVAPYPQVRATCLVNTNTHEIIDAQIGSMDQGELTLANQLSPPAQSITLFDRAYFSADFLIGWQTRGESSHWLMRAKDNLRYDIIKRNSPHDFHIRMPISARAKKLNPALGDYWEARLIEVEQAGKIRRYITSLLDSKTYPARTLAKLYAQRWEIEMCYREIKSNLQEGKHLRSKQPDLIYQELWGVLIAYNVLRRQMKYMAQRAKVSPLRISFHIASIALLNLLRFDSLASAGNLPKHLESLMEKSNRYVIPERRVRSYPRVVKGKPQKYPRKSQSIS
>NZ_CP044460.1|WP_001140620.1|4755_5058_+|helix-turn-helix-transcriptional-regulator
MAKTLQELLASRSPESQARIQKMADELLLENQLHLIREELEISQKELAETLGIKQPSLSAIENRGNDLKISTMKKYVEAMGGKLRIDVELPTGKHIGFNV
>NZ_CP044460.1|WP_000269911.1|4406_4763_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MWTVITTDLFNQWLEQQDESTQEKVLAALVVLQQQGPSLGRPLVDTVYESKFTNMKELRVQHRGRPLRAFFAFDPLRQAIVLCIADKGGKKRFYKDMLDIADEQYQLHLTTLGDKSNG
>NZ_CP044460.1|WP_163145943.1|2532_3858_+|ISNCY-family-transposase
MSDKELKRLSVLQEICDQRITQSQAAQLLHISERQIRRLLQKYKAQGPAALAHAGRGQISNSRLPEELKLKCLNLVSDQLHGFGPTLAHEKLTTVHGFDISVETLRSWMIAADLWIPRAKRLKRPYQPRYNRDCYGELIQIDGSHHDWFEGRAPKCCLLVFIDDATGKLQHLRFCESESTFDYMISTRLYVEQHGKPLAFYSDKHSVFRVNQSSKKDTKITQFGRVLSTLNIDIIFANSPQAKGRVERANRTLQDRLIKEMRLKGICSIEQANVWLPCFIEQFNQKFAKMAFNPKNLHRPITETAEKLDDIFTWREPRRVTNSLTITYDKCVYILENTEENQRLIGKYLEFLEYPDGTIAIMHNSRKINYSLFDKLSQLNQREIVENKRLGAVLNHIQQQHEELEQQNKRNRSQKMPSRRAQKTAIQERNLNPVLDLEMSI
>NZ_CP044460.1|WP_000877730.1|1893_2322_-|hypothetical-protein
MKYSNEKIVKALLLSPLPLLFFTAVLFIVMNQEYSLYSILVVLVGHGLVYLAYCILTVPFSFIFSILLNRYNSLNLLTICIASIIIATPFFILFGWSHTGEISKEWWKMYTDTWTIFMALFPGLCYWLFLINLKDKKSKNIE
>NZ_CP044460.1|WP_163146727.1|15383_15890_-|hypothetical-protein
MKALSVIELAKLYGMNRQSIYKRINKGDLSKNSDGKIDLAEAIRVFGEPSQRSTQNVTLQSQAAQKSAEVDILQQQVDILKKQLDLAQEREQFQREQLKAKDDQTYSLQLLLGAPKPEQKEESTEADQPIAQVASDQTMEEPRTTNPVSQPEPKRRGLFGRVIRAVLD
>NZ_CP044460.1|WP_005174595.1|16142_16703_-|hypothetical-protein
MGLTNNDLERDEDFLECSKLYFKVAHDEYRDELLRANRLDEKIGRLIAIVNILLAGIVAFSTTSFSDELFTELSNGLKILLILILLLLLSFTFLSWWFLVTASNFSSIGKIAVDDEVRDWVSSKSQSEMYIALADDYKHAIDNAEKKINQCKVDPLNKSLFFLKLSVVTLLVYLVMIFILKYGAIT
>NZ_CP044460.1|WP_127801922.1|16750_17716_-|replication-initiation-protein
MNYTKSHSTLTKFRTELGTQQQLDLFESLPNKPYCMDEKPGYMLIRTKSIAVKKPYIQINSPLTTIYFVFDDDKEDAALSWFDAGLPKPFWTTQNPVNGHSHHCYKLEIPLCTSDFSSIKAIKYAQAVYYAYALKMGADRNYSHLITKNPLHPQWRTTFWTERAYSLDYLADFVDLPKRIPKKLEVVGLGRNVTMFEKGRHWAYKAIRDYMHHNTSLEWEKAVRAQIEAINSGFEQPLPYSEVKATAKSIAKWVWQRFSYGEFSAVQAVRGAKGGKAKGLAYSVKREQAIQLKANGMNNTQIAKQLEVDRKTVRRWLGVGQ
>NZ_CP044460.1|WP_004728244.1|18060_18702_+|AAA-family-ATPase
MIILVGGEKGGSGKSCLAQNLAVYLQAKKRDILLLDADPQGTTTDWIKERDDNNKVESIPSVQAAGNIRQILLDLSKRYQDIIIDAGGQDSEALRSAMTIATHMLLPFRPKRRDLKTLVHVEKLIRLAKAVNPELYTRAVITQCPTLPSQFQRILDAKEACESFDLIPLNNFTCNRNIYDDADENGLSVFEMSSDEKAKQEIEQIAKEFLGDL
>NZ_CP044460.1|WP_127801923.1|18701_18992_+|hypothetical-protein
MALKGLKKSEQSLNEEKIEDFIQGATKRVKKIEPTQQTYKRYTFSLTEDVNHQIDTLLVNCRVAKANRSIILKAAISQLEKLSAEELQKIVLDKIK
>NZ_CP044460.1|WP_127801924.1|19215_19617_+|PH-domain-containing-protein
MQKYKSKIDWWVIIVLTGSSLLLLTLVYSHFDSQNLHANIIFSVLLSSLALVVWLPIPTTYYVVDGEILKIHSIFLKWEIPLNSIEKIEETSDSLSAPALSLDRIRIEYKKDGIHESIMVSPRNKTEFIKQIS
>NZ_CP044460.1|WP_000286964.1|19724_20027_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKSTQSKDIKLALQLAQDLEEEL
>NZ_CP044460.1|WP_000985610.1|20027_20309_+|putative-addiction-module-antidote-protein
MAIKLRKWDSAEHLKTEEDMQAYLQACIDESNGDAAFIAKALGNIAKAKGMAQLSRDTGLGRESLYKALSGDVNPSFDTVIKVVKALNLRLAI
>NZ_CP044460.1|WP_044109724.1|20395_20938_-|cysteine-hydrolase
MSKSALLVIDLQNEYLPTGKLPLVNIEQAAANAVKVIAKAHQLGTQVIHVQHIADAESPIFEPSSNGIEFQDTVKPQEDEAVIIKNHINAFLNTNLKEILDSNQVTELVVIGAMTHMCVDAAVRAASDFGYKVKVIHDACATLDLEFNGVKVPAGHVHATLMAAFEFAYAQVISTEDYVS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044460_1	1.1\|15013\|29\|NZ_CP044460\|CRISPRCasFinder	15013-15041	29	NZ_CP044460	Acinetobacter indicus strain B18 plasmid pB18-5, complete sequence	15013-15041	0	1.0

1. spacer 1.1|15013|29|NZ_CP044460|CRISPRCasFinder matches to NZ_CP044460 (Acinetobacter indicus strain B18 plasmid pB18-5, complete sequence) position: , mismatch: 0, identity: 1.0

aagtaaattaaggctccatactcattaag	CRISPR spacer
aagtaaattaaggctccatactcattaag	Protospacer
*****************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP044457

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

20 : 66184

Escherichia_phage(47.06%)

integrase,transposase

attL 39348:39407|attR 75043:75863

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067855.1\|20_725_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_159153817.1\|2035_3571_+	phosphorylase	NA	NA	NA	NA
WP_163143569.1\|3590_4538_+	nucleotidyltransferase	NA	NA	NA	NA
WP_151208077.1\|4541_5039_+	four-carbon acid sugar kinase family protein	NA	NA	NA	NA
WP_127798918.1\|5035_5932_+	ATP-binding protein	B2YG10	Musca_hytrovirus	1.2e-05	26.6
WP_127798920.1\|5960_6500_+	3'-5' exonuclease	NA	NA	NA	NA
WP_127798922.1\|6540_7056_+	hypothetical protein	NA	NA	NA	NA
WP_159153816.1\|7319_8538_+\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	4.9e-76	52.2
WP_159153815.1\|8660_9434_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	1.2e-75	56.6
WP_163145943.1\|10989_12315_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_127800962.1\|12913_13234_-	hypothetical protein	NA	NA	NA	NA
WP_127800960.1\|13233_13515_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_163143575.1\|13671_14055_+\|transposase	transposase	NA	NA	NA	NA
WP_004780063.1\|14051_14387_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_127800924.1\|16508_17054_-	DNA-binding protein	NA	NA	NA	NA
WP_104505828.1\|17937_18261_+	transcriptional regulator	NA	NA	NA	NA
WP_104505827.1\|18241_18556_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_104505826.1\|18594_18909_+	hypothetical protein	NA	NA	NA	NA
WP_074163995.1\|19614_20115_-	META domain-containing protein	NA	NA	NA	NA
WP_074163994.1\|20117_20801_-	hypothetical protein	NA	NA	NA	NA
WP_163146584.1\|21038_21743_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	5.3e-139	99.6
WP_000376623.1\|21872_22373_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000259031.1\|22500_23340_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_052238321.1\|23333_23669_-	ethidium bromide resistance protein	NA	NA	NA	NA
WP_025999322.1\|23561_23927_+	hydrogenase maturation nickel metallochaperone HypA	NA	NA	NA	NA
WP_004193231.1\|23930_24806_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004236386.1\|24916_26056_+	class C beta-lactamase DHA-1	NA	NA	NA	NA
WP_000050481.1\|27372_28914_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000259031.1\|29318_30158_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_163146594.1\|31827_32808_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	5.9e-64	42.5
WP_163141132.1\|32807_33581_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	5.5e-73	55.4
WP_001206316.1\|33913_34705_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
WP_001256773.1\|34797_36057_-	chloramphenicol efflux MFS transporter CmlA6	S4TR35	Salmonella_phage	2.8e-26	31.7
WP_001261740.1\|36318_37110_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA2	NA	NA	NA	NA
WP_001931474.1\|37150_38017_-	PSE family carbenicillin-hydrolyzing class A beta-lactamase CARB-2	A0A077SL40	Escherichia_phage	4.8e-57	44.1
WP_032490158.1\|38181_38655_-	trimethoprim-resistant dihydrofolate reductase DfrA16	G3MBI7	Bacillus_virus	1.4e-18	30.8
39348:39407	attL	NA	NA	NA	NA
WP_001067855.1\|39400_40105_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_127800989.1\|41039_42212_-	replication initiation protein	NA	NA	NA	NA
WP_127800991.1\|43068_43842_+	ParA family protein	Q8JL10	Natrialba_phage	7.6e-14	33.3
WP_127800993.1\|43855_44767_+	ParB/RepB/Spo0J family partition protein	S5VSZ7	Leptospira_phage	1.4e-14	35.1
WP_163143549.1\|45197_45581_+\|transposase	transposase	NA	NA	NA	NA
WP_163143552.1\|45577_45913_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_127801007.1\|47984_49646_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.6e-170	54.9
WP_127801006.1\|50156_50396_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000934717.1\|52226_53492_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_000366814.1\|53491_53797_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004726728.1\|54717_54975_-	hypothetical protein	NA	NA	NA	NA
WP_004658347.1\|55324_55921_-	putative adenosine monophosphate-protein transferase Fic	NA	NA	NA	NA
WP_002125865.1\|55933_56101_-	DUF2559 family protein	NA	NA	NA	NA
WP_127800793.1\|56417_56867_+	hypothetical protein	NA	NA	NA	NA
WP_127800787.1\|56853_59193_+	hypothetical protein	NA	NA	NA	NA
WP_127800785.1\|59197_62398_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_000550047.1\|62710_62929_-	hypothetical protein	NA	NA	NA	NA
WP_159153749.1\|62959_64342_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	NA	NA	NA	NA
WP_005245164.1\|64984_66184_+\|integrase	tyrosine-type recombinase/integrase	E5AGD0	Erwinia_phage	2.6e-37	29.3
75043:75863	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP044456

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044456_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044456_1

246442-246534

Orphan

Consensus_repeat	Method
TCAGAACTTTGGCGGTGGTTACGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044456_1

>merge|NZ_CP044456|1|246442-246534|CRISPRCasFinder
TCAGAACTTTGGCGGTGGTTACGGCAACAATGGCGGTCAAGGCGGTGGCTTTGGTGGCGGTTATGGTAATCAGAACTTTGGCGGTGGTTACGG

>NZ_CP044456|1|1|246442-246534|CRISPRCasFinder
TCAGAACTTTGGCGGTGGTTACGG	CAACAATGGCGGTCAAGGCGGTGGCTTTGGTGGCGGTTATGGTAA
TCAGAACTTTGGCGGTGGTTACGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044456.1\|WP_163146548.1\|249695_250145_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146537.1\|240517_241462_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146539.1\|242510_242972_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146542.1\|245349_245670_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146552.1\|251966_252491_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146544.1\|246972_247614_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146538.1\|241597_242080_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146540.1\|243254_244373_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146541.1\|244687_245287_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146546.1\|248692_248974_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146550.1\|250747_251197_+\|guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|213552
NZ_CP044456.1\|WP_163146551.1\|251361_251946_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146545.1\|248051_248420_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146536.1\|240031_240403_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146535.1\|239401_239917_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146549.1\|250296_250740_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044456.1\|WP_163146533.1\|235004_237689_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378817
NZ_CP044456.1\|WP_163146547.1\|248974_249703_-\|DUF2786-domain-containing-protein	unknown	unknown	gnl\|CDD\|378525
NZ_CP044456.1\|WP_163146534.1\|238038_239226_-\|SEL1-like-repeat-protein	unknown	unknown	gnl\|CDD\|276807
NZ_CP044456.1\|WP_163146553.1\|252723_254625_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP044456.1\|WP_163146550.1\|250747_251197_+\|guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	gnl\|CDD\|213552	TIGR00691, PppGpp_synthetase., (p)ppGpp synthetase, RelA/SpoT family. The functions of E. coli RelA and SpoT differ somewhat. RelA (EC 2.7.6.5) produces pppGpp (or ppGpp) from ATP and GTP (or GDP). SpoT (EC 3.1.7.2) degrades ppGpp, but may also act as a secondary ppGpp synthetase. The two proteins are strongly similar. In many species, a single homolog to SpoT and RelA appears reponsible for both ppGpp synthesis and ppGpp degradation. (p)ppGpp is a regulatory metabolite of the stringent response, but appears also to be involved in antibiotic biosynthesis in some species. [Cellular processes, Adaptations to atypical conditions].	6.05997e-14
NZ_CP044456.1\|WP_163146533.1\|235004_237689_-\|hypothetical-protein	gnl\|CDD\|378817	pfam12128, DUF3584, Protein of unknown function (DUF3584). This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.	4.24662e-05
NZ_CP044456.1\|WP_163146547.1\|248974_249703_-\|DUF2786-domain-containing-protein	gnl\|CDD\|378525	pfam10979, DUF2786, Protein of unknown function (DUF2786). This family of proteins has no known function.	3.51976e-08
NZ_CP044456.1\|WP_163146534.1\|238038_239226_-\|SEL1-like-repeat-protein	gnl\|CDD\|276807	sd00010, SLR, Sel1-like repeat. Sel1-like repeats (SLRs) share similar alpha-helical conformations with Tetratricopeptide repeats (TPRs), but with different consensus sequence lengths and superhelical topologies. SLRs contain 36 to 44 amino acids and are present in bacteria and eukaryotes but not in archaea. SLR proteins are involved in a variety of functions, and many serve as adaptor proteins for the assembly of macromolecular complexes. The SLR family was named after the Caenorhabditis elegans Sel1 protein which is predicted to fold into 11 SLRs, a transmembrane domain, and an N-terminal signal sequence. The human Sel1L protein contains an additional fibronectin type-II domain and an N-terminal PEST sequence. Its downregulation is associated with the development of breast and pancreatic carcinomas.	2.8532e-19

>NZ_CP044456.1|WP_163146542.1|245349_245670_+|hypothetical-protein
MDGQDSKKRFKRYLFNRAVIFLGIIAILMYVFGFSWNGFEIKLIVFVFGIMALVSSGFYFFRYLDARNMSVFEYLDETLGADRHRYIWYIAGAICSGLIVTKILIG
>NZ_CP044456.1|WP_163146541.1|244687_245287_+|hypothetical-protein
MYNLMQLSYFLKNTPHLRVLLPNQINDRSSFNGMLKNGIKEVFIIIPNINGLVIHLTNVKFHNSIKTLNDVVSVCDTHSFLEFGPENMYLEANGVQILDNNGILLFKQDVEKYLCQTERPVINEVIHETLLDLAVRIKFIENNRSKAISTSIDSLMKKCAEPGHANCKGYVDRFVGVVNTTKRNRLNRSNAPFRSRIVG
>NZ_CP044456.1|WP_163146540.1|243254_244373_+|hypothetical-protein
MTTLRIQPEQNRVLFLGNHIGADAFENHMRNYVAVGSTLFNTLENIREAAQEQVLIEDFSLSNYLSEFGFGHPVVNQWFQSKIYTPFVTHLVATTQTALSHFSNRETLSDDDMAYLEAYLDELNYSQLSQLPTKGIEPITQLKNHFRNSNIGVMADLQMAMEDMDDDEVENTIFGSEPFEQTIEHLKSLLECSAWTVDQKIKVVDLFLENVGGFQDLITHAESDTYSPFQIIKEAMDDTPFMQFVLGYNGETTFNLYGNVYPVVQRDIHCLHGYVVADFANSKARTEAELKAETMATADFIAGVLGDTIFEAYSYLVDLEKHSVDSIFNRFREVSKQSHTVLMDTIKDVLEPFIPELNLKQLRLTYINNAAV
>NZ_CP044456.1|WP_163146539.1|242510_242972_+|hypothetical-protein
MNLSIWATTANHINNAEQGASPELFSYGVSLTPDLRQNYTPQKAIHLVSLLLAVVFSRHNVDAILSTPSAELRSGVVNDSEAPVNQQVIYMTAKTIEDEYLKLKWSLEDMVRFNLRVRRWLSERETDTVDGIGKAIYGLLKDLDARVHFQQAA
>NZ_CP044456.1|WP_163146538.1|241597_242080_+|hypothetical-protein
MYYALEVNNFLSTSQGFRKVKIMKTNLKTPMEWFNFSTYQLFKICLIINFLGHCALAIPVLGYEALDITKNNFIVYLFVSHIITVILAQYHGYSKIPGIFGACTTLFGFLPYLGWLMHLITAVLTGPLSVRLVVACPFSKRHRPLQERIEARENRKNAAI
>NZ_CP044456.1|WP_163146537.1|240517_241462_-|hypothetical-protein
MNSHIEILVKPLPLQQSLDEVGKMIQQIKSLNIQQKYELLENRIQALQLLDIKIYKNHFDNFMGIQEPITPLDHHITIEILENLTEQTRDYVNHLSSVHGLLHATHSNTNYTALTKNTFDLYSEISSQSILMRELFEKATKKLEQISRDYKGSFTVDSREIEYSRYLLTMTGSISRIEKEVKSYADQLYETAMRLTARLKELNQDMRAINQKVECISQITDYLHANCSRKLAKIKYARNLGAIMGGIFLILMVIISFYEQSAYKILFIPFIMSTFYIYLSYREHKKYQAAMHKSLSQLKEVMNSAIQAQKIKTL
>NZ_CP044456.1|WP_163146536.1|240031_240403_+|hypothetical-protein
MNETLIAPQPHLLNGIKFKAIGLCSALTVVALLWAYNPNSGLAYKSYWAEIKKSDLDKPASTSHVVILRYYLRKTHADYLEEELNSQPQITNRHLIEYLGKVATIYDEYQIARHPRRGILNPS
>NZ_CP044456.1|WP_163146535.1|239401_239917_+|hypothetical-protein
MTEKDNNIVSFSRAKVSSDETKVQNLIRAVKGFGFQTFESPEPLSFNVVTGNSIKSGVHVVRVELKENGWFFKADLASLDYGSNNPVINRATAHNLINEAMGKLQEEFTGVQINGTEYQGVWQIRDFANEENFTILFMLGVSRKDNTSPISVIQHLASVPKIAFKLVQDGV
>NZ_CP044456.1|WP_163146534.1|238038_239226_-|SEL1-like-repeat-protein
MHTKQEKDGAEYQQILQARELYEKGIRLSMVKPNKTNLKKAVSYFTQAADLGHINANFIIGDAFCKGKWRTELDQTEALKYLDTAANHNHPEAMVGFADIHHRNGNLFEALDEYLLALTYGNQAAIDRIQKLIDNPIGQNYLANLFQREEKTQESMVQFFIGRCYLHGFCTEPNLERAIGWLKEAVRSNSAYAAHTLGYLYETGNGVDKDIDMAIDLYKIAGEQGFSKGYLSIAIYNSQRINEPHMAKENLQSAFEFYRKAAELGDLVADNEMGILHIQGFEFGFPNYADAALCFQAGADKGNPDAILNLANCYYSGVGVERDLIKAENYFSLLLSHEDGLAAQAAYGLGAIYTQNIQKRIRKIGRSYLEAAAKANIQGAKDLLNKSFGNNKKVA
>NZ_CP044456.1|WP_163146533.1|235004_237689_-|hypothetical-protein
MRLIVHRQNGFSIGSEKGYVVPIAFENDDSTITAIQPGQFPNNNRIWISRGFGVIESEFGNEDIFYLNTYHDTCEKKDDTPQEAERIERELEIIRNNPNNCRYFSLGSNASRLDSGYVQAVHLPRLPDVGTGRLTSHLMPKLPAVGIPFFAIVDNFVYGPFQIRRDTTIGIEDDIIFETVNKITPLGLQNNHIAKFPLKALEDNEILLRVNSGSLQAVYISNLHIVKSAINFEVIDYISDVNLIQYYLRSEFAKDNSISKSHANTLRTAIESSIRKNHILKTERVERLFKVLDQFLTQDTQEYDLIKRYLNSKEGSQFLTNFLETNGSVILKDHIDALTNKNKKELEELRTAHDAQITAMQTRLANEKQIVERKIAKLHADYESNQKEINERQSQANTESLTQEVESLQHQIAELTSTLQILKQGHDLEQQILRLEGRRETLDQDVSHKRDQIKEMDKALEHQARLIQNPSLLTDKAVEDVTLRGLRGIMTGSNFNSKNEPFILEPISPAVIHLEGETRSSYISEIQTRINKQEGRILTYNETANLIVSVMQNYLTIFSGYPGTGKTSTVSNFAEALGINGSGTNKCNFLNVAVARGWTSSKDLLGNKNALRQSYEEGRTGIYSMLKAIEESKYGSENNNLNHEMLNMILLDEANLSPMEHYWSDFLSICDTFQEGKVLNLGGRDKQFTLELPPSLRFIATINTDATVEPLSDRLLDRAGVIMLGIEDSNTNEAMEVENLLFNGAVPYKELAEAFMIDANPIKFQESGKQDSELSILQETGKLDSELSILQEIRNALQMEIANTPAVHISKRKSNAILRYCAVANELNYQQMSPIDFAVAQHILPKIKGHGKGFKDRLLALDKVLNDSRLLQSKRLLKQILDNGSEFGDTFSLL
>NZ_CP044456.1|WP_163146544.1|246972_247614_-|hypothetical-protein
MLKVKKLILSTVLATLGLTGAHAAAPTKAQILQWLVNAQQSTAEPKKAIQLVKTEKITLVNGEEAYISGVEFENAARNFWGGYILTRPDAKKAQILDEFGGQSNTFKVHKTNYKGKLLDIVELEQSSSGGGAISGANSLVVFKGDKLQVLASGENSGTMMYDDCRKDKYIETEFKIKPNSQTITKITTTSNGCEEVKKQNKKVKTELIPIAVK
>NZ_CP044456.1|WP_163146545.1|248051_248420_+|hypothetical-protein
MIIDKELHQFPFLQVTFQVDDDGLQFNECLVFDLRDIAKQLNTPIEGLDTDSEDFFLLIARGYVDFRCADHIYNLVSSRQIGLTFSNNDFEAEIVYTEQITQEYFDRLETGLIANLYTFPEE
>NZ_CP044456.1|WP_163146546.1|248692_248974_-|hypothetical-protein
MNIIDGYIVDTMRQFRKYKFTKTDVTQTMDKIVEEYRISHTVKNGKLPGNSEAPFQEYLQKLPLNAKVPRGKYFKDKSPFRRHTLLEEMWRIN
>NZ_CP044456.1|WP_163146547.1|248974_249703_-|DUF2786-domain-containing-protein
MSNQAADQDSVLAKIKKCLNLSKSSNANEAQVALRQAHALMKKHNLSMNDVELSEIVTAQVNADTKTKVPDWTAELIRVVAVLLECEVMFNRFMGSNKKMIINFVGAKENTEIAVYTFTVLYRALKKQRKDFIAEQAAQKRLLHANKVRIGDAFCQGWVIAVREKIKDLIQQEKTPEEQAFADRVKSYVHQKTKSATMTPNSRNKQGLTKYAQEGFREGRNVDLHIGVHGKGKQQALLTQGS
>NZ_CP044456.1|WP_163146548.1|249695_250145_-|hypothetical-protein
MEQELQRRVAPTRDHREIPPFNDIKHDLEIPEDARFIGWYINNPQNPLHFVSRDVTTKTKFMKKLISVSVEQGKCFKLGEYQKALDFVDALPFAAQVTVIFGYVKKSDELPADTMKRAYIDPNATEYLVFSALPLYYNGKPQFSEDDNE
>NZ_CP044456.1|WP_163146549.1|250296_250740_+|hypothetical-protein
MKKNFAHYRTMFIQLASFMDVNLHSSVSENFMDFMTRKLDFTVAMPSQDAMSFYANLSQNPEKLKLLGLTKSSDFLRVQTKQLWYRENANYVAPELFDAEYDLWFAHQLNKLFDDQVLKGDFQKTQFLKAMFADLKQRIGLSITHAV
>NZ_CP044456.1|WP_163146550.1|250747_251197_+|guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase
MATAKLAEQLAIERHYGQFDKAGEPYIKHPERVANAVNTPEEKMAAWMHDLIEDTDTTADELLKLGFPVTVVDAILSLTKRPGESRVSAAHRTAANRIGVAVKLADVADNMNLDRLPQVTEKDLARLEEYKQVKLILEDAKVNRWNNFQ
>NZ_CP044456.1|WP_163146551.1|251361_251946_-|hypothetical-protein
MQTYEHEDNVPQELQDQLKKAEYKSREIKFAYKLLLVVAIPWIWLCIMSYYMIAFIDQYDYAKAEKKRQAVAEKVRKDMVKLDQQGNRYATLYLVEHGSFEQRSTAFNALKDIQDKDAQYFNLVYSSKYSDVPGYNILEDHEYIRNLMKYVSSGYFKAVNELVDLETKLRDKKKPTAKEIESLKLIEQFKQSLI
>NZ_CP044456.1|WP_163146552.1|251966_252491_-|hypothetical-protein
MTSELSQAASIELPKNKLNLEQTHEKILVHQNSIFLGRKIIIVCLALMIISVTLTLCAVVEKRNKTKKKQSLENQPVYVEHAINLAATGNEDALIWLGMSGNASKTEFQKIKALAYNTDNPQVIEALLKTDETLKKENPEFKGLDHSEIKALKTKGMELGSVKLIEEKYIEVAK
>NZ_CP044456.1|WP_163146553.1|252723_254625_+|hypothetical-protein
MNMSEYAIQSVAKFQALLEEHDAYIYTYEMSFKYRLENVLKTLQFDDSGITAMVMVKDLYGQFGSAAHIRINAIDNKFDKVLKFRQDLLEVKELIQQSQIVEQMQHISGLIENYFKKADQGISPDMRNLLDDHGKVVDVYTKTLKSSKDFDVLVFNKGKNAVEGSKLELFSPVYVWRDFNSLQAHQHKFEDGVYFCFVDRVFGFVYKNGENLVVVSDTMEYNYLRRHISDRFIPSNKNNTDAGYYLPYQLLKTEYGKMDVQLYNFETAEAFANQTTPSVLCDISELPVESLVYVVLMFELLVKKYGFATDLLDAEPITTHGTNHIFDKAIEYKSSQKLITVDELRHSVFHALFPEQSYSAYNTRLEERFSHLVDQRLLNLVKHNGQVFCPDESGRYVPFTEKIKYKYGEFNNTDELKLLAFDLTMVGTPDQLEELRYRVARKNYAAMLDMHTKSYMSEKLPEIRKYLKKKFYDNLENLETIMGYQSIQVQNHLGRETPWSLMVSEQYDPKIKSYPQSQWLRTHISERDPGSSVLRCYETGSKRFQTIMFRVGSAEQLAFLLNVPVNKLPDPLKEYRYDSFDRHCKLDPVDQIESIWEQRLLEFEVVVSKSHYNSIRKKTNPQYLETIKATAQL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044456_1	1.1\|246466\|45\|NZ_CP044456\|CRISPRCasFinder	246466-246510	45	NZ_CP044456	Acinetobacter indicus strain B18 plasmid pB18-1, complete sequence	246466-246510	0	1.0
NZ_CP044456_1	1.1\|246466\|45\|NZ_CP044456\|CRISPRCasFinder	246466-246510	45	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	69930-69974	0	1.0

1. spacer 1.1|246466|45|NZ_CP044456|CRISPRCasFinder matches to NZ_CP044456 (Acinetobacter indicus strain B18 plasmid pB18-1, complete sequence) position: , mismatch: 0, identity: 1.0

caacaatggcggtcaaggcggtggctttggtggcggttatggtaa	CRISPR spacer
caacaatggcggtcaaggcggtggctttggtggcggttatggtaa	Protospacer
*********************************************

2. spacer 1.1|246466|45|NZ_CP044456|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

caacaatggcggtcaaggcggtggctttggtggcggttatggtaa	CRISPR spacer
caacaatggcggtcaaggcggtggctttggtggcggttatggtaa	Protospacer
*********************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_CP044458

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044458_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044458_1

46130-46995

TypeI-F

I-F

Consensus_repeat	Method
AGTTCACTGCCGTATAGGTAGCTTAGAAA	CRISPRCasFinder
GTTCACTGCCGTATAGGTAGCTTAGAAA	PILER-CR
GTTCACTGCCGTATAGGTAGCTTAGAAA	CRT

14 spacers

cas6f,cas7f,cas5f,cas8f,cas3-cas2

The CRISPR arrays of NZ_CP044458_1

>merge|NZ_CP044458|1|46130-46995|CRISPRCasFinder,PILER-CR,CRT
AGTTCACTGCCGTATAGGTAGCTTAGAAAGACTAAACGTAGATTTTTTAAGTAATATTCAAGTTCACTGCCGTATAGGTAGCTTAGAAACGAAACATGCAATTTGAGGGCTTCTGCGCGCAGTTCACTGCCGTATAGGTAGCTTAGAAAATGAAAATTTGATGGCTGTTTGATGATTGGGAGTTCACTGCCGTATAGGTAGCTTAGAAAGGATGAACAAACATGCTTTTCAATTACTGCAAGTTCACTGCCGTATAGGTAGCTTAGAAACATATGATTGTTTATATCGTTCCGTTTGACGAGTTCACTGCCGTATAGGTAGCTTAGAAATTAAAAGCATTTAAAAGCTTTTCTTTTATTAAGTTCACTGCCGTATAGGTAGCTTAGAAAAGCAGAAAAAGCAGAAAGGAAAATAGCACTAGGTTCACTGCCGTATAGGTAGCTTAGAAACCCCCTTTCTGCAACGTCACCCCCTTTTGTCTGTTCACTGCCGTATAGGTAGCTTAGAAAATGCAATTATTAATTCATACAAACGGATTGCATGTTCACTGCCGTATAGGTAGCTTAGAAATTATGCTTGGTGGACAGCAATTTGTTTTACTTGGTTCACTGCCGTATAGGTAGCTTAGAAATTTTGCCTGGTACACATACTTAACCTGGGCCAGTTCACTGCCGTATAGGTAGCTTAGAAAAGGGGCCAGCCGAACAAATTAAATTAGCAAGAGTTCACTGCCGTATAGGTAGCTTTGAAAGTCAAAAGTTATGGAAAAGTTTTGAAGCTTGGGTTCACTGCCGTATAGGTAGCTTAGAAATTTGTAAAACAAGTTGACTGTTACTTCATTCACTGCCGAACAGGTAGTTTATTCA

>NZ_CP044458|1|1|46130-46995|CRISPRCasFinder
AGTTCACTGCCGTATAGGTAGCTTAGAAA	GACTAAACGTAGATTTTTTAAGTAATATTCA
AGTTCACTGCCGTATAGGTAGCTTAGAAA	CGAAACATGCAATTTGAGGGCTTCTGCGCGC
AGTTCACTGCCGTATAGGTAGCTTAGAAA	ATGAAAATTTGATGGCTGTTTGATGATTGGG
AGTTCACTGCCGTATAGGTAGCTTAGAAA	GGATGAACAAACATGCTTTTCAATTACTGCA
AGTTCACTGCCGTATAGGTAGCTTAGAAA	CATATGATTGTTTATATCGTTCCGTTTGACG
AGTTCACTGCCGTATAGGTAGCTTAGAAA	TTAAAAGCATTTAAAAGCTTTTCTTTTATTA
AGTTCACTGCCGTATAGGTAGCTTAGAAA	AGCAGAAAAAGCAGAAAGGAAAATAGCACTA
GGTTCACTGCCGTATAGGTAGCTTAGAAA	CCCCCTTTCTGCAACGTCACCCCCTTTTGTC
TGTTCACTGCCGTATAGGTAGCTTAGAAA	ATGCAATTATTAATTCATACAAACGGATTGCA
TGTTCACTGCCGTATAGGTAGCTTAGAAA	TTATGCTTGGTGGACAGCAATTTGTTTTACTT
GGTTCACTGCCGTATAGGTAGCTTAGAAA	TTTTGCCTGGTACACATACTTAACCTGGGCC
AGTTCACTGCCGTATAGGTAGCTTAGAAA	AGGGGCCAGCCGAACAAATTAAATTAGCAAG
AGTTCACTGCCGTATAGGTAGCTTTGAAA	GTCAAAAGTTATGGAAAAGTTTTGAAGCTTG
GGTTCACTGCCGTATAGGTAGCTTAGAAA	TTTGTAAAACAAGTTGACTGTTACTT
CATTCACTGCCGAACAGGTAGTTTATTCA

>NZ_CP044458|1|1|46131-46940|PILER-CR
GTTCACTGCCGTATAGGTAGCTTAGAAA	GACTAAACGTAGATTTTTTAAGTAATATTCAA
GTTCACTGCCGTATAGGTAGCTTAGAAA	CGAAACATGCAATTTGAGGGCTTCTGCGCGCA
GTTCACTGCCGTATAGGTAGCTTAGAAA	ATGAAAATTTGATGGCTGTTTGATGATTGGGA
GTTCACTGCCGTATAGGTAGCTTAGAAA	GGATGAACAAACATGCTTTTCAATTACTGCAA
GTTCACTGCCGTATAGGTAGCTTAGAAA	CATATGATTGTTTATATCGTTCCGTTTGACGA
GTTCACTGCCGTATAGGTAGCTTAGAAA	TTAAAAGCATTTAAAAGCTTTTCTTTTATTAA
GTTCACTGCCGTATAGGTAGCTTAGAAA	AGCAGAAAAAGCAGAAAGGAAAATAGCACTAG
GTTCACTGCCGTATAGGTAGCTTAGAAA	CCCCCTTTCTGCAACGTCACCCCCTTTTGTCT
GTTCACTGCCGTATAGGTAGCTTAGAAA	ATGCAATTATTAATTCATACAAACGGATTGCAT
GTTCACTGCCGTATAGGTAGCTTAGAAA	TTATGCTTGGTGGACAGCAATTTGTTTTACTTG
GTTCACTGCCGTATAGGTAGCTTAGAAA	TTTTGCCTGGTACACATACTTAACCTGGGCCA
GTTCACTGCCGTATAGGTAGCTTAGAAA	AGGGGCCAGCCGAACAAATTAAATTAGCAAGA
GTTCACTGCCGTATAGGTAGCTTTGAAA	GTCAAAAGTTATGGAAAAGTTTTGAAGCTTGG
GTTCACTGCCGTATAGGTAGCTTAGAAA

>NZ_CP044458|1|1|46131-46995|CRT
GTTCACTGCCGTATAGGTAGCTTAGAAA	GACTAAACGTAGATTTTTTAAGTAATATTCAA
GTTCACTGCCGTATAGGTAGCTTAGAAA	CGAAACATGCAATTTGAGGGCTTCTGCGCGCA
GTTCACTGCCGTATAGGTAGCTTAGAAA	ATGAAAATTTGATGGCTGTTTGATGATTGGGA
GTTCACTGCCGTATAGGTAGCTTAGAAA	GGATGAACAAACATGCTTTTCAATTACTGCAA
GTTCACTGCCGTATAGGTAGCTTAGAAA	CATATGATTGTTTATATCGTTCCGTTTGACGA
GTTCACTGCCGTATAGGTAGCTTAGAAA	TTAAAAGCATTTAAAAGCTTTTCTTTTATTAA
GTTCACTGCCGTATAGGTAGCTTAGAAA	AGCAGAAAAAGCAGAAAGGAAAATAGCACTAG
GTTCACTGCCGTATAGGTAGCTTAGAAA	CCCCCTTTCTGCAACGTCACCCCCTTTTGTCT
GTTCACTGCCGTATAGGTAGCTTAGAAA	ATGCAATTATTAATTCATACAAACGGATTGCAT
GTTCACTGCCGTATAGGTAGCTTAGAAA	TTATGCTTGGTGGACAGCAATTTGTTTTACTTG
GTTCACTGCCGTATAGGTAGCTTAGAAA	TTTTGCCTGGTACACATACTTAACCTGGGCCA
GTTCACTGCCGTATAGGTAGCTTAGAAA	AGGGGCCAGCCGAACAAATTAAATTAGCAAGA
GTTCACTGCCGTATAGGTAGCTTTGAAA	GTCAAAAGTTATGGAAAAGTTTTGAAGCTTGG
GTTCACTGCCGTATAGGTAGCTTAGAAA	TTTGTAAAACAAGTTGACTGTTACTTC
ATTCACTGCCGAACAGGTAGTTTATTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044458.1\|WP_163146649.1\|39077_42116_+\|type-I-F-CRISPR-associated-helicase-Cas3	cas3-cas2	cas3-cas2-CAS-I-F	gnl\|CDD\|274201
NZ_CP044458.1\|WP_163146653.1\|45394_46000_+\|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4	cas6f	pfam09618_cas6f_CAS-I-F	gnl\|CDD\|378224
NZ_CP044458.1\|WP_163146662.1\|53173_53848_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044458.1\|WP_163146660.1\|51986_52235_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044458.1\|WP_163146654.1\|47074_47470_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044458.1\|WP_163146645.1\|36222_36552_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044458.1\|WP_163146646.1\|36926_37436_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044458.1\|WP_163146663.1\|54334_55009_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044458.1\|WP_163146647.1\|37638_37827_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP044458.1\|WP_163146657.1\|49765_50353_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044458.1\|WP_163146651.1\|43386_44328_+\|type-I-F-CRISPR-associated-protein-Csy2	cas5f	pfam09614_cas5f_CAS-I-F	gnl\|CDD\|378221
NZ_CP044458.1\|WP_163146650.1\|42130_43387_+\|type-I-F-CRISPR-associated-protein-Csy1	cas8f	cd09735_cas8f_CAS-I-F	gnl\|CDD\|378220
NZ_CP044458.1\|WP_163146659.1\|51213_51933_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044458.1\|WP_163146655.1\|47675_48752_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044458.1\|WP_163146658.1\|50569_51109_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044458.1\|WP_163146644.1\|35443_36266_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|372577
NZ_CP044458.1\|WP_163146648.1\|38017_38617_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044458.1\|WP_163146652.1\|44360_45395_+\|type-I-F-CRISPR-associated-protein-Csy3	cas7f	pfam09615_cas7f_CAS-I-F	gnl\|CDD\|378222
NZ_CP044458.1\|WP_163146661.1\|52266_52869_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044458.1\|WP_163146656.1\|49023_49533_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP044458.1\|WP_163146651.1\|43386_44328_+\|type-I-F-CRISPR-associated-protein-Csy2	gnl\|CDD\|378221	pfam09614, Cas_Csy2, CRISPR-associated protein (Cas_Csy2). CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) is a widespread family of prokaryotic direct repeats with spacers of unique sequence between consecutive repeats. This entry, typified by YPO2464 of Yersinia pestis, is a CRISPR-associated (Cas) entry strictly associated with the Ypest subtype of CRISPR/Cas locus. It is designated Csy2, for CRISPR/Cas Subtype Ypest protein 2.	1.72347e-112
NZ_CP044458.1\|WP_163146653.1\|45394_46000_+\|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4	gnl\|CDD\|378224	pfam09618, Cas_Csy4, CRISPR-associated protein (Cas_Csy4). CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) is a widespread family of prokaryotic direct repeats with spacers of unique sequence between consecutive repeats. This protein family, typified by YPO2462 of Yersinia pestis, is a CRISPR-associated (Cas) family strictly associated with the Ypest subtype of CRISPR/Cas locus. It is designated Csy4, for CRISPR/Cas Subtype Ypest protein 4.	1.26677e-49
NZ_CP044458.1\|WP_163146650.1\|42130_43387_+\|type-I-F-CRISPR-associated-protein-Csy1	gnl\|CDD\|378220	pfam09611, Cas_Csy1, CRISPR-associated protein (Cas_Csy1). CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) is a widespread family of prokaryotic direct repeats with spacers of unique sequence between consecutive repeats. This entry, typified by YPO2465 of Yersinia pestis, is a CRISPR-associated (Cas) entry strictly associated with the Ypest subtype of CRISPR/Cas locus. It is designated Csy1, for CRISPR/Cas Subtype Ypest protein 1.	3.00829e-92
NZ_CP044458.1\|WP_163146649.1\|39077_42116_+\|type-I-F-CRISPR-associated-helicase-Cas3	gnl\|CDD\|274201	TIGR02562, conserved_hypothetical_protein, CRISPR-associated helicase Cas3, subtype I-F/YPEST. The helicase in many CRISPR-associated (cas) gene clusters is designated Cas3, and most Cas3 proteins are described by model TIGR01587. Members of this family are considerably larger, show a number of motifs in common with TIGR01587 sequences, and replace Cas3 in some CRISPR/cas loci in a number of Proteobacteria, including Yersinia pestis, Chromobacterium violaceum, Erwinia carotovora subsp. atroseptica SCRI1043, Photorhabdus luminescens subsp. laumondii TTO1, Legionella pneumophila, etc.	0
NZ_CP044458.1\|WP_163146644.1\|35443_36266_+\|IS5-family-transposase	gnl\|CDD\|372577	pfam13359, DDE_Tnp_4, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	3.17178e-19
NZ_CP044458.1\|WP_163146652.1\|44360_45395_+\|type-I-F-CRISPR-associated-protein-Csy3	gnl\|CDD\|378222	pfam09615, Cas_Csy3, CRISPR-associated protein (Cas_Csy3). CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) is a widespread family of prokaryotic direct repeats with spacers of unique sequence between consecutive repeats. This entry, typified by YPO2463 of Yersinia pestis, is a CRISPR-associated (Cas) entry strictly associated with the Ypest subtype of CRISPR/Cas locus. It is designated Csy3, for CRISPR/Cas Subtype Ypest protein 3.	8.9039e-164
NZ_CP044458.1\|WP_163146647.1\|37638_37827_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	5.94336e-06

>NZ_CP044458.1|WP_163146653.1|45394_46000_+|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4
MFYQQITLIDQCEVPSFAIWSKLYKKLHLALVESKEREGGVHIGVSFPGYVYDGSTPKGKKWLGNKLRLIARSERELRDLNIDQWLKNLVDGDYVHITSIKSVPAEIKGYACYGRKQTFNQSYIARLQRRANARNKGESSLASTTLTDLPYVQLESYSTPTELEGQRHGFTLHIEKKLVDKNENFVFSTYGLSSESALPEF
>NZ_CP044458.1|WP_163146652.1|44360_45395_+|type-I-F-CRISPR-associated-protein-Csy3
MAKAKEVNQKEAVKVASVLSFERKLVSSAGYFYGTNWNDRAIEALLPLSEISVRGVIANRQKGKYNQAKFEADAQKANLQTVDTCTLGKEQDTLKVSFTLKVLNGVEQPSSCNSEAFQQTYQEAVKQYIEEYGFRELAKRYAQNIASGRFLWRNRFNAEQIEVQVKINDGEPLKFNGFAYDQHDFSKDYPELEPLIVAIEKALSSETESTLLTIDTYALIGKGQPVFPSEELVLNKDSSKFEKSKILYETDGTAALHSQKISNAIRTIDTWYPTFTEKNMAIAVEPYGTVTNFNLVMRTPQHKQDFYTLFDKFAVGGELESAEQKHYVMAVLIRGGVFGQGKDA
>NZ_CP044458.1|WP_163146651.1|43386_44328_+|type-I-F-CRISPR-associated-protein-Csy2
MRSFILIPNIVIEGANAISSPFTVGFPAMTAWLGSVHALQRKLREKGYENIVLDKCAVSCHSFDLRSYKDKGEFNSHLKGKRLPVNKDGKLASFVVEGTCDLEVSLLIEYHNLNGEEVESFLEDIGKIMKFKMNLASGSVKSLNQIQFIHFDEDEDEEVQLKPLLRKLMLGHVLIERRDLVEQNMNSGMDALDAVLDPLKVISQARYVETQKDQEPQAERGENDETKAKERKVVWTYTTKQPGWIIPIAVGFKGISPLGKALKQRDQNTEHRFAESLVTLGEFVMPFRIESLDQMLWRYDIDQANDLYLCLNN
>NZ_CP044458.1|WP_163146650.1|42130_43387_+|type-I-F-CRISPR-associated-protein-Csy1
MIRPHFEGFLQEQKSAWLNKKALGKEPKPELVQKAEDRYSEKTWWETSLQAARPAAATHISTFTHPDAKTTNLVVGISIVNNGLMATSNVNCRNSYDIYGNAGNDSLISEVYRFLYLQLPDGLTVAGHLTQDTNDIQSFFNGLGIDYSYAKERLESMLSDRRPTKTHQLVKQVYFPISDNQYHLLSLLTSSVLQTELLKRINELKFSDKSKELRILRREKKFTDQKIEEIFGLTEVFFGGSKPQNISVANSVNNGKAYLLPSLPPKIEKRALRLPKNDFFETLFYMNFKESFTAWHELMAGNWNNIRIRNGIIKTIQFIIDQILFKALTISEQMPEGWTDDEKYQALPKYQKIFLDCKYEDKEFKDEAWRTQISNAVGHWIIKSYEKSVKESFLLESSEYNEVKALVESTLRKEKAVF
>NZ_CP044458.1|WP_163146649.1|39077_42116_+|type-I-F-CRISPR-associated-helicase-Cas3
MVHSNLFLEAVESLASISALLHDWGKANELFQNKLVELNLSGDPLRHEWVSCLILKGLILQSGNTKSDTLWLNLLVNQSWNEQAIKDLVLQMSDQESPLKSLPPTAQLIAWLVVTHHRLPDLKNESIRDSFAGTHISTLSGMLNIITANWGYSTKFDADYKTRLQHCLNFNNGLLSQSEQWMDSLKTQATRLLELAPTIQQALDNGCWRVLLHHARLCMMLGDHYYSSCDKDKNWKSAVSLFANTDPKSHELKQQLDEHLVHVGRHAADIAKQLPSFIDEMGSAQNLIKLQKRAKGFEWQDTGVDTIRALRAVNPGAENLGWFVVNMASTGKGKTIANAKFMQAMSHNEHSLRYVLALGLRTLTLQTGDSYTDDIGLTKEQLAVVIGSSAVRELHENGKEQNTAKAVPQEEQSGSESAENLMDADLVYTPVSAPESLQVFFNGRQKEQNQAFLYKPVLVCTIDHIIGATETVRGGKYILPALRLLSSDLVIDEVDDFSTEDFIPISRLVHLAGMLGRKVMVSSATIPPALAEGLFNAYQQGWELYSKFSGKPNQTVAMWVDEFTAATKVIDQEPCQTYAQSHNEFVAHRVIELRDQKVKHRSKIVECTDLQAAKEQKLLDDSLAQQYYERIKTQIQDFHLLHHTVDEPTGKKVSFGIVRVANIPPCVALTQYLLNADWDADITPRIMSYHSRQILLLRSEQERHLDSVLKRKEKKGQQPVAFSNPVIRAHIDAAQTENVTFVVVATPVAEVGRDHDYDWAVVEPSSFRSIIQLSGRVLRHRPVQEDMTDANIALMQLNVRGLRNAKVAYTKPGFEKDNSKFRLKTKDLSKLINTTNTAINAVPRIQSQQVLKPTEQLADLEHAVIANVLTNYQKHGAKTMNAWLNETWFLTALHQNFFPFRKSSPSILLYAIFDGPQLRFCEKNKFGEFIDRTGAYKISMYTLNPLEKERLWLDRDYYDILRCKALEARNEVGNVDEITERLSKWYGEVVLPKYDESKALIYSDQFGLVVKN
>NZ_CP044458.1|WP_163146648.1|38017_38617_-|hypothetical-protein
MSQATFSFEQLSPAAQAKALDVCRDINTSDELWYEQLNESSLDVFLETLGFEDPKIYFSLAYCQGDYAELNSARFHYNKGFVKQIKAEFPTWTKAHEMAEQLQDICKRYFYGYSFSVVNGRTCDIEHKRLGTDWQHDISAFESEIDDFMDDLNSMLYNAYRDEYETLTSDENVKANLIDQDHQFFADGTDKKTVYANAA
>NZ_CP044458.1|WP_163146647.1|37638_37827_-|helix-turn-helix-transcriptional-regulator
MTLQELCRSKDLTIEDVADKIDLDANLLKQYVAGNGKPKGWAINAMAELFDVDFFTMEKYFE
>NZ_CP044458.1|WP_163146646.1|36926_37436_-|hypothetical-protein
MPNNNIAIGVFLHRLYLALLSCFMIMVWLAFDHVLFPLADSLPIAFMFAFWVLVAPWFIQKRGIQFLSFDILETADSRLHFSRGNSWRYLLSLHGLNPQQLYLIPLRQIMLNMAFGGIYFLLSRSDVSVFITLPIATLGGYLTARSLCFSICLVFTIIAETMGSEFRGK
>NZ_CP044458.1|WP_163146645.1|36222_36552_-|hypothetical-protein
MDIKQLQEFQKTARYKTLVAQGANCFISVRDAHGPLAQRILQELPIEEFFDGITKVDDADNAADGISSEDLMHFTVSVESMLKHFTDNIRPLAKVLIASLFGLLMQRLN
>NZ_CP044458.1|WP_163146644.1|35443_36266_+|IS5-family-transposase
MRYQKLNRFSDSEFKRLVGVPRQVFTEMVEVLEKAESLKKKSGRPHTLDIEDQLLLTLNYLRNYSTQLELAANYHIAESNVNRTIKKVENALMKSRRFILPKRSITTADEHFNWVIIDATECSIERPKKNQSKFYSGKKKKHTLKAQVIYHPKSKQIIGLDISNGSQHDIKLARKTVKKFNHCEYVITDLGYYGLEQDGFKLLMPIKKQKNFPLFDVEKKYNNMIGKIRVVIEHINSQLKTFRILSERYRNRRKRFGLRINLIAALVNRINSQ
>NZ_CP044458.1|WP_163146654.1|47074_47470_-|hypothetical-protein
MHEEQLAQPESHRIKGLEIGFIKMNIQAQHQDFLTAHGLFVLDQLPDDIQQIAIQNVMDAEHKGFIQDIANARAAIKKDLHACINNSHFIRELHSNRSKLKCPKYRRSFVLNNLCEFRADGTYYTYADIEF
>NZ_CP044458.1|WP_163146655.1|47675_48752_-|hypothetical-protein
MKNAELYFHIEHLAKNSILPEIEKRQDAARKVNVSPHHTIQLAQLETHPESGVIEVQLEITALDHVSNYVLQKAFNSIVEDIKFDDLLPEQLKAFQFDPSSLYCHSSKLDEMCKEAQRHQEYDQYEVWVSYKHSLLYKLPPTAEKDLLKVIKADLQARKKMAAKEKNTFSEITSINFKFEHHGKVHHCSLNPLTQKLGFANSYDENGNKLAAHNLTWHSWRTPTVDLSELFKGIHTNTALKAVLKSHLVKGAKITALTTTRFKFTDYYSFYRSYKLIRLYANIGDYHNPVLAIVDIHKSGEIVILNERGVDITTTDDRAKSIVNQLQAVHKELFCSNKHYAKSILTFHHLSVYHRVFS
>NZ_CP044458.1|WP_163146656.1|49023_49533_-|hypothetical-protein
MKIESAIKLHTNQSAVSILLDSLPINHSHEQVGTLLVLAVADSIHSTSTDHLRFIINVEANSELDEERFTVDSTLDVDLAKFDDLDALKKHIKINLQADLISTAISLEVVSDEVIEAFDDWNQSQASEPFDFEAPDGFNIIDYAVDVADQISKVIEKYFLLSMKERAAV
>NZ_CP044458.1|WP_163146657.1|49765_50353_-|hypothetical-protein
MSWVTVTPSKVQKISLRILRAEWYTIPELVADVKEQMPEVEEQLQEIIHNLCGGTNGDQMNAAMLMPMVATNNEESVLSLLPEKAQRIIRSLLIKEIQRESRQSIECDFSVPVDFTLDDLKKLVSNEIHYSETVSIYDYVYAPVFTNIHGGGYNVVVFVAVNHKQTDQRIFNLINENSRNIVNSLNQISLSIWER
>NZ_CP044458.1|WP_163146658.1|50569_51109_+|hypothetical-protein
MGLSEEEVKEGRYYISKQFSEEYYDHKYSSMQRAVTPPGNVPDDKLMIEPVRFDMKKHIRSKCEEKVVVTKHDLEKVKFGLRGITYMLTEEANVDRTPFYQCIENQLKTIDLDNENLQNLVQSSDYQDMKKQPEFEKEIQEIKKDGRVTLYEALAILSSMHKYSSAVDKAQYQTTINNL
>NZ_CP044458.1|WP_163146659.1|51213_51933_+|hypothetical-protein
MKRNKFIAASLLAASIISTQFTQAESAASGVKEVGDIVTDTSFVGISKEAKYMIEHGHFYVWRMMWEPLINNYNIKDRKNIRPELERDNLDKMEKVADTWQSVYALHQLAIYNMAKATVTEEYFNKRDNPDRKEAIRIWEKCFNLSPTRCDNTVQIFSYYENLDDTAKAVHWLEQGSSKSNNGFSSLLLAKGILEDKSGFPKDKKKGLELARLAKQQLAARGVTKYDQDVNYILSKFDK
>NZ_CP044458.1|WP_163146660.1|51986_52235_-|hypothetical-protein
MKLNLVDRLYVAVMGLLVSHASFLYAVYATRAFAMYLLMSVVGSITFAVILRIGRTKTARMAFKGNREIDKHPEFRDDLDLL
>NZ_CP044458.1|WP_163146661.1|52266_52869_-|hypothetical-protein
MNINDLKASAKLENKAKRLERIFVGNKSACRPQHFVDFLQINVIAEMAPHLAGSVEKIVLSGVMVSEGKVCHFEQSYQPDQLEESIERHQKIDYTTLHSGVNSLSYLVQKDLIGCLINTANPLFKDKAFVAWWNDQADDNEVIKPEEVTVEDKTAVIATAHVGEILYDMMIETLENYCKSNLVKYQKKISFEKSFCECES
>NZ_CP044458.1|WP_163146662.1|53173_53848_-|hypothetical-protein
MHKHNTSGITIERIFDFKHREAEPTSLEITPDIISWQAPELIIKDGDRIIFNGYEGDDYSSDDHLDNLLKELLTPQIREAFDLSIDTSVLYVPVYKYLDDEIKNEDDLFQQWHTANELNHKGPYQIKRVRAVYSGTDTPGSDDIAFVGKLLAQATRSVYQTELFLTYGGNFVLLDDGDIHRAKSLEELPFKFGADVIKFANASLTTLAEQHARRDELFQIGHIL
>NZ_CP044458.1|WP_163146663.1|54334_55009_-|hypothetical-protein
MRKVIAALFALSTVSAFAATPTQQVLDEVNKVCAVQPNYDNSYRLCNTLDVRFPFENDAAFKNKLTSVLKKSGLKIKGDPVSSIKSSVPGFSILNGSVIHAYASTYNQDGDFALIDKAGNQYGMAVYYAPYGNKLIVEPTSKDTSKYSHPWLGDLKDATLRKGIVEFVRNNYKNSWGSSPNAQNTFKDTINEELRELKIYLGADIQHQGFQYYDPNYRLPHEKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044458_1	1.1\|46159\|31\|NZ_CP044458\|CRISPRCasFinder	46159-46189	31	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46159-46189	0	1.0
NZ_CP044458_1	1.1\|46159\|31\|NZ_CP044458\|CRISPRCasFinder	46159-46189	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136816-136846	0	1.0
NZ_CP044458_1	1.2\|46219\|31\|NZ_CP044458\|CRISPRCasFinder	46219-46249	31	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46219-46249	0	1.0
NZ_CP044458_1	1.2\|46219\|31\|NZ_CP044458\|CRISPRCasFinder	46219-46249	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136756-136786	0	1.0
NZ_CP044458_1	1.3\|46279\|31\|NZ_CP044458\|CRISPRCasFinder	46279-46309	31	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46279-46309	0	1.0
NZ_CP044458_1	1.3\|46279\|31\|NZ_CP044458\|CRISPRCasFinder	46279-46309	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136696-136726	0	1.0
NZ_CP044458_1	1.4\|46339\|31\|NZ_CP044458\|CRISPRCasFinder	46339-46369	31	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46339-46369	0	1.0
NZ_CP044458_1	1.4\|46339\|31\|NZ_CP044458\|CRISPRCasFinder	46339-46369	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136636-136666	0	1.0
NZ_CP044458_1	1.5\|46399\|31\|NZ_CP044458\|CRISPRCasFinder	46399-46429	31	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46399-46429	0	1.0
NZ_CP044458_1	1.5\|46399\|31\|NZ_CP044458\|CRISPRCasFinder	46399-46429	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136576-136606	0	1.0
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136516-136546	0	1.0
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46459-46489	0	1.0
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46519-46549	0	1.0
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136456-136486	0	1.0
NZ_CP044458_1	1.8\|46579\|31\|NZ_CP044458\|CRISPRCasFinder	46579-46609	31	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46579-46609	0	1.0
NZ_CP044458_1	1.8\|46579\|31\|NZ_CP044458\|CRISPRCasFinder	46579-46609	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136396-136426	0	1.0
NZ_CP044458_1	1.9\|46639\|32\|NZ_CP044458\|CRISPRCasFinder	46639-46670	32	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46639-46670	0	1.0
NZ_CP044458_1	1.9\|46639\|32\|NZ_CP044458\|CRISPRCasFinder	46639-46670	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136335-136366	0	1.0
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46700-46731	0	1.0
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136274-136305	0	1.0
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46761-46791	0	1.0
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136214-136244	0	1.0
NZ_CP044458_1	1.12\|46821\|31\|NZ_CP044458\|CRISPRCasFinder	46821-46851	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136154-136184	0	1.0
NZ_CP044458_1	1.12\|46821\|31\|NZ_CP044458\|CRISPRCasFinder	46821-46851	31	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46821-46851	0	1.0
NZ_CP044458_1	1.13\|46881\|31\|NZ_CP044458\|CRISPRCasFinder	46881-46911	31	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46881-46911	0	1.0
NZ_CP044458_1	1.13\|46881\|31\|NZ_CP044458\|CRISPRCasFinder	46881-46911	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136094-136124	0	1.0
NZ_CP044458_1	1.14\|46941\|26\|NZ_CP044458\|CRISPRCasFinder	46941-46966	26	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46941-46966	0	1.0
NZ_CP044458_1	1.14\|46941\|26\|NZ_CP044458\|CRISPRCasFinder	46941-46966	26	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136039-136064	0	1.0
NZ_CP044458_1	1.15\|46159\|32\|NZ_CP044458\|PILER-CR,CRT	46159-46190	32	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46159-46190	0	1.0
NZ_CP044458_1	1.15\|46159\|32\|NZ_CP044458\|PILER-CR,CRT	46159-46190	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136815-136846	0	1.0
NZ_CP044458_1	1.16\|46219\|32\|NZ_CP044458\|PILER-CR,CRT	46219-46250	32	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46219-46250	0	1.0
NZ_CP044458_1	1.16\|46219\|32\|NZ_CP044458\|PILER-CR,CRT	46219-46250	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136755-136786	0	1.0
NZ_CP044458_1	1.17\|46279\|32\|NZ_CP044458\|PILER-CR,CRT	46279-46310	32	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46279-46310	0	1.0
NZ_CP044458_1	1.17\|46279\|32\|NZ_CP044458\|PILER-CR,CRT	46279-46310	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136695-136726	0	1.0
NZ_CP044458_1	1.18\|46339\|32\|NZ_CP044458\|PILER-CR,CRT	46339-46370	32	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46339-46370	0	1.0
NZ_CP044458_1	1.18\|46339\|32\|NZ_CP044458\|PILER-CR,CRT	46339-46370	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136635-136666	0	1.0
NZ_CP044458_1	1.19\|46399\|32\|NZ_CP044458\|PILER-CR,CRT	46399-46430	32	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46399-46430	0	1.0
NZ_CP044458_1	1.19\|46399\|32\|NZ_CP044458\|PILER-CR,CRT	46399-46430	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136575-136606	0	1.0
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46459-46490	0	1.0
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136515-136546	0	1.0
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46519-46550	0	1.0
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136455-136486	0	1.0
NZ_CP044458_1	1.22\|46579\|32\|NZ_CP044458\|PILER-CR,CRT	46579-46610	32	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46579-46610	0	1.0
NZ_CP044458_1	1.22\|46579\|32\|NZ_CP044458\|PILER-CR,CRT	46579-46610	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136395-136426	0	1.0
NZ_CP044458_1	1.23\|46639\|33\|NZ_CP044458\|PILER-CR,CRT	46639-46671	33	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46639-46671	0	1.0
NZ_CP044458_1	1.23\|46639\|33\|NZ_CP044458\|PILER-CR,CRT	46639-46671	33	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136334-136366	0	1.0
NZ_CP044458_1	1.24\|46700\|33\|NZ_CP044458\|PILER-CR,CRT	46700-46732	33	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46700-46732	0	1.0
NZ_CP044458_1	1.24\|46700\|33\|NZ_CP044458\|PILER-CR,CRT	46700-46732	33	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136273-136305	0	1.0
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46761-46792	0	1.0
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136213-136244	0	1.0
NZ_CP044458_1	1.26\|46821\|32\|NZ_CP044458\|PILER-CR,CRT	46821-46852	32	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46821-46852	0	1.0
NZ_CP044458_1	1.26\|46821\|32\|NZ_CP044458\|PILER-CR,CRT	46821-46852	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136153-136184	0	1.0
NZ_CP044458_1	1.27\|46881\|32\|NZ_CP044458\|PILER-CR,CRT	46881-46912	32	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46881-46912	0	1.0
NZ_CP044458_1	1.27\|46881\|32\|NZ_CP044458\|PILER-CR,CRT	46881-46912	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136093-136124	0	1.0
NZ_CP044458_1	1.28\|46941\|27\|NZ_CP044458\|CRT	46941-46967	27	NZ_CP044458	Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence	46941-46967	0	1.0
NZ_CP044458_1	1.28\|46941\|27\|NZ_CP044458\|CRT	46941-46967	27	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	136038-136064	0	1.0
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP034096	Acinetobacter baumannii strain A52 plasmid pA52-4, complete sequence	3359-3389	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_KX118105	Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence	105-135	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_KX118105	Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence	41391-41421	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_KX118105	Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence	41551-41581	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_KX118105	Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence	41749-41779	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_KX118105	Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence	51224-51254	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_KX118105	Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence	53879-53909	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	4139-4169	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	4336-4366	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	4533-4563	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	4730-4760	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	4927-4957	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	5124-5154	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	5321-5351	1	0.968
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	42561-42591	1	0.968
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP034096	Acinetobacter baumannii strain A52 plasmid pA52-4, complete sequence	3359-3390	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_KX118105	Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence	105-136	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_KX118105	Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence	41391-41422	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_KX118105	Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence	41551-41582	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_KX118105	Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence	41749-41780	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_KX118105	Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence	51224-51255	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_KX118105	Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence	53879-53910	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	4139-4170	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	4336-4367	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	4533-4564	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	4730-4761	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	4927-4958	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	5124-5155	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP037425	Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence	5321-5352	1	0.969
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	42561-42592	1	0.969
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	70-100	2	0.935
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	267-297	2	0.935
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	464-494	2	0.935
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	661-691	2	0.935
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	858-888	2	0.935
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	1055-1085	2	0.935
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	1252-1282	2	0.935
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	1449-1479	2	0.935
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	1646-1676	2	0.935
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	1843-1873	2	0.935
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	2040-2070	2	0.935
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	2237-2267	2	0.935
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	2434-2464	2	0.935
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	70-101	2	0.938
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	267-298	2	0.938
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	464-495	2	0.938
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	661-692	2	0.938
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	858-889	2	0.938
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	1055-1086	2	0.938
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	1252-1283	2	0.938
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	1449-1480	2	0.938
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	1646-1677	2	0.938
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	1843-1874	2	0.938
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	2040-2071	2	0.938
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	2237-2268	2	0.938
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_CP032117	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence	2434-2465	2	0.938
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP030107	Acinetobacter baumannii strain DA33382 plasmid pDA33382-2-2, complete sequence	289-319	3	0.903
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP016903	Acinetobacter soli strain GFJ2 plasmid pGFJ7, complete sequence	3743-3773	3	0.903
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP030107	Acinetobacter baumannii strain DA33382 plasmid pDA33382-2-2, complete sequence	288-319	3	0.906
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP016903	Acinetobacter soli strain GFJ2 plasmid pGFJ7, complete sequence	3742-3773	3	0.906
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	AP013736	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S46-C31, * SEQUENCING IN PROGRESS *	34237-34268	6	0.812
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	AP013728	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S24-C174, * SEQUENCING IN PROGRESS *	2413-2444	6	0.812
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	AP013730	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S30-C21, * SEQUENCING IN PROGRESS *	431-462	6	0.812
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	AP013733	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S37-C24, * SEQUENCING IN PROGRESS *	7782-7813	6	0.812
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	AP013735	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S43-C92, * SEQUENCING IN PROGRESS *	9213-9244	6	0.812
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	AP013444	Uncultured Mediterranean phage uvMED DNA, complete genome, group G17, isolate: uvMED-CGR-C32A-MedDCM-OCT-S40-C23	30779-30810	6	0.812
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	AP013734	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S39-C27, * SEQUENCING IN PROGRESS *	24278-24309	6	0.812
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	AP013731	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S32-C100, * SEQUENCING IN PROGRESS *	19835-19866	6	0.812
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	AP013729	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S27-C31, * SEQUENCING IN PROGRESS *	28424-28455	6	0.812
NZ_CP044458_1	1.3\|46279\|31\|NZ_CP044458\|CRISPRCasFinder	46279-46309	31	NZ_CP045822	Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence	19647-19677	7	0.774
NZ_CP044458_1	1.3\|46279\|31\|NZ_CP044458\|CRISPRCasFinder	46279-46309	31	NZ_CP045813	Bacillus subtilis strain P8_B3 plasmid pBs005, complete sequence	10921-10951	7	0.774
NZ_CP044458_1	1.3\|46279\|31\|NZ_CP044458\|CRISPRCasFinder	46279-46309	31	NZ_CP041758	Bacillus sp. KBS0812 plasmid unnamed, complete sequence	43199-43229	7	0.774
NZ_CP044458_1	1.3\|46279\|31\|NZ_CP044458\|CRISPRCasFinder	46279-46309	31	NC_021809	Bacillus subtilis subsp. subtilis str. NCIB 3610 plasmid pBS32, complete sequence	13998-14028	7	0.774
NZ_CP044458_1	1.3\|46279\|31\|NZ_CP044458\|CRISPRCasFinder	46279-46309	31	NZ_CP020103	Bacillus subtilis strain NCIB 3610 plasmid pBS32, complete sequence	5409-5439	7	0.774
NZ_CP044458_1	1.3\|46279\|31\|NZ_CP044458\|CRISPRCasFinder	46279-46309	31	NZ_CP034485	Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 strain NCIB 3610 plasmid unnamed, complete sequence	53780-53810	7	0.774
NZ_CP044458_1	1.3\|46279\|31\|NZ_CP044458\|CRISPRCasFinder	46279-46309	31	NZ_CP045923	Bacillus subtilis strain P8_B1 plasmid pBs003, complete sequence	11020-11050	7	0.774
NZ_CP044458_1	1.3\|46279\|31\|NZ_CP044458\|CRISPRCasFinder	46279-46309	31	NZ_AP019715	Bacillus subtilis subsp. subtilis strain NBRC 13719 plasmid pBSU1, complete sequence	65213-65243	7	0.774
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_MK275621	Clostridium perfringens strain JXJA17 plasmid p3, complete sequence	29131-29161	7	0.774
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP013041	Clostridium perfringens strain JP55 plasmid pJFP55F, complete sequence	45555-45585	7	0.774
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	MN693353	Marine virus AFVG_25M425, complete genome	19044-19074	7	0.774
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	MN693547	Marine virus AFVG_25M424, complete genome	11685-11715	7	0.774
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	MN693598	Marine virus AFVG_25M403, complete genome	8685-8715	7	0.774
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	MN693297	Marine virus AFVG_25M423, complete genome	7779-7809	7	0.774
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	NZ_CP028874	Borreliella bavariensis PBi plasmid lp25_cp32-3, complete sequence	18259-18289	7	0.774
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	NC_017225	Borreliella afzelii PKo plasmid cp32-12, complete sequence	27000-27030	7	0.774
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	NZ_CP044485	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence	15099-15130	7	0.781
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	KT325596	Uncultured bacterium plasmid pFK2-7, complete sequence	4578-4609	7	0.781
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	NZ_CP038024	Acinetobacter radioresistens strain DD78 plasmid pAR2, complete sequence	31558-31589	7	0.781
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	NZ_CP010903	Acinetobacter nosocomialis strain 6411 plasmid p6411-66.409kb, complete sequence	27366-27397	7	0.781
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	MK978162	Acinetobacter lwoffii strain M2a plasmid pAVAci14, complete sequence	31669-31700	7	0.781
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	NZ_CP051870	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_1, complete sequence	29567-29598	7	0.781
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	NC_019217	Uncultured bacterium HHV216 plasmid pHHV216, complete sequence	4551-4582	7	0.781
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	NC_019218	Uncultured bacterium HHV35 plasmid pHHV35, complete sequence	4749-4780	7	0.781
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	NC_019299	Uncultured bacterium HH1107 plasmid pHH1107, complete sequence	4551-4582	7	0.781
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	NZ_CP044465	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-2, complete sequence	8125-8156	7	0.781
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	NZ_CP041290	Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence	1751-1782	7	0.781
NZ_CP044458_1	1.13\|46881\|31\|NZ_CP044458\|CRISPRCasFinder	46881-46911	31	MT188223	Acinetobacter phage vB_AbaM_D22, complete genome	92045-92075	7	0.774
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_MK275621	Clostridium perfringens strain JXJA17 plasmid p3, complete sequence	29131-29162	7	0.781
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP013041	Clostridium perfringens strain JP55 plasmid pJFP55F, complete sequence	45555-45586	7	0.781
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP009059	Borreliella afzelii K78 plasmid lp54, complete sequence	45560-45591	7	0.781
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP009214	Borreliella afzelii Tom3107 plasmid lp54, complete sequence	12704-12735	7	0.781
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NC_017241	Borreliella afzelii PKo plasmid lp54, complete sequence	45418-45449	7	0.781
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	NZ_CP028874	Borreliella bavariensis PBi plasmid lp25_cp32-3, complete sequence	18258-18289	7	0.781
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	NC_017225	Borreliella afzelii PKo plasmid cp32-12, complete sequence	27000-27031	7	0.781
NZ_CP044458_1	1.4\|46339\|31\|NZ_CP044458\|CRISPRCasFinder	46339-46369	31	NZ_CP046704	Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence	331618-331648	8	0.742
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP013040	Clostridium perfringens strain JP838 plasmid pJFP838C, complete sequence	54857-54887	8	0.742
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP029156	Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence	17130-17160	8	0.742
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP029153	Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence	11174-11204	8	0.742
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP015841	Chlamydia gallinacea 08-1274/3 plasmid p1274, complete sequence	3899-3929	8	0.742
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP020425	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence	29617-29647	8	0.742
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	FN668942	Clostridium difficile BI1 plasmid pCDBI1, complete sequence	28261-28291	8	0.742
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP033574	Shewanella algae strain KC-Na-R1 plasmid pKC-Na-R1, complete sequence	119828-119858	8	0.742
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP019793	Chlamydia gallinacea strain JX-1 plasmid pJX1, complete sequence	4839-4869	8	0.742
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP011969	Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence	24939-24969	8	0.742
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	AP014358	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C94, * SEQUENCING IN PROGRESS *	28868-28898	8	0.742
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	NZ_KX832926	Providencia rettgeri strain 16pre36 plasmid p16Pre36-1, complete sequence	21905-21935	8	0.742
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	NZ_CP026061	Proteus mirabilis strain FDAARGOS_80 plasmid unnamed2, complete sequence	17429-17459	8	0.742
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	NC_010555	Proteus mirabilis HI4320 plasmid pHI4320, complete sequence	15848-15878	8	0.742
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	NZ_CP021855	Proteus mirabilis strain AR_0156 plasmid unitig_3, complete sequence	16183-16213	8	0.742
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	NZ_MK941846	Proteus mirabilis strain PM1157 plasmid pOXA-23, complete sequence	51543-51573	8	0.742
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	NZ_MF150117	Proteus mirabilis strain A64421 plasmid pPM64421b, complete sequence	14992-15022	8	0.742
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	MN693756	Marine virus AFVG_250M718, complete genome	29702-29732	8	0.742
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	MN694439	Marine virus AFVG_250M296, complete genome	29296-29326	8	0.742
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	MN693803	Marine virus AFVG_250M716, complete genome	7503-7533	8	0.742
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	MN694282	Marine virus AFVG_250M297, complete genome	29308-29338	8	0.742
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	MN694541	Marine virus AFVG_250M717, complete genome	29711-29741	8	0.742
NZ_CP044458_1	1.8\|46579\|31\|NZ_CP044458\|CRISPRCasFinder	46579-46609	31	MK759884	Salmonella phage vB_SenM_SB18, complete genome	69601-69631	8	0.742
NZ_CP044458_1	1.8\|46579\|31\|NZ_CP044458\|CRISPRCasFinder	46579-46609	31	NC_015292	Erwinia phage phiEa104, complete genome	69346-69376	8	0.742
NZ_CP044458_1	1.8\|46579\|31\|NZ_CP044458\|CRISPRCasFinder	46579-46609	31	MH426725	Erwinia phage SunLIRen, complete genome	69342-69372	8	0.742
NZ_CP044458_1	1.8\|46579\|31\|NZ_CP044458\|CRISPRCasFinder	46579-46609	31	FQ482083	Erwinia amylovora phage phiEa104 complete genome	69346-69376	8	0.742
NZ_CP044458_1	1.8\|46579\|31\|NZ_CP044458\|CRISPRCasFinder	46579-46609	31	HQ728263	Erwinia phage vB_EamM-M7, complete genome	52322-52352	8	0.742
NZ_CP044458_1	1.8\|46579\|31\|NZ_CP044458\|CRISPRCasFinder	46579-46609	31	NC_011811	Erwinia phage phiEa21-4, complete genome	69359-69389	8	0.742
NZ_CP044458_1	1.8\|46579\|31\|NZ_CP044458\|CRISPRCasFinder	46579-46609	31	MN604407	Salmonella phage ST-3, complete genome	43189-43219	8	0.742
NZ_CP044458_1	1.8\|46579\|31\|NZ_CP044458\|CRISPRCasFinder	46579-46609	31	MK770412	Salmonella phage SE5, complete genome	15441-15471	8	0.742
NZ_CP044458_1	1.9\|46639\|32\|NZ_CP044458\|CRISPRCasFinder	46639-46670	32	MN694484	Marine virus AFVG_250M1201, complete genome	16742-16773	8	0.75
NZ_CP044458_1	1.12\|46821\|31\|NZ_CP044458\|CRISPRCasFinder	46821-46851	31	NZ_AP017978	Neochlamydia sp. S13 plasmid pS13, complete sequence	227429-227459	8	0.742
NZ_CP044458_1	1.15\|46159\|32\|NZ_CP044458\|PILER-CR,CRT	46159-46190	32	AP018320	Nostoc sp. HK-01 plasmid plasmid2 DNA, complete genome	130534-130565	8	0.75
NZ_CP044458_1	1.15\|46159\|32\|NZ_CP044458\|PILER-CR,CRT	46159-46190	32	MN180251	UNVERIFIED: Wolbachia phage WO isolate Seq2wOMel_KL2 genomic sequence	81265-81296	8	0.75
NZ_CP044458_1	1.17\|46279\|32\|NZ_CP044458\|PILER-CR,CRT	46279-46310	32	NZ_CP045822	Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence	19647-19678	8	0.75
NZ_CP044458_1	1.17\|46279\|32\|NZ_CP044458\|PILER-CR,CRT	46279-46310	32	NZ_CP045813	Bacillus subtilis strain P8_B3 plasmid pBs005, complete sequence	10921-10952	8	0.75
NZ_CP044458_1	1.17\|46279\|32\|NZ_CP044458\|PILER-CR,CRT	46279-46310	32	NZ_CP041758	Bacillus sp. KBS0812 plasmid unnamed, complete sequence	43199-43230	8	0.75
NZ_CP044458_1	1.17\|46279\|32\|NZ_CP044458\|PILER-CR,CRT	46279-46310	32	NC_021809	Bacillus subtilis subsp. subtilis str. NCIB 3610 plasmid pBS32, complete sequence	13998-14029	8	0.75
NZ_CP044458_1	1.17\|46279\|32\|NZ_CP044458\|PILER-CR,CRT	46279-46310	32	NZ_CP020103	Bacillus subtilis strain NCIB 3610 plasmid pBS32, complete sequence	5409-5440	8	0.75
NZ_CP044458_1	1.17\|46279\|32\|NZ_CP044458\|PILER-CR,CRT	46279-46310	32	NZ_AP019715	Bacillus subtilis subsp. subtilis strain NBRC 13719 plasmid pBSU1, complete sequence	65212-65243	8	0.75
NZ_CP044458_1	1.17\|46279\|32\|NZ_CP044458\|PILER-CR,CRT	46279-46310	32	NZ_CP034485	Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 strain NCIB 3610 plasmid unnamed, complete sequence	53780-53811	8	0.75
NZ_CP044458_1	1.17\|46279\|32\|NZ_CP044458\|PILER-CR,CRT	46279-46310	32	NZ_CP045923	Bacillus subtilis strain P8_B1 plasmid pBs003, complete sequence	11020-11051	8	0.75
NZ_CP044458_1	1.18\|46339\|32\|NZ_CP044458\|PILER-CR,CRT	46339-46370	32	NZ_CP046704	Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence	331618-331649	8	0.75
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP013040	Clostridium perfringens strain JP838 plasmid pJFP838C, complete sequence	54856-54887	8	0.75
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP033574	Shewanella algae strain KC-Na-R1 plasmid pKC-Na-R1, complete sequence	119828-119859	8	0.75
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP019793	Chlamydia gallinacea strain JX-1 plasmid pJX1, complete sequence	4839-4870	8	0.75
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP015841	Chlamydia gallinacea 08-1274/3 plasmid p1274, complete sequence	3898-3929	8	0.75
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	MN693547	Marine virus AFVG_25M424, complete genome	11685-11716	8	0.75
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	MK387309	Pseudoalteromonas phage C7, complete genome	32705-32736	8	0.75
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	MN693598	Marine virus AFVG_25M403, complete genome	8685-8716	8	0.75
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	MN693297	Marine virus AFVG_25M423, complete genome	7779-7810	8	0.75
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	MN693353	Marine virus AFVG_25M425, complete genome	19043-19074	8	0.75
NZ_CP044458_1	1.22\|46579\|32\|NZ_CP044458\|PILER-CR,CRT	46579-46610	32	MK759884	Salmonella phage vB_SenM_SB18, complete genome	69600-69631	8	0.75
NZ_CP044458_1	1.22\|46579\|32\|NZ_CP044458\|PILER-CR,CRT	46579-46610	32	NC_015292	Erwinia phage phiEa104, complete genome	69345-69376	8	0.75
NZ_CP044458_1	1.22\|46579\|32\|NZ_CP044458\|PILER-CR,CRT	46579-46610	32	MH426725	Erwinia phage SunLIRen, complete genome	69341-69372	8	0.75
NZ_CP044458_1	1.22\|46579\|32\|NZ_CP044458\|PILER-CR,CRT	46579-46610	32	FQ482083	Erwinia amylovora phage phiEa104 complete genome	69345-69376	8	0.75
NZ_CP044458_1	1.22\|46579\|32\|NZ_CP044458\|PILER-CR,CRT	46579-46610	32	HQ728263	Erwinia phage vB_EamM-M7, complete genome	52321-52352	8	0.75
NZ_CP044458_1	1.22\|46579\|32\|NZ_CP044458\|PILER-CR,CRT	46579-46610	32	NC_011811	Erwinia phage phiEa21-4, complete genome	69358-69389	8	0.75
NZ_CP044458_1	1.22\|46579\|32\|NZ_CP044458\|PILER-CR,CRT	46579-46610	32	MN604407	Salmonella phage ST-3, complete genome	43188-43219	8	0.75
NZ_CP044458_1	1.22\|46579\|32\|NZ_CP044458\|PILER-CR,CRT	46579-46610	32	MK770412	Salmonella phage SE5, complete genome	15440-15471	8	0.75
NZ_CP044458_1	1.27\|46881\|32\|NZ_CP044458\|PILER-CR,CRT	46881-46912	32	MT188223	Acinetobacter phage vB_AbaM_D22, complete genome	92045-92076	8	0.75
NZ_CP044458_1	1.3\|46279\|31\|NZ_CP044458\|CRISPRCasFinder	46279-46309	31	MF360958	Salicola phage SCTP-2, complete genome	96486-96516	9	0.71
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	LC425518	Uncultured phage DNA, contig: NODE577	3862-3892	9	0.71
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP045351	Vibrio sp. THAF100 plasmid pTHAF100_a, complete sequence	365616-365646	9	0.71
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	MK387309	Pseudoalteromonas phage C7, complete genome	32706-32736	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KY065496	Streptococcus phage IPP60, complete genome	3617-3647	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KY065466	Streptococcus phage IPP25, complete genome	3780-3810	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KY065476	Streptococcus phage IPP36, complete genome	3880-3910	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KY065475	Streptococcus phage IPP35, complete genome	3481-3511	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KY065472	Streptococcus phage IPP31, complete genome	3617-3647	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KT337353	Streptococcus phage phiARI0460-2, partial genome	38047-38077	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KY065474	Streptococcus phage IPP34, complete genome	3619-3649	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KY065477	Streptococcus phage IPP37, partial genome	3481-3511	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KT337349	Streptococcus phage phiARI0399, partial genome	36521-36551	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KY065452	Streptococcus phage IPP10, complete genome	3617-3647	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KY065499	Streptococcus phage IPP63, complete genome	4692-4722	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KY065473	Streptococcus phage IPP32, complete genome	4642-4672	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KT337356	Streptococcus phage phiARI0468-2, complete genome	38187-38217	9	0.71
NZ_CP044458_1	1.7\|46519\|31\|NZ_CP044458\|CRISPRCasFinder	46519-46549	31	KY065450	Streptococcus phage IPP8, complete genome	3619-3649	9	0.71
NZ_CP044458_1	1.8\|46579\|31\|NZ_CP044458\|CRISPRCasFinder	46579-46609	31	NC_014838	Pantoea sp. At-9b plasmid pPAT9B01, complete sequence	299165-299195	9	0.71
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	NC_007410	Trichormus variabilis ATCC 29413 plasmid A, complete sequence	139650-139681	9	0.719
NZ_CP044458_1	1.10\|46700\|32\|NZ_CP044458\|CRISPRCasFinder	46700-46731	32	NZ_CP047243	Trichormus variabilis 0441 plasmid unnamed1, complete sequence	145687-145718	9	0.719
NZ_CP044458_1	1.17\|46279\|32\|NZ_CP044458\|PILER-CR,CRT	46279-46310	32	MF360958	Salicola phage SCTP-2, complete genome	96486-96517	9	0.719
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP020425	Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence	29617-29648	9	0.719
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP029156	Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence	17129-17160	9	0.719
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP029153	Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence	11173-11204	9	0.719
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	FN668942	Clostridium difficile BI1 plasmid pCDBI1, complete sequence	28261-28292	9	0.719
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP011969	Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence	24939-24970	9	0.719
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP045351	Vibrio sp. THAF100 plasmid pTHAF100_a, complete sequence	365616-365647	9	0.719
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	AP014358	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C94, * SEQUENCING IN PROGRESS *	28867-28898	9	0.719
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	655574-655605	9	0.719
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	NZ_KX832926	Providencia rettgeri strain 16pre36 plasmid p16Pre36-1, complete sequence	21904-21935	9	0.719
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	NZ_CP026061	Proteus mirabilis strain FDAARGOS_80 plasmid unnamed2, complete sequence	17428-17459	9	0.719
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	NC_010555	Proteus mirabilis HI4320 plasmid pHI4320, complete sequence	15848-15879	9	0.719
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	NZ_CP021855	Proteus mirabilis strain AR_0156 plasmid unitig_3, complete sequence	16183-16214	9	0.719
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	NZ_MK941846	Proteus mirabilis strain PM1157 plasmid pOXA-23, complete sequence	51542-51573	9	0.719
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	NZ_MF150117	Proteus mirabilis strain A64421 plasmid pPM64421b, complete sequence	14991-15022	9	0.719
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	MN693756	Marine virus AFVG_250M718, complete genome	29701-29732	9	0.719
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	MN694439	Marine virus AFVG_250M296, complete genome	29295-29326	9	0.719
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	MN693803	Marine virus AFVG_250M716, complete genome	7503-7534	9	0.719
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	MN694282	Marine virus AFVG_250M297, complete genome	29307-29338	9	0.719
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	MN694541	Marine virus AFVG_250M717, complete genome	29710-29741	9	0.719
NZ_CP044458_1	1.26\|46821\|32\|NZ_CP044458\|PILER-CR,CRT	46821-46852	32	NZ_AP017978	Neochlamydia sp. S13 plasmid pS13, complete sequence	227428-227459	9	0.719
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP045351	Vibrio sp. THAF100 plasmid pTHAF100_a, complete sequence	898363-898393	10	0.677
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	KC465899	Pelagibacter phage HTVC008M, complete genome	145762-145792	10	0.677
NZ_CP044458_1	1.11\|46761\|31\|NZ_CP044458\|CRISPRCasFinder	46761-46791	31	NZ_MF078634	Acinetobacter pittii strain HGSA488 plasmid pLS488, complete sequence	1-22	10	0.677
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KY065496	Streptococcus phage IPP60, complete genome	3617-3648	10	0.688
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KY065466	Streptococcus phage IPP25, complete genome	3780-3811	10	0.688
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KY065476	Streptococcus phage IPP36, complete genome	3880-3911	10	0.688
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KY065475	Streptococcus phage IPP35, complete genome	3481-3512	10	0.688
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KY065472	Streptococcus phage IPP31, complete genome	3617-3648	10	0.688
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KT337353	Streptococcus phage phiARI0460-2, partial genome	38046-38077	10	0.688
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KY065474	Streptococcus phage IPP34, complete genome	3619-3650	10	0.688
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KY065477	Streptococcus phage IPP37, partial genome	3481-3512	10	0.688
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KT337349	Streptococcus phage phiARI0399, partial genome	36520-36551	10	0.688
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KY065452	Streptococcus phage IPP10, complete genome	3617-3648	10	0.688
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KY065499	Streptococcus phage IPP63, complete genome	4692-4723	10	0.688
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KY065473	Streptococcus phage IPP32, complete genome	4642-4673	10	0.688
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KT337356	Streptococcus phage phiARI0468-2, complete genome	38186-38217	10	0.688
NZ_CP044458_1	1.21\|46519\|32\|NZ_CP044458\|PILER-CR,CRT	46519-46550	32	KY065450	Streptococcus phage IPP8, complete genome	3619-3650	10	0.688
NZ_CP044458_1	1.22\|46579\|32\|NZ_CP044458\|PILER-CR,CRT	46579-46610	32	NC_014838	Pantoea sp. At-9b plasmid pPAT9B01, complete sequence	299164-299195	10	0.688
NZ_CP044458_1	1.25\|46761\|32\|NZ_CP044458\|PILER-CR,CRT	46761-46792	32	NZ_MF078634	Acinetobacter pittii strain HGSA488 plasmid pLS488, complete sequence	1-23	10	0.688
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NC_025097	Uncultured bacterium AST2 plasmid pAST2, complete sequence	11868-11898	11	0.645
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	MN657042	Psychrobacter sp. strain ANT_P18B plasmid pA18BP1, complete sequence	71-101	11	0.645
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	MN657064	Psychrobacter sp. strain ANT_P27 plasmid pA27P4, complete sequence	63-93	11	0.645
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	MN657067	Psychrobacter sp. strain ANT_P28 plasmid pA28P3, complete sequence	170-200	11	0.645
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	MN657076	Psychrobacter sp. strain ANT_P39B plasmid pA39BP2, complete sequence	71-101	11	0.645
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	MN657088	Psychrobacter sp. strain ANT_H3 plasmid pA3H8, complete sequence	71-101	11	0.645
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	MN657111	Psychrobacter sp. strain ANT_P52 plasmid pA52P3, complete sequence	72-102	11	0.645
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NC_021158	Psychrobacter maritimus plasmid pKLH80, strain MR29-12, complete sequence	1050-1080	11	0.645
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP012537	Psychrobacter sp. P11G5 plasmid pPspP11G5d, complete sequence	37-67	11	0.645
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NZ_CP012540	Psychrobacter sp. P11G5 plasmid pPspP11G5g, complete sequence	44-74	11	0.645
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NZ_CP045351	Vibrio sp. THAF100 plasmid pTHAF100_a, complete sequence	898362-898393	11	0.656
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	KC465899	Pelagibacter phage HTVC008M, complete genome	145761-145792	11	0.656
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	MN657102	Psychrobacter sp. strain ANT_P46 plasmid pA46P4, complete sequence	71-101	12	0.613
NZ_CP044458_1	1.6\|46459\|31\|NZ_CP044458\|CRISPRCasFinder	46459-46489	31	NC_015979	Lactobacillus sanfranciscensis TMW 1.1304 plasmid pLS1, complete sequence	49832-49862	14	0.548
NZ_CP044458_1	1.20\|46459\|32\|NZ_CP044458\|PILER-CR,CRT	46459-46490	32	NC_015979	Lactobacillus sanfranciscensis TMW 1.1304 plasmid pLS1, complete sequence	49832-49863	14	0.562

1. spacer 1.1|46159|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

gactaaacgtagattttttaagtaatattca	CRISPR spacer
gactaaacgtagattttttaagtaatattca	Protospacer
*******************************

2. spacer 1.1|46159|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gactaaacgtagattttttaagtaatattca	CRISPR spacer
gactaaacgtagattttttaagtaatattca	Protospacer
*******************************

3. spacer 1.2|46219|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

cgaaacatgcaatttgagggcttctgcgcgc	CRISPR spacer
cgaaacatgcaatttgagggcttctgcgcgc	Protospacer
*******************************

4. spacer 1.2|46219|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

cgaaacatgcaatttgagggcttctgcgcgc	CRISPR spacer
cgaaacatgcaatttgagggcttctgcgcgc	Protospacer
*******************************

5. spacer 1.3|46279|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

atgaaaatttgatggctgtttgatgattggg	CRISPR spacer
atgaaaatttgatggctgtttgatgattggg	Protospacer
*******************************

6. spacer 1.3|46279|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

atgaaaatttgatggctgtttgatgattggg	CRISPR spacer
atgaaaatttgatggctgtttgatgattggg	Protospacer
*******************************

7. spacer 1.4|46339|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

ggatgaacaaacatgcttttcaattactgca	CRISPR spacer
ggatgaacaaacatgcttttcaattactgca	Protospacer
*******************************

8. spacer 1.4|46339|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggatgaacaaacatgcttttcaattactgca	CRISPR spacer
ggatgaacaaacatgcttttcaattactgca	Protospacer
*******************************

9. spacer 1.5|46399|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

catatgattgtttatatcgttccgtttgacg	CRISPR spacer
catatgattgtttatatcgttccgtttgacg	Protospacer
*******************************

10. spacer 1.5|46399|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

catatgattgtttatatcgttccgtttgacg	CRISPR spacer
catatgattgtttatatcgttccgtttgacg	Protospacer
*******************************

11. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaagcttttcttttatta	Protospacer
*******************************

12. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaagcttttcttttatta	Protospacer
*******************************

13. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagcagaaaggaaaatagcacta	Protospacer
*******************************

14. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagcagaaaggaaaatagcacta	Protospacer
*******************************

15. spacer 1.8|46579|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

ccccctttctgcaacgtcacccccttttgtc	CRISPR spacer
ccccctttctgcaacgtcacccccttttgtc	Protospacer
*******************************

16. spacer 1.8|46579|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

ccccctttctgcaacgtcacccccttttgtc	CRISPR spacer
ccccctttctgcaacgtcacccccttttgtc	Protospacer
*******************************

17. spacer 1.9|46639|32|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

atgcaattattaattcatacaaacggattgca	CRISPR spacer
atgcaattattaattcatacaaacggattgca	Protospacer
********************************

18. spacer 1.9|46639|32|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

atgcaattattaattcatacaaacggattgca	CRISPR spacer
atgcaattattaattcatacaaacggattgca	Protospacer
********************************

19. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
ttatgcttggtggacagcaatttgttttactt	Protospacer
********************************

20. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
ttatgcttggtggacagcaatttgttttactt	Protospacer
********************************

21. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatacttaacctgggcc	Protospacer
*******************************

22. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatacttaacctgggcc	Protospacer
*******************************

23. spacer 1.12|46821|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

aggggccagccgaacaaattaaattagcaag	CRISPR spacer
aggggccagccgaacaaattaaattagcaag	Protospacer
*******************************

24. spacer 1.12|46821|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

aggggccagccgaacaaattaaattagcaag	CRISPR spacer
aggggccagccgaacaaattaaattagcaag	Protospacer
*******************************

25. spacer 1.13|46881|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtcaaaagttatggaaaagttttgaagcttg	CRISPR spacer
gtcaaaagttatggaaaagttttgaagcttg	Protospacer
*******************************

26. spacer 1.13|46881|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtcaaaagttatggaaaagttttgaagcttg	CRISPR spacer
gtcaaaagttatggaaaagttttgaagcttg	Protospacer
*******************************

27. spacer 1.14|46941|26|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

tttgtaaaacaagttgactgttactt	CRISPR spacer
tttgtaaaacaagttgactgttactt	Protospacer
**************************

28. spacer 1.14|46941|26|NZ_CP044458|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

tttgtaaaacaagttgactgttactt	CRISPR spacer
tttgtaaaacaagttgactgttactt	Protospacer
**************************

29. spacer 1.15|46159|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

gactaaacgtagattttttaagtaatattcaa	CRISPR spacer
gactaaacgtagattttttaagtaatattcaa	Protospacer
********************************

30. spacer 1.15|46159|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gactaaacgtagattttttaagtaatattcaa	CRISPR spacer
gactaaacgtagattttttaagtaatattcaa	Protospacer
********************************

31. spacer 1.16|46219|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

cgaaacatgcaatttgagggcttctgcgcgca	CRISPR spacer
cgaaacatgcaatttgagggcttctgcgcgca	Protospacer
********************************

32. spacer 1.16|46219|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

cgaaacatgcaatttgagggcttctgcgcgca	CRISPR spacer
cgaaacatgcaatttgagggcttctgcgcgca	Protospacer
********************************

33. spacer 1.17|46279|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

atgaaaatttgatggctgtttgatgattggga	CRISPR spacer
atgaaaatttgatggctgtttgatgattggga	Protospacer
********************************

34. spacer 1.17|46279|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

atgaaaatttgatggctgtttgatgattggga	CRISPR spacer
atgaaaatttgatggctgtttgatgattggga	Protospacer
********************************

35. spacer 1.18|46339|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

ggatgaacaaacatgcttttcaattactgcaa	CRISPR spacer
ggatgaacaaacatgcttttcaattactgcaa	Protospacer
********************************

36. spacer 1.18|46339|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggatgaacaaacatgcttttcaattactgcaa	CRISPR spacer
ggatgaacaaacatgcttttcaattactgcaa	Protospacer
********************************

37. spacer 1.19|46399|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

catatgattgtttatatcgttccgtttgacga	CRISPR spacer
catatgattgtttatatcgttccgtttgacga	Protospacer
********************************

38. spacer 1.19|46399|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

catatgattgtttatatcgttccgtttgacga	CRISPR spacer
catatgattgtttatatcgttccgtttgacga	Protospacer
********************************

39. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
ttaaaagcatttaaaagcttttcttttattaa	Protospacer
********************************

40. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
ttaaaagcatttaaaagcttttcttttattaa	Protospacer
********************************

41. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagcagaaaggaaaatagcactag	Protospacer
********************************

42. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagcagaaaggaaaatagcactag	Protospacer
********************************

43. spacer 1.22|46579|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

ccccctttctgcaacgtcacccccttttgtct	CRISPR spacer
ccccctttctgcaacgtcacccccttttgtct	Protospacer
********************************

44. spacer 1.22|46579|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

ccccctttctgcaacgtcacccccttttgtct	CRISPR spacer
ccccctttctgcaacgtcacccccttttgtct	Protospacer
********************************

45. spacer 1.23|46639|33|NZ_CP044458|PILER-CR,CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

atgcaattattaattcatacaaacggattgcat	CRISPR spacer
atgcaattattaattcatacaaacggattgcat	Protospacer
*********************************

46. spacer 1.23|46639|33|NZ_CP044458|PILER-CR,CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

atgcaattattaattcatacaaacggattgcat	CRISPR spacer
atgcaattattaattcatacaaacggattgcat	Protospacer
*********************************

47. spacer 1.24|46700|33|NZ_CP044458|PILER-CR,CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

ttatgcttggtggacagcaatttgttttacttg	CRISPR spacer
ttatgcttggtggacagcaatttgttttacttg	Protospacer
*********************************

48. spacer 1.24|46700|33|NZ_CP044458|PILER-CR,CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttatgcttggtggacagcaatttgttttacttg	CRISPR spacer
ttatgcttggtggacagcaatttgttttacttg	Protospacer
*********************************

49. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatacttaacctgggcca	Protospacer
********************************

50. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatacttaacctgggcca	Protospacer
********************************

51. spacer 1.26|46821|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

aggggccagccgaacaaattaaattagcaaga	CRISPR spacer
aggggccagccgaacaaattaaattagcaaga	Protospacer
********************************

52. spacer 1.26|46821|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

aggggccagccgaacaaattaaattagcaaga	CRISPR spacer
aggggccagccgaacaaattaaattagcaaga	Protospacer
********************************

53. spacer 1.27|46881|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtcaaaagttatggaaaagttttgaagcttgg	CRISPR spacer
gtcaaaagttatggaaaagttttgaagcttgg	Protospacer
********************************

54. spacer 1.27|46881|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtcaaaagttatggaaaagttttgaagcttgg	CRISPR spacer
gtcaaaagttatggaaaagttttgaagcttgg	Protospacer
********************************

55. spacer 1.28|46941|27|NZ_CP044458|CRT matches to NZ_CP044458 (Acinetobacter indicus strain B18 plasmid pB18-3, complete sequence) position: , mismatch: 0, identity: 1.0

tttgtaaaacaagttgactgttacttc	CRISPR spacer
tttgtaaaacaagttgactgttacttc	Protospacer
***************************

56. spacer 1.28|46941|27|NZ_CP044458|CRT matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 0, identity: 1.0

tttgtaaaacaagttgactgttacttc	CRISPR spacer
tttgtaaaacaagttgactgttacttc	Protospacer
***************************

57. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP034096 (Acinetobacter baumannii strain A52 plasmid pA52-4, complete sequence) position: , mismatch: 1, identity: 0.968

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ctaaaagcatttaaaagcttttcttttatta	Protospacer
.******************************

58. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_KX118105 (Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcc	Protospacer
*****************.*************

59. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_KX118105 (Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcc	Protospacer
*****************.*************

60. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_KX118105 (Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcc	Protospacer
*****************.*************

61. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_KX118105 (Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcc	Protospacer
*****************.*************

62. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_KX118105 (Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcc	Protospacer
*****************.*************

63. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_KX118105 (Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcc	Protospacer
*****************.*************

64. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcc	Protospacer
*****************.*************

65. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcc	Protospacer
*****************.*************

66. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcc	Protospacer
*****************.*************

67. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcc	Protospacer
*****************.*************

68. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcc	Protospacer
*****************.*************

69. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcc	Protospacer
*****************.*************

70. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcc	Protospacer
*****************.*************

71. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 1, identity: 0.968

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatacttaacctgagcc	Protospacer
***************************.***

72. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP034096 (Acinetobacter baumannii strain A52 plasmid pA52-4, complete sequence) position: , mismatch: 1, identity: 0.969

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
ctaaaagcatttaaaagcttttcttttattaa	Protospacer
.*******************************

73. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_KX118105 (Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcca	Protospacer
*****************.**************

74. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_KX118105 (Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcca	Protospacer
*****************.**************

75. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_KX118105 (Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcca	Protospacer
*****************.**************

76. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_KX118105 (Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcca	Protospacer
*****************.**************

77. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_KX118105 (Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcca	Protospacer
*****************.**************

78. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_KX118105 (Acinetobacter baumannii strain IHIT7853 plasmid IHIT7853-OXA-23, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcca	Protospacer
*****************.**************

79. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcca	Protospacer
*****************.**************

80. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcca	Protospacer
*****************.**************

81. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcca	Protospacer
*****************.**************

82. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcca	Protospacer
*****************.**************

83. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcca	Protospacer
*****************.**************

84. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcca	Protospacer
*****************.**************

85. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP037425 (Acinetobacter johnsonii strain M19 plasmid pFM-M19, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcca	Protospacer
*****************.**************

86. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 1, identity: 0.969

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatacttaacctgagcca	Protospacer
***************************.****

87. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.935

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggct	Protospacer
*****************.************.

88. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.935

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggct	Protospacer
*****************.************.

89. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.935

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggct	Protospacer
*****************.************.

90. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.935

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggct	Protospacer
*****************.************.

91. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.935

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggct	Protospacer
*****************.************.

92. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.935

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggct	Protospacer
*****************.************.

93. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.935

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggct	Protospacer
*****************.************.

94. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.935

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggct	Protospacer
*****************.************.

95. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.935

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggct	Protospacer
*****************.************.

96. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.935

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggct	Protospacer
*****************.************.

97. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.935

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggct	Protospacer
*****************.************.

98. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.935

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatncttaacctgggct	Protospacer
***************** ************.

99. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.935

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
ttttgcctggtacacatgcttaacctgggct	Protospacer
*****************.************.

100. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.938

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcta	Protospacer
*****************.************.*

101. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.938

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcta	Protospacer
*****************.************.*

102. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.938

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcta	Protospacer
*****************.************.*

103. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.938

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcta	Protospacer
*****************.************.*

104. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.938

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcta	Protospacer
*****************.************.*

105. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.938

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcta	Protospacer
*****************.************.*

106. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.938

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcta	Protospacer
*****************.************.*

107. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.938

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcta	Protospacer
*****************.************.*

108. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.938

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcta	Protospacer
*****************.************.*

109. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.938

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcta	Protospacer
*****************.************.*

110. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.938

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcta	Protospacer
*****************.************.*

111. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.938

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatncttaacctgggcta	Protospacer
***************** ************.*

112. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP032117 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.2, complete sequence) position: , mismatch: 2, identity: 0.938

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
ttttgcctggtacacatgcttaacctgggcta	Protospacer
*****************.************.*

113. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP030107 (Acinetobacter baumannii strain DA33382 plasmid pDA33382-2-2, complete sequence) position: , mismatch: 3, identity: 0.903

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ctaaaagcatttaaaagcttttttattatta	Protospacer
.*********************.* ******

114. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP016903 (Acinetobacter soli strain GFJ2 plasmid pGFJ7, complete sequence) position: , mismatch: 3, identity: 0.903

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ctaaaagcatttaaaagcttttttattatta	Protospacer
.*********************.* ******

115. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP030107 (Acinetobacter baumannii strain DA33382 plasmid pDA33382-2-2, complete sequence) position: , mismatch: 3, identity: 0.906

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
ctaaaagcatttaaaagcttttttattattaa	Protospacer
.*********************.* *******

116. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP016903 (Acinetobacter soli strain GFJ2 plasmid pGFJ7, complete sequence) position: , mismatch: 3, identity: 0.906

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
ctaaaagcatttaaaagcttttttattattaa	Protospacer
.*********************.* *******

117. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to AP013736 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S46-C31, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.812

ttaaaagca--tttaaaagcttttcttttattaa	CRISPR spacer
--aacaccatctttaaaaacttttcttttataaa	Protospacer
  ** * **  *******.************ **

118. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to AP013728 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S24-C174, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.812

ttaaaagca--tttaaaagcttttcttttattaa	CRISPR spacer
--aacaccatctttaaaaacttttcttttataaa	Protospacer
  ** * **  *******.************ **

119. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to AP013730 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S30-C21, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.812

ttaaaagca--tttaaaagcttttcttttattaa	CRISPR spacer
--aacaccatctttaaaaacttttcttttataaa	Protospacer
  ** * **  *******.************ **

120. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to AP013733 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S37-C24, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.812

ttaaaagca--tttaaaagcttttcttttattaa	CRISPR spacer
--aacaccatctttaaaaacttttcttttataaa	Protospacer
  ** * **  *******.************ **

121. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to AP013735 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S43-C92, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.812

ttaaaagca--tttaaaagcttttcttttattaa	CRISPR spacer
--aacaccatctttaaaaacttttcttttataaa	Protospacer
  ** * **  *******.************ **

122. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to AP013444 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G17, isolate: uvMED-CGR-C32A-MedDCM-OCT-S40-C23) position: , mismatch: 6, identity: 0.812

ttaaaagca--tttaaaagcttttcttttattaa	CRISPR spacer
--aacaccatctttaaaaacttttcttttataaa	Protospacer
  ** * **  *******.************ **

123. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to AP013734 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S39-C27, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.812

ttaaaagca--tttaaaagcttttcttttattaa	CRISPR spacer
--aacaccatctttaaaaacttttcttttataaa	Protospacer
  ** * **  *******.************ **

124. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to AP013731 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S32-C100, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.812

ttaaaagca--tttaaaagcttttcttttattaa	CRISPR spacer
--aacaccatctttaaaaacttttcttttataaa	Protospacer
  ** * **  *******.************ **

125. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to AP013729 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C32A-MedDCM-OCT-S27-C31, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.812

ttaaaagca--tttaaaagcttttcttttattaa	CRISPR spacer
--aacaccatctttaaaaacttttcttttataaa	Protospacer
  ** * **  *******.************ **

126. spacer 1.3|46279|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP045822 (Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence) position: , mismatch: 7, identity: 0.774

atgaaaatttgatggctgtttgatgattggg	CRISPR spacer
attgaaattttatgtctgtttgatgatccag	Protospacer
** .****** *** ************. .*

127. spacer 1.3|46279|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP045813 (Bacillus subtilis strain P8_B3 plasmid pBs005, complete sequence) position: , mismatch: 7, identity: 0.774

atgaaaatttgatggctgtttgatgattggg	CRISPR spacer
attgaaattttatgtctgtttgatgatccag	Protospacer
** .****** *** ************. .*

128. spacer 1.3|46279|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP041758 (Bacillus sp. KBS0812 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

atgaaaatttgatggctgtttgatgattggg	CRISPR spacer
attgaaattttatgtctgtttgatgatccag	Protospacer
** .****** *** ************. .*

129. spacer 1.3|46279|31|NZ_CP044458|CRISPRCasFinder matches to NC_021809 (Bacillus subtilis subsp. subtilis str. NCIB 3610 plasmid pBS32, complete sequence) position: , mismatch: 7, identity: 0.774

atgaaaatttgatggctgtttgatgattggg	CRISPR spacer
attgaaattttatgtctgtttgatgatccag	Protospacer
** .****** *** ************. .*

130. spacer 1.3|46279|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP020103 (Bacillus subtilis strain NCIB 3610 plasmid pBS32, complete sequence) position: , mismatch: 7, identity: 0.774

atgaaaatttgatggctgtttgatgattggg	CRISPR spacer
attgaaattttatgtctgtttgatgatccag	Protospacer
** .****** *** ************. .*

131. spacer 1.3|46279|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP034485 (Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 strain NCIB 3610 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

atgaaaatttgatggctgtttgatgattggg	CRISPR spacer
attgaaattttatgtctgtttgatgatccag	Protospacer
** .****** *** ************. .*

132. spacer 1.3|46279|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP045923 (Bacillus subtilis strain P8_B1 plasmid pBs003, complete sequence) position: , mismatch: 7, identity: 0.774

atgaaaatttgatggctgtttgatgattggg	CRISPR spacer
attgaaattttatgtctgtttgatgatccag	Protospacer
** .****** *** ************. .*

133. spacer 1.3|46279|31|NZ_CP044458|CRISPRCasFinder matches to NZ_AP019715 (Bacillus subtilis subsp. subtilis strain NBRC 13719 plasmid pBSU1, complete sequence) position: , mismatch: 7, identity: 0.774

atgaaaatttgatggctgtttgatgattggg	CRISPR spacer
attgaaattttatgtctgtttgatgatccag	Protospacer
** .****** *** ************. .*

134. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_MK275621 (Clostridium perfringens strain JXJA17 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.774

ttaaa---agcatttaaaagcttttcttttatta	CRISPR spacer
---aatttattttttaaaaacttttcttttatta	Protospacer
   **   * . *******.**************

135. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP013041 (Clostridium perfringens strain JP55 plasmid pJFP55F, complete sequence) position: , mismatch: 7, identity: 0.774

ttaaa---agcatttaaaagcttttcttttatta	CRISPR spacer
---aatttattttttaaaatcttttcttttatta	Protospacer
   **   * . ******* **************

136. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to MN693353 (Marine virus AFVG_25M425, complete genome) position: , mismatch: 7, identity: 0.774

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
aaaagaacatttaaaagcttttcttggttta	Protospacer
  **.*.******************   ***

137. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to MN693547 (Marine virus AFVG_25M424, complete genome) position: , mismatch: 7, identity: 0.774

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
aaaagaacatttaaaagcttttcttggttta	Protospacer
  **.*.******************   ***

138. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to MN693598 (Marine virus AFVG_25M403, complete genome) position: , mismatch: 7, identity: 0.774

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
aaaagaacatttaaaagcttttcttggttta	Protospacer
  **.*.******************   ***

139. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to MN693297 (Marine virus AFVG_25M423, complete genome) position: , mismatch: 7, identity: 0.774

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
aaaagaacatttaaaagcttttcttggttta	Protospacer
  **.*.******************   ***

140. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP028874 (Borreliella bavariensis PBi plasmid lp25_cp32-3, complete sequence) position: , mismatch: 7, identity: 0.774

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaagagaagaaaggaaaaaattaaga	Protospacer
********.** *********** * .*  *

141. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to NC_017225 (Borreliella afzelii PKo plasmid cp32-12, complete sequence) position: , mismatch: 7, identity: 0.774

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaagagaagaaaggaaaaaattaaga	Protospacer
********.** *********** * .*  *

142. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044485 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-2, complete sequence) position: , mismatch: 7, identity: 0.781

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
taatgcttggcggtcagcaatttgtacttctg	Protospacer
* ********.** *********** .* **

143. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to KT325596 (Uncultured bacterium plasmid pFK2-7, complete sequence) position: , mismatch: 7, identity: 0.781

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
taatgcttggcggtcagcaatttgtacttctg	Protospacer
* ********.** *********** .* **

144. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to NZ_CP038024 (Acinetobacter radioresistens strain DD78 plasmid pAR2, complete sequence) position: , mismatch: 7, identity: 0.781

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
taatgcttggcggtcagcaatttgtacttctg	Protospacer
* ********.** *********** .* **

145. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to NZ_CP010903 (Acinetobacter nosocomialis strain 6411 plasmid p6411-66.409kb, complete sequence) position: , mismatch: 7, identity: 0.781

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
taatgcttggcggtcagcaatttgtacttctg	Protospacer
* ********.** *********** .* **

146. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to MK978162 (Acinetobacter lwoffii strain M2a plasmid pAVAci14, complete sequence) position: , mismatch: 7, identity: 0.781

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
taatgcttggcggtcagcaatttgtacttctg	Protospacer
* ********.** *********** .* **

147. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to NZ_CP051870 (Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_1, complete sequence) position: , mismatch: 7, identity: 0.781

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
taatgcttggcggtcagcaatttgtacttctg	Protospacer
* ********.** *********** .* **

148. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to NC_019217 (Uncultured bacterium HHV216 plasmid pHHV216, complete sequence) position: , mismatch: 7, identity: 0.781

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
taatgcttggcggtcagcaatttgtacttctg	Protospacer
* ********.** *********** .* **

149. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to NC_019218 (Uncultured bacterium HHV35 plasmid pHHV35, complete sequence) position: , mismatch: 7, identity: 0.781

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
taatgcttggcggtcagcaatttgtacttctg	Protospacer
* ********.** *********** .* **

150. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to NC_019299 (Uncultured bacterium HH1107 plasmid pHH1107, complete sequence) position: , mismatch: 7, identity: 0.781

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
taatgcttggcggtcagcaatttgtacttctg	Protospacer
* ********.** *********** .* **

151. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to NZ_CP044465 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-2, complete sequence) position: , mismatch: 7, identity: 0.781

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
taatgcttggcggtcagcaatttgtacttctg	Protospacer
* ********.** *********** .* **

152. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to NZ_CP041290 (Acinetobacter indicus strain 94-2 plasmid p94-2-tetX3, complete sequence) position: , mismatch: 7, identity: 0.781

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
taatgcttggcggtcagcaatttgtacttctg	Protospacer
* ********.** *********** .* **

153. spacer 1.13|46881|31|NZ_CP044458|CRISPRCasFinder matches to MT188223 (Acinetobacter phage vB_AbaM_D22, complete genome) position: , mismatch: 7, identity: 0.774

gtcaaaagttatggaaaagttttgaagcttg	CRISPR spacer
gcaaaaagttttgaaaaagttttgaaagttt	Protospacer
*. ******* **.************. **

154. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_MK275621 (Clostridium perfringens strain JXJA17 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.781

ttaaa---agcatttaaaagcttttcttttattaa	CRISPR spacer
---aatttattttttaaaaacttttcttttattaa	Protospacer
   **   * . *******.***************

155. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP013041 (Clostridium perfringens strain JP55 plasmid pJFP55F, complete sequence) position: , mismatch: 7, identity: 0.781

ttaaa---agcatttaaaagcttttcttttattaa	CRISPR spacer
---aatttattttttaaaatcttttcttttattaa	Protospacer
   **   * . ******* ***************

156. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP009059 (Borreliella afzelii K78 plasmid lp54, complete sequence) position: , mismatch: 7, identity: 0.781

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
tttaatttttttaaaaacttttctattattaa	Protospacer
** **  . *******.******* *******

157. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP009214 (Borreliella afzelii Tom3107 plasmid lp54, complete sequence) position: , mismatch: 7, identity: 0.781

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
tttaatttttttaaaaacttttctattattaa	Protospacer
** **  . *******.******* *******

158. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NC_017241 (Borreliella afzelii PKo plasmid lp54, complete sequence) position: , mismatch: 7, identity: 0.781

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
tttaatttttttaaaaacttttctattattaa	Protospacer
** **  . *******.******* *******

159. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP028874 (Borreliella bavariensis PBi plasmid lp25_cp32-3, complete sequence) position: , mismatch: 7, identity: 0.781

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaagagaagaaaggaaaaaattaagag	Protospacer
********.** *********** * .*  **

160. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to NC_017225 (Borreliella afzelii PKo plasmid cp32-12, complete sequence) position: , mismatch: 7, identity: 0.781

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaagagaagaaaggaaaaaattaagag	Protospacer
********.** *********** * .*  **

161. spacer 1.4|46339|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP046704 (Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence) position: , mismatch: 8, identity: 0.742

ggatgaacaaacatgcttttcaattactgca	CRISPR spacer
taaataacaaatatgcttatcaattactggg	Protospacer
 .*  ******.****** ********** .

162. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP013040 (Clostridium perfringens strain JP838 plasmid pJFP838C, complete sequence) position: , mismatch: 8, identity: 0.742

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
atttatttttttaaaatcttttcttttatta	Protospacer
 *  *  . ******* **************

163. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP029156 (Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaggcttgtctgacacgt	Protospacer
***************.**** ***  .*.

164. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP029153 (Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaggcttgtctgacacgt	Protospacer
***************.**** ***  .*.

165. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP015841 (Chlamydia gallinacea 08-1274/3 plasmid p1274, complete sequence) position: , mismatch: 8, identity: 0.742

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
acaaaagcatttaaacacttttctttgtcaa	Protospacer
 .************* .*********  . *

166. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP020425 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaggcttgtctgacgtgt	Protospacer
***************.**** ***  ..*

167. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to FN668942 (Clostridium difficile BI1 plasmid pCDBI1, complete sequence) position: , mismatch: 8, identity: 0.742

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaggcttgtctgacgtgt	Protospacer
***************.**** ***  ..*

168. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP033574 (Shewanella algae strain KC-Na-R1 plasmid pKC-Na-R1, complete sequence) position: , mismatch: 8, identity: 0.742

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
gtcaaagcattcaaaagctcttcttttgagt	Protospacer
 * ********.*******.*******.

169. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP019793 (Chlamydia gallinacea strain JX-1 plasmid pJX1, complete sequence) position: , mismatch: 8, identity: 0.742

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
acaaaagcatttaaacacttttctttgtcaa	Protospacer
 .************* .*********  . *

170. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP011969 (Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaggcttgtctgacgtgt	Protospacer
***************.**** ***  ..*

171. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to AP014358 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C94, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.742

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
tctatgtcatttaaaagctgatcttttattg	Protospacer
*. * . ************  *********.

172. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to NZ_KX832926 (Providencia rettgeri strain 16pre36 plasmid p16Pre36-1, complete sequence) position: , mismatch: 8, identity: 0.742

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
aatagaaaaatcaaaaaggaaaatagagttt	Protospacer
*..******* **.************ ..*

173. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP026061 (Proteus mirabilis strain FDAARGOS_80 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
aatagaaaaatcaaaaaggaaaatagagttt	Protospacer
*..******* **.************ ..*

174. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to NC_010555 (Proteus mirabilis HI4320 plasmid pHI4320, complete sequence) position: , mismatch: 8, identity: 0.742

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
aatagaaaaatcaaaaaggaaaatagagttt	Protospacer
*..******* **.************ ..*

175. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP021855 (Proteus mirabilis strain AR_0156 plasmid unitig_3, complete sequence) position: , mismatch: 8, identity: 0.742

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
aatagaaaaatcaaaaaggaaaatagagttt	Protospacer
*..******* **.************ ..*

176. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to NZ_MK941846 (Proteus mirabilis strain PM1157 plasmid pOXA-23, complete sequence) position: , mismatch: 8, identity: 0.742

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
aatagaaaaatcaaaaaggaaaatagagttt	Protospacer
*..******* **.************ ..*

177. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to NZ_MF150117 (Proteus mirabilis strain A64421 plasmid pPM64421b, complete sequence) position: , mismatch: 8, identity: 0.742

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
aatagaaaaatcaaaaaggaaaatagagttt	Protospacer
*..******* **.************ ..*

178. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to MN693756 (Marine virus AFVG_250M718, complete genome) position: , mismatch: 8, identity: 0.742

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
attgaaaaaatcagaaaggaaaaaagcatga	Protospacer
* ...***** ************ ****. *

179. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to MN694439 (Marine virus AFVG_250M296, complete genome) position: , mismatch: 8, identity: 0.742

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
attgaaaaaatcagaaaggaaaaaagcatga	Protospacer
* ...***** ************ ****. *

180. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to MN693803 (Marine virus AFVG_250M716, complete genome) position: , mismatch: 8, identity: 0.742

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
attgaaaaaatcagaaaggaaaaaagcatga	Protospacer
* ...***** ************ ****. *

181. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to MN694282 (Marine virus AFVG_250M297, complete genome) position: , mismatch: 8, identity: 0.742

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
attgaaaaaatcagaaaggaaaaaagcatga	Protospacer
* ...***** ************ ****. *

182. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to MN694541 (Marine virus AFVG_250M717, complete genome) position: , mismatch: 8, identity: 0.742

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
attgaaaaaatcagaaaggaaaaaagcatga	Protospacer
* ...***** ************ ****. *

183. spacer 1.8|46579|31|NZ_CP044458|CRISPRCasFinder matches to MK759884 (Salmonella phage vB_SenM_SB18, complete genome) position: , mismatch: 8, identity: 0.742

ccccctttctgcaacgtcacccccttttgtc	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgag	Protospacer
 .**..*************** ****.**

184. spacer 1.8|46579|31|NZ_CP044458|CRISPRCasFinder matches to NC_015292 (Erwinia phage phiEa104, complete genome) position: , mismatch: 8, identity: 0.742

ccccctttctgcaacgtcacccccttttgtc	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgag	Protospacer
 .**..*************** ****.**

185. spacer 1.8|46579|31|NZ_CP044458|CRISPRCasFinder matches to MH426725 (Erwinia phage SunLIRen, complete genome) position: , mismatch: 8, identity: 0.742

ccccctttctgcaacgtcacccccttttgtc	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgag	Protospacer
 .**..*************** ****.**

186. spacer 1.8|46579|31|NZ_CP044458|CRISPRCasFinder matches to FQ482083 (Erwinia amylovora phage phiEa104 complete genome) position: , mismatch: 8, identity: 0.742

ccccctttctgcaacgtcacccccttttgtc	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgag	Protospacer
 .**..*************** ****.**

187. spacer 1.8|46579|31|NZ_CP044458|CRISPRCasFinder matches to HQ728263 (Erwinia phage vB_EamM-M7, complete genome) position: , mismatch: 8, identity: 0.742

ccccctttctgcaacgtcacccccttttgtc	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgag	Protospacer
 .**..*************** ****.**

188. spacer 1.8|46579|31|NZ_CP044458|CRISPRCasFinder matches to NC_011811 (Erwinia phage phiEa21-4, complete genome) position: , mismatch: 8, identity: 0.742

ccccctttctgcaacgtcacccccttttgtc	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgag	Protospacer
 .**..*************** ****.**

189. spacer 1.8|46579|31|NZ_CP044458|CRISPRCasFinder matches to MN604407 (Salmonella phage ST-3, complete genome) position: , mismatch: 8, identity: 0.742

ccccctttctgcaacgtcacccccttttgtc	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgag	Protospacer
 .**..*************** ****.**

190. spacer 1.8|46579|31|NZ_CP044458|CRISPRCasFinder matches to MK770412 (Salmonella phage SE5, complete genome) position: , mismatch: 8, identity: 0.742

ccccctttctgcaacgtcacccccttttgtc	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgag	Protospacer
 .**..*************** ****.**

191. spacer 1.9|46639|32|NZ_CP044458|CRISPRCasFinder matches to MN694484 (Marine virus AFVG_250M1201, complete genome) position: , mismatch: 8, identity: 0.75

atgc-aattattaattcatacaaacggattgca	CRISPR spacer
-tacaaattattaattgatacaaaaggaaaact	Protospacer
 *.* *********** ******* ***  .*

192. spacer 1.12|46821|31|NZ_CP044458|CRISPRCasFinder matches to NZ_AP017978 (Neochlamydia sp. S13 plasmid pS13, complete sequence) position: , mismatch: 8, identity: 0.742

aggggc-----cagccgaacaaattaaattagcaag	CRISPR spacer
-----cttttgcagccgaacaaattgaaatagcaat	Protospacer
     *     **************.** ******

193. spacer 1.15|46159|32|NZ_CP044458|PILER-CR,CRT matches to AP018320 (Nostoc sp. HK-01 plasmid plasmid2 DNA, complete genome) position: , mismatch: 8, identity: 0.75

gactaaacgtagattttttaagtaatattcaa	CRISPR spacer
ctctatcattagattttttaaataagattcaa	Protospacer
  ***    ************.*** ******

194. spacer 1.15|46159|32|NZ_CP044458|PILER-CR,CRT matches to MN180251 (UNVERIFIED: Wolbachia phage WO isolate Seq2wOMel_KL2 genomic sequence) position: , mismatch: 8, identity: 0.75

gactaaacgtagattttttaagtaatattcaa	CRISPR spacer
tacaggatatagagtttttaagtactattcaa	Protospacer
 ** ..*..**** ********** *******

195. spacer 1.17|46279|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP045822 (Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence) position: , mismatch: 8, identity: 0.75

atgaaaatttgatggctgtttgatgattggga	CRISPR spacer
attgaaattttatgtctgtttgatgatccagg	Protospacer
** .****** *** ************. .*.

196. spacer 1.17|46279|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP045813 (Bacillus subtilis strain P8_B3 plasmid pBs005, complete sequence) position: , mismatch: 8, identity: 0.75

atgaaaatttgatggctgtttgatgattggga	CRISPR spacer
attgaaattttatgtctgtttgatgatccagg	Protospacer
** .****** *** ************. .*.

197. spacer 1.17|46279|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP041758 (Bacillus sp. KBS0812 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

atgaaaatttgatggctgtttgatgattggga	CRISPR spacer
attgaaattttatgtctgtttgatgatccagg	Protospacer
** .****** *** ************. .*.

198. spacer 1.17|46279|32|NZ_CP044458|PILER-CR,CRT matches to NC_021809 (Bacillus subtilis subsp. subtilis str. NCIB 3610 plasmid pBS32, complete sequence) position: , mismatch: 8, identity: 0.75

atgaaaatttgatggctgtttgatgattggga	CRISPR spacer
attgaaattttatgtctgtttgatgatccagg	Protospacer
** .****** *** ************. .*.

199. spacer 1.17|46279|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP020103 (Bacillus subtilis strain NCIB 3610 plasmid pBS32, complete sequence) position: , mismatch: 8, identity: 0.75

atgaaaatttgatggctgtttgatgattggga	CRISPR spacer
attgaaattttatgtctgtttgatgatccagg	Protospacer
** .****** *** ************. .*.

200. spacer 1.17|46279|32|NZ_CP044458|PILER-CR,CRT matches to NZ_AP019715 (Bacillus subtilis subsp. subtilis strain NBRC 13719 plasmid pBSU1, complete sequence) position: , mismatch: 8, identity: 0.75

atgaaaatttgatggctgtttgatgattggga	CRISPR spacer
attgaaattttatgtctgtttgatgatccagg	Protospacer
** .****** *** ************. .*.

201. spacer 1.17|46279|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP034485 (Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 strain NCIB 3610 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

atgaaaatttgatggctgtttgatgattggga	CRISPR spacer
attgaaattttatgtctgtttgatgatccagg	Protospacer
** .****** *** ************. .*.

202. spacer 1.17|46279|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP045923 (Bacillus subtilis strain P8_B1 plasmid pBs003, complete sequence) position: , mismatch: 8, identity: 0.75

atgaaaatttgatggctgtttgatgattggga	CRISPR spacer
attgaaattttatgtctgtttgatgatccagg	Protospacer
** .****** *** ************. .*.

203. spacer 1.18|46339|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP046704 (Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence) position: , mismatch: 8, identity: 0.75

ggatgaacaaacatgcttttcaattactgcaa	CRISPR spacer
taaataacaaatatgcttatcaattactggga	Protospacer
 .*  ******.****** ********** .*

204. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP013040 (Clostridium perfringens strain JP838 plasmid pJFP838C, complete sequence) position: , mismatch: 8, identity: 0.75

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
atttatttttttaaaatcttttcttttattaa	Protospacer
 *  *  . ******* ***************

205. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP033574 (Shewanella algae strain KC-Na-R1 plasmid pKC-Na-R1, complete sequence) position: , mismatch: 8, identity: 0.75

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
gtcaaagcattcaaaagctcttcttttgagta	Protospacer
 * ********.*******.*******.   *

206. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP019793 (Chlamydia gallinacea strain JX-1 plasmid pJX1, complete sequence) position: , mismatch: 8, identity: 0.75

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
acaaaagcatttaaacacttttctttgtcaaa	Protospacer
 .************* .*********  . **

207. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP015841 (Chlamydia gallinacea 08-1274/3 plasmid p1274, complete sequence) position: , mismatch: 8, identity: 0.75

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
acaaaagcatttaaacacttttctttgtcaaa	Protospacer
 .************* .*********  . **

208. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to MN693547 (Marine virus AFVG_25M424, complete genome) position: , mismatch: 8, identity: 0.75

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
aaaagaacatttaaaagcttttcttggtttat	Protospacer
  **.*.******************   ***

209. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to MK387309 (Pseudoalteromonas phage C7, complete genome) position: , mismatch: 8, identity: 0.75

ttaaaagcatttaaaagcttttc-----ttttattaa	CRISPR spacer
ttaaaatcatttataagcttttcacgctcttt-----	Protospacer
****** ****** *********     .***

210. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to MN693598 (Marine virus AFVG_25M403, complete genome) position: , mismatch: 8, identity: 0.75

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
aaaagaacatttaaaagcttttcttggtttat	Protospacer
  **.*.******************   ***

211. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to MN693297 (Marine virus AFVG_25M423, complete genome) position: , mismatch: 8, identity: 0.75

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
aaaagaacatttaaaagcttttcttggtttat	Protospacer
  **.*.******************   ***

212. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to MN693353 (Marine virus AFVG_25M425, complete genome) position: , mismatch: 8, identity: 0.75

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
aaaagaacatttaaaagcttttcttggtttat	Protospacer
  **.*.******************   ***

213. spacer 1.22|46579|32|NZ_CP044458|PILER-CR,CRT matches to MK759884 (Salmonella phage vB_SenM_SB18, complete genome) position: , mismatch: 8, identity: 0.75

ccccctttctgcaacgtcacccccttttgtct	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgagt	Protospacer
 .**..*************** ****.**  *

214. spacer 1.22|46579|32|NZ_CP044458|PILER-CR,CRT matches to NC_015292 (Erwinia phage phiEa104, complete genome) position: , mismatch: 8, identity: 0.75

ccccctttctgcaacgtcacccccttttgtct	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgagt	Protospacer
 .**..*************** ****.**  *

215. spacer 1.22|46579|32|NZ_CP044458|PILER-CR,CRT matches to MH426725 (Erwinia phage SunLIRen, complete genome) position: , mismatch: 8, identity: 0.75

ccccctttctgcaacgtcacccccttttgtct	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgagt	Protospacer
 .**..*************** ****.**  *

216. spacer 1.22|46579|32|NZ_CP044458|PILER-CR,CRT matches to FQ482083 (Erwinia amylovora phage phiEa104 complete genome) position: , mismatch: 8, identity: 0.75

ccccctttctgcaacgtcacccccttttgtct	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgagt	Protospacer
 .**..*************** ****.**  *

217. spacer 1.22|46579|32|NZ_CP044458|PILER-CR,CRT matches to HQ728263 (Erwinia phage vB_EamM-M7, complete genome) position: , mismatch: 8, identity: 0.75

ccccctttctgcaacgtcacccccttttgtct	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgagt	Protospacer
 .**..*************** ****.**  *

218. spacer 1.22|46579|32|NZ_CP044458|PILER-CR,CRT matches to NC_011811 (Erwinia phage phiEa21-4, complete genome) position: , mismatch: 8, identity: 0.75

ccccctttctgcaacgtcacccccttttgtct	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgagt	Protospacer
 .**..*************** ****.**  *

219. spacer 1.22|46579|32|NZ_CP044458|PILER-CR,CRT matches to MN604407 (Salmonella phage ST-3, complete genome) position: , mismatch: 8, identity: 0.75

ccccctttctgcaacgtcacccccttttgtct	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgagt	Protospacer
 .**..*************** ****.**  *

220. spacer 1.22|46579|32|NZ_CP044458|PILER-CR,CRT matches to MK770412 (Salmonella phage SE5, complete genome) position: , mismatch: 8, identity: 0.75

ccccctttctgcaacgtcacccccttttgtct	CRISPR spacer
atcctcttctgcaacgtcaccaccttctgagt	Protospacer
 .**..*************** ****.**  *

221. spacer 1.27|46881|32|NZ_CP044458|PILER-CR,CRT matches to MT188223 (Acinetobacter phage vB_AbaM_D22, complete genome) position: , mismatch: 8, identity: 0.75

gtcaaaagttatggaaaagttttgaagcttgg	CRISPR spacer
gcaaaaagttttgaaaaagttttgaaagtttt	Protospacer
*. ******* **.************. **

222. spacer 1.3|46279|31|NZ_CP044458|CRISPRCasFinder matches to MF360958 (Salicola phage SCTP-2, complete genome) position: , mismatch: 9, identity: 0.71

atgaaaatttgatggctgtttgatgattggg	CRISPR spacer
ttgaaaatttgataactgtttgattgtctta	Protospacer
 ************..********* .*.  .

223. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to LC425518 (Uncultured phage DNA, contig: NODE577) position: , mismatch: 9, identity: 0.71

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
tgtggcagattcaaaagcttttcttttattg	Protospacer
*  .. . ***.******************.

224. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP045351 (Vibrio sp. THAF100 plasmid pTHAF100_a, complete sequence) position: , mismatch: 9, identity: 0.71

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
cttggcacattgaaaagcttttcttttgttc	Protospacer
.* .. .**** ***************.**

225. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to MK387309 (Pseudoalteromonas phage C7, complete genome) position: , mismatch: 9, identity: 0.71

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaatcatttataagcttttcacgctctt	Protospacer
****** ****** ********* . . .*

226. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KY065496 (Streptococcus phage IPP60, complete genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

227. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KY065466 (Streptococcus phage IPP25, complete genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

228. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KY065476 (Streptococcus phage IPP36, complete genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

229. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KY065475 (Streptococcus phage IPP35, complete genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

230. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KY065472 (Streptococcus phage IPP31, complete genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

231. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KT337353 (Streptococcus phage phiARI0460-2, partial genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

232. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KY065474 (Streptococcus phage IPP34, complete genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

233. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KY065477 (Streptococcus phage IPP37, partial genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

234. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KT337349 (Streptococcus phage phiARI0399, partial genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

235. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KY065452 (Streptococcus phage IPP10, complete genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

236. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KY065499 (Streptococcus phage IPP63, complete genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

237. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KY065473 (Streptococcus phage IPP32, complete genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

238. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KT337356 (Streptococcus phage phiARI0468-2, complete genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

239. spacer 1.7|46519|31|NZ_CP044458|CRISPRCasFinder matches to KY065450 (Streptococcus phage IPP8, complete genome) position: , mismatch: 9, identity: 0.71

agcagaaaaagcagaaaggaaaatagcacta	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggag	Protospacer
*********** ******.**** *. .  .

240. spacer 1.8|46579|31|NZ_CP044458|CRISPRCasFinder matches to NC_014838 (Pantoea sp. At-9b plasmid pPAT9B01, complete sequence) position: , mismatch: 9, identity: 0.71

ccccctttctgcaacgtcacccccttttgtc	CRISPR spacer
gcaagttcctgcaacgtcaccgcctttttct	Protospacer
 *   **.************* ****** ..

241. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to NC_007410 (Trichormus variabilis ATCC 29413 plasmid A, complete sequence) position: , mismatch: 9, identity: 0.719

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
tcttttgaggcggaaagcaatttgttttactg	Protospacer
*. * .  **.*** ****************

242. spacer 1.10|46700|32|NZ_CP044458|CRISPRCasFinder matches to NZ_CP047243 (Trichormus variabilis 0441 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ttatgcttggtggacagcaatttgttttactt	CRISPR spacer
tcttttgaggcggaaagcaatttgttttactg	Protospacer
*. * .  **.*** ****************

243. spacer 1.17|46279|32|NZ_CP044458|PILER-CR,CRT matches to MF360958 (Salicola phage SCTP-2, complete genome) position: , mismatch: 9, identity: 0.719

atgaaaatttgatggctgtttgatgattggga	CRISPR spacer
ttgaaaatttgataactgtttgattgtcttaa	Protospacer
 ************..********* .*.  .*

244. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP020425 (Clostridioides difficile strain FDAARGOS_267 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
ttaaaagcatttaaaggcttgtctgacgtgtt	Protospacer
***************.**** ***  ..*

245. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP029156 (Clostridioides difficile strain CD161 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
ttaaaagcatttaaaggcttgtctgacacgtt	Protospacer
***************.**** ***  .*.

246. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP029153 (Clostridioides difficile strain CDT4 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
ttaaaagcatttaaaggcttgtctgacacgtt	Protospacer
***************.**** ***  .*.

247. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to FN668942 (Clostridium difficile BI1 plasmid pCDBI1, complete sequence) position: , mismatch: 9, identity: 0.719

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
ttaaaagcatttaaaggcttgtctgacgtgtt	Protospacer
***************.**** ***  ..*

248. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP011969 (Clostridioides difficile ATCC 9689 = DSM 1296 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
ttaaaagcatttaaaggcttgtctgacgtgtt	Protospacer
***************.**** ***  ..*

249. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP045351 (Vibrio sp. THAF100 plasmid pTHAF100_a, complete sequence) position: , mismatch: 9, identity: 0.719

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
cttggcacattgaaaagcttttcttttgttca	Protospacer
.* .. .**** ***************.** *

250. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to AP014358 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C94, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.719

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
tctatgtcatttaaaagctgatcttttattgt	Protospacer
*. * . ************  *********.

251. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 9, identity: 0.719

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
ctaatgcgaagcagaaaggaaaatcgcacaag	Protospacer
   * . .**************** **** **

252. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to NZ_KX832926 (Providencia rettgeri strain 16pre36 plasmid p16Pre36-1, complete sequence) position: , mismatch: 9, identity: 0.719

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
aatagaaaaatcaaaaaggaaaatagagttta	Protospacer
*..******* **.************ ..* .

253. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP026061 (Proteus mirabilis strain FDAARGOS_80 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
aatagaaaaatcaaaaaggaaaatagagttta	Protospacer
*..******* **.************ ..* .

254. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to NC_010555 (Proteus mirabilis HI4320 plasmid pHI4320, complete sequence) position: , mismatch: 9, identity: 0.719

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
aatagaaaaatcaaaaaggaaaatagagttta	Protospacer
*..******* **.************ ..* .

255. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP021855 (Proteus mirabilis strain AR_0156 plasmid unitig_3, complete sequence) position: , mismatch: 9, identity: 0.719

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
aatagaaaaatcaaaaaggaaaatagagttta	Protospacer
*..******* **.************ ..* .

256. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to NZ_MK941846 (Proteus mirabilis strain PM1157 plasmid pOXA-23, complete sequence) position: , mismatch: 9, identity: 0.719

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
aatagaaaaatcaaaaaggaaaatagagttta	Protospacer
*..******* **.************ ..* .

257. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to NZ_MF150117 (Proteus mirabilis strain A64421 plasmid pPM64421b, complete sequence) position: , mismatch: 9, identity: 0.719

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
aatagaaaaatcaaaaaggaaaatagagttta	Protospacer
*..******* **.************ ..* .

258. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to MN693756 (Marine virus AFVG_250M718, complete genome) position: , mismatch: 9, identity: 0.719

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
attgaaaaaatcagaaaggaaaaaagcatgat	Protospacer
* ...***** ************ ****. *

259. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to MN694439 (Marine virus AFVG_250M296, complete genome) position: , mismatch: 9, identity: 0.719

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
attgaaaaaatcagaaaggaaaaaagcatgat	Protospacer
* ...***** ************ ****. *

260. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to MN693803 (Marine virus AFVG_250M716, complete genome) position: , mismatch: 9, identity: 0.719

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
attgaaaaaatcagaaaggaaaaaagcatgat	Protospacer
* ...***** ************ ****. *

261. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to MN694282 (Marine virus AFVG_250M297, complete genome) position: , mismatch: 9, identity: 0.719

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
attgaaaaaatcagaaaggaaaaaagcatgat	Protospacer
* ...***** ************ ****. *

262. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to MN694541 (Marine virus AFVG_250M717, complete genome) position: , mismatch: 9, identity: 0.719

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
attgaaaaaatcagaaaggaaaaaagcatgat	Protospacer
* ...***** ************ ****. *

263. spacer 1.26|46821|32|NZ_CP044458|PILER-CR,CRT matches to NZ_AP017978 (Neochlamydia sp. S13 plasmid pS13, complete sequence) position: , mismatch: 9, identity: 0.719

aggggc-----cagccgaacaaattaaattagcaaga	CRISPR spacer
-----cttttgcagccgaacaaattgaaatagcaatc	Protospacer
     *     **************.** ******

264. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP045351 (Vibrio sp. THAF100 plasmid pTHAF100_a, complete sequence) position: , mismatch: 10, identity: 0.677

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
acggaaccatttaaaaacttttcttttgggg	Protospacer
 ...** *********.**********.  .

265. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to KC465899 (Pelagibacter phage HTVC008M, complete genome) position: , mismatch: 10, identity: 0.677

ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ccttgtgcatttaaaaacttttctgttatat	Protospacer
..  . **********.******* ****

266. spacer 1.11|46761|31|NZ_CP044458|CRISPRCasFinder matches to NZ_MF078634 (Acinetobacter pittii strain HGSA488 plasmid pLS488, complete sequence) position: , mismatch: 10, identity: 0.677

ttttgcctggtacacatacttaacctgggcc	CRISPR spacer
---------gtacacatgcttaacctgggcc	Protospacer
         ********.*************

267. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KY065496 (Streptococcus phage IPP60, complete genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

268. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KY065466 (Streptococcus phage IPP25, complete genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

269. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KY065476 (Streptococcus phage IPP36, complete genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

270. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KY065475 (Streptococcus phage IPP35, complete genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

271. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KY065472 (Streptococcus phage IPP31, complete genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

272. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KT337353 (Streptococcus phage phiARI0460-2, partial genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

273. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KY065474 (Streptococcus phage IPP34, complete genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

274. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KY065477 (Streptococcus phage IPP37, partial genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

275. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KT337349 (Streptococcus phage phiARI0399, partial genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

276. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KY065452 (Streptococcus phage IPP10, complete genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

277. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KY065499 (Streptococcus phage IPP63, complete genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

278. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KY065473 (Streptococcus phage IPP32, complete genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

279. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KT337356 (Streptococcus phage phiARI0468-2, complete genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

280. spacer 1.21|46519|32|NZ_CP044458|PILER-CR,CRT matches to KY065450 (Streptococcus phage IPP8, complete genome) position: , mismatch: 10, identity: 0.688

agcagaaaaagcagaaaggaaaatagcactag	CRISPR spacer
agcagaaaaagaagaaagaaaaagaaaggaga	Protospacer
*********** ******.**** *. .  ..

281. spacer 1.22|46579|32|NZ_CP044458|PILER-CR,CRT matches to NC_014838 (Pantoea sp. At-9b plasmid pPAT9B01, complete sequence) position: , mismatch: 10, identity: 0.688

ccccctttctgcaacgtcacccccttttgtct	CRISPR spacer
gcaagttcctgcaacgtcaccgcctttttctg	Protospacer
 *   **.************* ****** ..

282. spacer 1.25|46761|32|NZ_CP044458|PILER-CR,CRT matches to NZ_MF078634 (Acinetobacter pittii strain HGSA488 plasmid pLS488, complete sequence) position: , mismatch: 10, identity: 0.688

ttttgcctggtacacatacttaacctgggcca	CRISPR spacer
---------gtacacatgcttaacctgggcca	Protospacer
         ********.**************

283. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NC_025097 (Uncultured bacterium AST2 plasmid pAST2, complete sequence) position: , mismatch: 11, identity: 0.645

----------ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaagcatttaaaagcatt----------	Protospacer
          ****************** **

284. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to MN657042 (Psychrobacter sp. strain ANT_P18B plasmid pA18BP1, complete sequence) position: , mismatch: 11, identity: 0.645

----------ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaagcatttaaaagcatt----------	Protospacer
          ****************** **

285. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to MN657064 (Psychrobacter sp. strain ANT_P27 plasmid pA27P4, complete sequence) position: , mismatch: 11, identity: 0.645

----------ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaagcatttaaaagcatt----------	Protospacer
          ****************** **

286. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to MN657067 (Psychrobacter sp. strain ANT_P28 plasmid pA28P3, complete sequence) position: , mismatch: 11, identity: 0.645

----------ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaagcatttaaaagcatt----------	Protospacer
          ****************** **

287. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to MN657076 (Psychrobacter sp. strain ANT_P39B plasmid pA39BP2, complete sequence) position: , mismatch: 11, identity: 0.645

----------ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaagcatttaaaagcatt----------	Protospacer
          ****************** **

288. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to MN657088 (Psychrobacter sp. strain ANT_H3 plasmid pA3H8, complete sequence) position: , mismatch: 11, identity: 0.645

----------ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaagcatttaaaagcatt----------	Protospacer
          ****************** **

289. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to MN657111 (Psychrobacter sp. strain ANT_P52 plasmid pA52P3, complete sequence) position: , mismatch: 11, identity: 0.645

----------ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaagcatttaaaagcatt----------	Protospacer
          ****************** **

290. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NC_021158 (Psychrobacter maritimus plasmid pKLH80, strain MR29-12, complete sequence) position: , mismatch: 11, identity: 0.645

----------ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaagcatttaaaagcatt----------	Protospacer
          ****************** **

291. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP012537 (Psychrobacter sp. P11G5 plasmid pPspP11G5d, complete sequence) position: , mismatch: 11, identity: 0.645

----------ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaagcatttaaaagcatt----------	Protospacer
          ****************** **

292. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NZ_CP012540 (Psychrobacter sp. P11G5 plasmid pPspP11G5g, complete sequence) position: , mismatch: 11, identity: 0.645

----------ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaagcatttaaaagcatt----------	Protospacer
          ****************** **

293. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NZ_CP045351 (Vibrio sp. THAF100 plasmid pTHAF100_a, complete sequence) position: , mismatch: 11, identity: 0.656

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
acggaaccatttaaaaacttttcttttggggt	Protospacer
 ...** *********.**********.  .

294. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to KC465899 (Pelagibacter phage HTVC008M, complete genome) position: , mismatch: 11, identity: 0.656

ttaaaagcatttaaaagcttttcttttattaa	CRISPR spacer
ccttgtgcatttaaaaacttttctgttatatc	Protospacer
..  . **********.******* ****

295. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to MN657102 (Psychrobacter sp. strain ANT_P46 plasmid pA46P4, complete sequence) position: , mismatch: 12, identity: 0.613

----------ttaaaagcatttaaaagcttttcttttatta	CRISPR spacer
ttaaaagcatttaaaagcatttaaaaacatt----------	Protospacer
          ****************.* **

296. spacer 1.6|46459|31|NZ_CP044458|CRISPRCasFinder matches to NC_015979 (Lactobacillus sanfranciscensis TMW 1.1304 plasmid pLS1, complete sequence) position: , mismatch: 14, identity: 0.548

-------ttaaaagcatttaaaagcttttcttttatta----	CRISPR spacer
taataatagaaaagcatttaaa-----------tataaaacg	Protospacer
         *************           *** *

297. spacer 1.20|46459|32|NZ_CP044458|PILER-CR,CRT matches to NC_015979 (Lactobacillus sanfranciscensis TMW 1.1304 plasmid pLS1, complete sequence) position: , mismatch: 14, identity: 0.562

--------ttaaaagcatttaaaagcttttcttttattaa---	CRISPR spacer
ataataatagaaaagcatttaaa-----------tataaaacg	Protospacer
          *************           *** **

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage