CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP028246	Lactobacillus plantarum strain SRCM101518 plasmid unnamed5, complete sequence	0 crisprs	NA	0	0	0
NZ_CP028241	Lactobacillus plantarum strain SRCM101518 chromosome, complete genome	2 crisprs	cas3,DEDDh,DinG,csa3,csn2,cas2,cas1,cas9,WYL	1	10	8
NZ_CP028242	Lactobacillus plantarum strain SRCM101518 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	0
NZ_CP028245	Lactobacillus plantarum strain SRCM101518 plasmid unnamed4, complete sequence	0 crisprs	NA	0	0	0
NZ_CP028243	Lactobacillus plantarum strain SRCM101518 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0	0
NZ_CP028244	Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence	0 crisprs	csa3	0	0	4

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP028241_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028241_1

2018041-2019263

TypeII

Consensus_repeat	Method
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRISPRCasFinder
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	PILER-CR

18 spacers

csa3,csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_CP028241_1

>merge|NZ_CP028241|1|2018041-2019263|CRT,CRISPRCasFinder,PILER-CR
TGTGAAACTGTTTTTGATGTGGCCGTTATTCAAGACAAACGTTCTATGCTTCGTTTCCTCAGCATCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCGTGTCTTGTTCCTTGTTGTACTCCATACCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACGGATCAGAAGCGATTTATGAGTACAATGATGTTCTAAACCTGTTTGATATGACTACTATTCAAGACACTCACAAAGGTTCCGTATCTGTCGGTCTAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACAGTCCTGATCTTACATCTAGCAAGGCTCGGGTTCTAAACCTGTTTGATATGACTACTATTCAAGACGTAATTGAGTGTTGATATTCTCTTTACTTTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACACGTAACTTTAAGCTGTTGCACAAACTGCGGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTAACTCAGTTCTGAACGGTGCCTTATTGACGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTAGAGCAGTAATTGCTTGACTATAGTTACTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTACCGGCTTTACAATAACGTGATATTCCTTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTCATCGGTTGACCTATCAGCTGATTTTGGTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTGGCAAACTGTTCGGAGACGGTGGCAACCAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTGTACGTGTCACCTTCTTGCAAGTCCGGGAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCAAAGATCGTCTAACTTTACGGGCTAACATGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCAGCACCATCAATACATGTCAAGTTGACCGGTTCTAAACCTGTTTGATATGACTACTATTCAAGACACAAACTGCTGACGATGACAACGAAAGTCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACAAGGCAAATTTCAAGATGAGCGTCAAAAACGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCTTATCTTGATACTATTAGCAACAACTAGTGTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP028241|1|1|2018041-2019263|CRT
TGTGAAACTGTTTTTGATGTGGCCGTTATTCAAGAC	AAACGTTCTATGCTTCGTTTCCTCAGCATC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTGTCTTGTTCCTTGTTGTACTCCATACC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGATCAGAAGCGATTTATGAGTACAATGAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACTCACAAAGGTTCCGTATCTGTCGGTCTA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGTCCTGATCTTACATCTAGCAAGGCTCGG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTAATTGAGTGTTGATATTCTCTTTACTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACGTAACTTTAAGCTGTTGCACAAACTGCG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAACTCAGTTCTGAACGGTGCCTTATTGAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAGAGCAGTAATTGCTTGACTATAGTTACT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TACCGGCTTTACAATAACGTGATATTCCTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TCATCGGTTGACCTATCAGCTGATTTTGGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TGGCAAACTGTTCGGAGACGGTGGCAACCA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TGTACGTGTCACCTTCTTGCAAGTCCGGGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CAAAGATCGTCTAACTTTACGGGCTAACAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CAGCACCATCAATACATGTCAAGTTGACCG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACAAACTGCTGACGATGACAACGAAAGTC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AAGGCAAATTTCAAGATGAGCGTCAAAAAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CTTATCTTGATACTATTAGCAACAACTAGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP028241|1|1|2018107-2019263|CRISPRCasFinder
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTGTCTTGTTCCTTGTTGTACTCCATACC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGATCAGAAGCGATTTATGAGTACAATGAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACTCACAAAGGTTCCGTATCTGTCGGTCTA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGTCCTGATCTTACATCTAGCAAGGCTCGG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTAATTGAGTGTTGATATTCTCTTTACTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACGTAACTTTAAGCTGTTGCACAAACTGCG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAACTCAGTTCTGAACGGTGCCTTATTGAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAGAGCAGTAATTGCTTGACTATAGTTACT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TACCGGCTTTACAATAACGTGATATTCCTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TCATCGGTTGACCTATCAGCTGATTTTGGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TGGCAAACTGTTCGGAGACGGTGGCAACCA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TGTACGTGTCACCTTCTTGCAAGTCCGGGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CAAAGATCGTCTAACTTTACGGGCTAACAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CAGCACCATCAATACATGTCAAGTTGACCG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACAAACTGCTGACGATGACAACGAAAGTC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AAGGCAAATTTCAAGATGAGCGTCAAAAAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CTTATCTTGATACTATTAGCAACAACTAGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP028241|1|1|2018173-2019263|PILER-CR
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGATCAGAAGCGATTTATGAGTACAATGAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACTCACAAAGGTTCCGTATCTGTCGGTCTA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGTCCTGATCTTACATCTAGCAAGGCTCGG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTAATTGAGTGTTGATATTCTCTTTACTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACGTAACTTTAAGCTGTTGCACAAACTGCG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAACTCAGTTCTGAACGGTGCCTTATTGAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAGAGCAGTAATTGCTTGACTATAGTTACT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TACCGGCTTTACAATAACGTGATATTCCTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TCATCGGTTGACCTATCAGCTGATTTTGGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TGGCAAACTGTTCGGAGACGGTGGCAACCA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TGTACGTGTCACCTTCTTGCAAGTCCGGGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CAAAGATCGTCTAACTTTACGGGCTAACAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CAGCACCATCAATACATGTCAAGTTGACCG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACAAACTGCTGACGATGACAACGAAAGTC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AAGGCAAATTTCAAGATGAGCGTCAAAAAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CTTATCTTGATACTATTAGCAACAACTAGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028241.1\|WP_054399469.1\|2010467_2011700_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NZ_CP028241.1\|WP_015379640.1\|2019961_2020267_-\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP028241.1\|WP_003641732.1\|2013390_2013864_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|197670
NZ_CP028241.1\|WP_160231106.1\|2026516_2027224_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028241.1\|WP_108909660.1\|2010077_2010443_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP028241.1\|WP_003646323.1\|2012279_2012735_+\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NZ_CP028241.1\|WP_003641731.1\|2013977_2014580_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP028241.1\|WP_063204128.1\|2015238_2017977_+\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
NZ_CP028241.1\|WP_003641738.1\|2008820_2010014_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340897
NZ_CP028241.1\|WP_060684251.1\|2020244_2021150_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP028241.1\|WP_063722121.1\|2025709_2026492_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP028241.1\|WP_003641724.1\|2028926_2029397_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NZ_CP028241.1\|WP_003641733.1\|2012822_2013245_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
NZ_CP028241.1\|WP_160231109.1\|2031348_2032089_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
NZ_CP028241.1\|WP_160231108.1\|2029512_2031105_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|214906
NZ_CP028241.1\|WP_045351426.1\|2007728_2008577_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381297
NZ_CP028241.1\|WP_160231105.1\|2021344_2025421_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP028241.1\|WP_003641730.1\|2014645_2014840_+\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
NZ_CP028241.1\|WP_160231107.1\|2027329_2028694_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694
NZ_CP028241.1\|WP_060684252.1\|2019287_2019965_-\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411

Protein	Function_ID	Function_description	E-value
NZ_CP028241.1\|WP_054399469.1\|2010467_2011700_-\|MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.42462e-140
NZ_CP028241.1\|WP_015379640.1\|2019961_2020267_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.01798e-25
NZ_CP028241.1\|WP_003641732.1\|2013390_2013864_-\|hypothetical-protein	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	4.83323e-10
NZ_CP028241.1\|WP_108909660.1\|2010077_2010443_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	3.66649e-14
NZ_CP028241.1\|WP_003646323.1\|2012279_2012735_+\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	7.07627e-26
NZ_CP028241.1\|WP_003641731.1\|2013977_2014580_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	5.27584e-30
NZ_CP028241.1\|WP_063204128.1\|2015238_2017977_+\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP028241.1\|WP_003641738.1\|2008820_2010014_-\|MFS-transporter	gnl\|CDD\|340897	cd17339, MFS_NIMT_CynX_like, 2-nitroimidazole and cyanate transporters and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli 2-nitroimidazole transporter (NIMT) and cyanate transport protein CynX, and similar proteins. NIMT, also called YeaN, confers resistance to 2-nitroimidazole, the antibacterial and antifungal antibiotic, by mediating the active efflux of this compound. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The NIMT/CynX-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.6578e-118
NZ_CP028241.1\|WP_060684251.1\|2020244_2021150_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.76066e-89
NZ_CP028241.1\|WP_063722121.1\|2025709_2026492_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.17929e-25
NZ_CP028241.1\|WP_003641724.1\|2028926_2029397_+\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	8.22877e-58
NZ_CP028241.1\|WP_003641733.1\|2012822_2013245_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	2.47416e-43
NZ_CP028241.1\|WP_160231109.1\|2031348_2032089_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	6.87607e-88
NZ_CP028241.1\|WP_160231108.1\|2029512_2031105_-\|DNA-binding-protein	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	1.88552e-17
NZ_CP028241.1\|WP_045351426.1\|2007728_2008577_-\|aldo/keto-reductase	gnl\|CDD\|381297	cd19071, AKR_AKR1-5-like, AKR1/2/3/4/5 family of aldo-keto reductase (AKR) and similar proteins. Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. The family includes AKR1A/B/C/D/E/G/I, AKR2A/B/C/D/E, AKR3A/B/C/D/E/G, AKR4A/B/C, AKR5A/B/C/D/E/F/G/H, and similar proteins.	7.60293e-121
NZ_CP028241.1\|WP_160231105.1\|2021344_2025421_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	2.56856e-128
NZ_CP028241.1\|WP_003641730.1\|2014645_2014840_+\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17
NZ_CP028241.1\|WP_160231107.1\|2027329_2028694_-\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0
NZ_CP028241.1\|WP_060684252.1\|2019287_2019965_-\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	2.57931e-80

>NZ_CP028241.1|WP_063204128.1|2015238_2017977_+|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYATDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPMTETTPALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHGPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYNYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKFIRFRWMGKDGVID
>NZ_CP028241.1|WP_003641730.1|2014645_2014840_+|PspC-domain-containing-protein
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>NZ_CP028241.1|WP_003641731.1|2013977_2014580_+|NAD(P)H-dependent-oxidoreductase
MFKIAIILGSTRSQANGRALFNHLKLIIDQLPTHSTIHYQFLDLANYQLPLFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGIVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHTLHQALTEITYYTTVLTTTPFPTD
>NZ_CP028241.1|WP_003641732.1|2013390_2013864_-|hypothetical-protein
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIMAYLGQHGPSRAKTLPVPTGLSQATISRGLTKLARLELATKYRDLTNNKEVLVRLTALGEAGAELHTQLDAAIAAKAQAIVDDYSDAELTRFVSLMRRIREIKL
>NZ_CP028241.1|WP_003641733.1|2012822_2013245_-|Hsp20/alpha-crystallin-family-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAADKITASQADGVLTITLPKTQPSANDGQIEIQ
>NZ_CP028241.1|WP_003646323.1|2012279_2012735_+|DUF3021-domain-containing-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSYLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNHRS
>NZ_CP028241.1|WP_054399469.1|2010467_2011700_-|MFS-transporter
MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGDFTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVTNVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGLLAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLIIVMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRYGDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNTPVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVPDIWKNGKRTVS
>NZ_CP028241.1|WP_108909660.1|2010077_2010443_-|winged-helix-turn-helix-transcriptional-regulator
MASCLFCYLSLNMMLIQCIVSFMNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKALRLVGLTNTRREAQTKYLSLQLATFDRLLPGFLATL
>NZ_CP028241.1|WP_003641738.1|2008820_2010014_-|MFS-transporter
MTTTHQHSRYLTLGMMLAATNMRLPITMMPGLISSLKRTLGLPSSMAGLLTTIPLLTFAIMSPLIAHWGRRFGNELTIYVMLIFLAVGSYLRVIPTIAALFIGTLLVGIGADGGNVLIPAIIKDNFPTKIPVATSQYTLSMLLVGSLGTGLSGVLAAHWSLPLTMAVLSVIGLINLVVWLPNLKYNHRAPTVAMTASDGQSTATHGSVWRRPLAWVVTAFFGLQALVYYSLLTWLPTVFVAHGFSLIVAGNLVTVMQLSGLPMSYLVPATSGHRRGVWAMIMVVGVGFIAGIGGILLSGTNFWVAALSCVLLGLGSGAAFSLAVVFFTQKTTNGFETADLSGMAQSAGYLLAAVGPVLFGWLGGQLGWGPVLWLAIILSALLALSGSIIFQHATIYE
>NZ_CP028241.1|WP_045351426.1|2007728_2008577_-|aldo/keto-reductase
MTVLTTMYQLANGVNIPKVAFGTWQIPGGEATYQAVRAALAAGYRHIDTALAYQNEASVGQAIRDSGIPREQIFVTTKLPAETKSYQGALNDFDRSLKNLGLDYVDLYLVHAPWPWGQVGRVYDEANLDVWQAMEAIYQSGRAKAIGVSNFAVRDLKNILNQATIPPMINQIQYYLGFTEPKITKFSEEHAMLVEAYSPLATGGVLDNPQVQAYADKYGVSVAQLALRFVLQNGVLPLPKAVNPAHIEANTQLDFAISVADMQALNDLPDAAGSYMHNPTQG
>NZ_CP028241.1|WP_060684252.1|2019287_2019965_-|type-II-A-CRISPR-associated-protein-Csn2
MNITYYPFPPFKIDAGKVNVLDLGNSNMYAEVCQGFRDRIDSVRISNDDLELQTISSQCNWYGDLMLSVDLNRLFLKKVQTQIIKLMADDRQVAVLDENRKVVSQVMEASFLLDLPLDVDESPSLEQILKFTGIHFPTALMNDPRAILEALVQTHVELGLKQKLVLTNISHYLDQKQWASFEQLVHDLGATVIVIEYSEINRMEKFKNSCYYYVDEDLVDWRDMN
>NZ_CP028241.1|WP_015379640.1|2019961_2020267_-|CRISPR-associated-endonuclease-Cas2
MRLIVMFDVPMDTSEERRAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>NZ_CP028241.1|WP_060684251.1|2020244_2021150_-|type-II-CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALAEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGDQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPDEVSSDAINSHV
>NZ_CP028241.1|WP_160231105.1|2021344_2025421_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDISPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTLVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEENQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRTKQNGAIPYQVQQNELDQIINNQKEYYPWLGEENPVIKRRGKFPYKLDELVGFRVPYYVGPLITKEMQAATANAGFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKYKRVTAKNIQDNLVAAGEFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLSRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAARGGGVAGRRTQSRSKQIVAAYQGTAQAIVRDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFIYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIAANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNESEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKTDFGKLQVPGGIKLTGDAEIIYQSPTGLFERKISLKDL
>NZ_CP028241.1|WP_063722121.1|2025709_2026492_-|alpha/beta-hydrolase
MHFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLEQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPQMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSAAFNKALLEFLATC
>NZ_CP028241.1|WP_160231106.1|2026516_2027224_-|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQQPAMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALSPATWQACLSEQLAINALLALTGDSRQLSQITTEQVRQLQTSIQTATGIDWEKVAQLLDSTVIAQNTLSEAEPDDKTRQWLEKLQKLTPQDFNNHVE
>NZ_CP028241.1|WP_160231107.1|2027329_2028694_-|amino-acid-permease
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIFAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>NZ_CP028241.1|WP_003641724.1|2028926_2029397_+|NUDIX-hydrolase
MANYIKEIRALVGHKPIILNTAAGILVNDQQQVLLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>NZ_CP028241.1|WP_160231108.1|2029512_2031105_-|DNA-binding-protein
MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEIIPVTTVVQVTEQNSTGDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYATLMDQGQRLYGIVTVLDQQKQHLELMLWRTTAVPSPIEALQIRQRLAKPRTNLGAVPTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPADELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVGISAQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSSQPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTAITVEKLRQTLGDQTYHALANYQRHVQLVAGSTEGVNETLLQALIHAVTYHELTTMHYYQPTVGMVDQVIYPIQLFSTTTKDEDDAQLVGCLALYNYETFEIQQVPLTAIARIAIIADPEHPQTTPETESPDWLRIFLHGWNDDF
>NZ_CP028241.1|WP_160231109.1|2031348_2032089_-|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGIDPERDQYEIALIRATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTISDAITVNSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSLQARLFAAFMRACVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP028241_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028241_2

2666867-2666952

Orphan

Consensus_repeat	Method
AATAAGATACTTTAAGTTTCTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP028241_2

>merge|NZ_CP028241|2|2666867-2666952|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTATTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCGAATAAGACACTTTAAGTTTCTTA

>NZ_CP028241|2|2|2666867-2666952|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTA	TTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCG
AATAAGACACTTTAAGTTTCTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028241.1\|WP_003642342.1\|2672338_2673067_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP028241.1\|WP_003642350.1\|2664168_2664963_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP028241.1\|WP_011102043.1\|2662181_2663177_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP028241.1\|WP_003642338.1\|2677271_2678684_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NZ_CP028241.1\|WP_011102045.1\|2658987_2659494_+\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP028241.1\|WP_003642345.1\|2669734_2670301_+\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP028241.1\|WP_011102046.1\|2657892_2658729_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP028241.1\|WP_003642355.1\|2659510_2660257_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP028241.1\|WP_003643400.1\|2663173_2664172_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP028241.1\|WP_003642358.1\|2657501_2657882_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP028241.1\|WP_011102040.1\|2671613_2672180_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP028241.1\|WP_022638460.1\|2666966_2668445_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP028241.1\|WP_160231198.1\|2661425_2661938_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP028241.1\|WP_003642340.1\|2673848_2674133_-\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP028241.1\|WP_003642344.1\|2670449_2671487_-\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP028241.1\|WP_003643398.1\|2666249_2666849_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP028241.1\|WP_033608962.1\|2674418_2677001_+\|glycoside-hydrolase-family-25	unknown	unknown	gnl\|CDD\|119382
NZ_CP028241.1\|WP_011102042.1\|2665199_2666129_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP028241.1\|WP_011102039.1\|2673199_2673565_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP028241.1\|WP_160231199.1\|2668561_2669515_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318

Protein	Function_ID	Function_description	E-value
NZ_CP028241.1\|WP_003642342.1\|2672338_2673067_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
NZ_CP028241.1\|WP_003642350.1\|2664168_2664963_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP028241.1\|WP_011102043.1\|2662181_2663177_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.80019e-78
NZ_CP028241.1\|WP_003642338.1\|2677271_2678684_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NZ_CP028241.1\|WP_011102045.1\|2658987_2659494_+\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	7.15338e-54
NZ_CP028241.1\|WP_003642345.1\|2669734_2670301_+\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	5.75015e-29
NZ_CP028241.1\|WP_011102046.1\|2657892_2658729_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.88105e-54
NZ_CP028241.1\|WP_003642355.1\|2659510_2660257_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP028241.1\|WP_003643400.1\|2663173_2664172_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NZ_CP028241.1\|WP_003642358.1\|2657501_2657882_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	8.88832e-19
NZ_CP028241.1\|WP_011102040.1\|2671613_2672180_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.31502e-05
NZ_CP028241.1\|WP_022638460.1\|2666966_2668445_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.10264e-72
NZ_CP028241.1\|WP_160231198.1\|2661425_2661938_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	4.00107e-08
NZ_CP028241.1\|WP_003642340.1\|2673848_2674133_-\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP028241.1\|WP_003642344.1\|2670449_2671487_-\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NZ_CP028241.1\|WP_003643398.1\|2666249_2666849_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP028241.1\|WP_033608962.1\|2674418_2677001_+\|glycoside-hydrolase-family-25	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	2.86064e-70
NZ_CP028241.1\|WP_011102042.1\|2665199_2666129_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	1.50683e-56
NZ_CP028241.1\|WP_011102039.1\|2673199_2673565_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
NZ_CP028241.1\|WP_160231199.1\|2668561_2669515_+\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	5.22089e-131

>NZ_CP028241.1|WP_003643398.1|2666249_2666849_-|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP028241.1|WP_011102042.1|2665199_2666129_+|ABC-transporter-substrate-binding-protein
MTKRWQIVKLGLVLGLMGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP028241.1|WP_003642350.1|2664168_2664963_-|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP028241.1|WP_003643400.1|2663173_2664172_-|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP028241.1|WP_011102043.1|2662181_2663177_-|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTSRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NZ_CP028241.1|WP_160231198.1|2661425_2661938_-|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLHHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP028241.1|WP_003642355.1|2659510_2660257_+|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP028241.1|WP_011102045.1|2658987_2659494_+|acetyltransferase
MQTIQPIVDANQRRIQALNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIKLADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP028241.1|WP_011102046.1|2657892_2658729_-|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVILPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY
>NZ_CP028241.1|WP_003642358.1|2657501_2657882_-|MerR-family-transcriptional-regulator
MLTFKIPEQQHYFTTKEVTAMTGMTKDALRYYEHLGILPDVQRNQYNYRQYSHKNLETLQLIKIFRDLDLDLSLLTPAHLALDGQAKVVAFKQYQQVIRDRIRHLEAIDQLLATKIDYFEHQSIDT
>NZ_CP028241.1|WP_022638460.1|2666966_2668445_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAETYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP028241.1|WP_160231199.1|2668561_2669515_+|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNRDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP028241.1|WP_003642345.1|2669734_2670301_+|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP028241.1|WP_003642344.1|2670449_2671487_-|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP028241.1|WP_011102040.1|2671613_2672180_+|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>NZ_CP028241.1|WP_003642342.1|2672338_2673067_-|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP028241.1|WP_011102039.1|2673199_2673565_+|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP028241.1|WP_003642340.1|2673848_2674133_-|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NZ_CP028241.1|WP_033608962.1|2674418_2677001_+|glycoside-hydrolase-family-25
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNNTNVHADATNATTTSSSAASTASSASVATSSAASDATTKATSVSSSAATQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKTASSAATSTSATATSQATSVASSTATTTQVSHTASSTAASAASSTATVKAVKAASSTVSSAATTATKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEITTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTTTSSKSTATASAKTVAQSGTYKFAKTTAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYSAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>NZ_CP028241.1|WP_003642338.1|2677271_2678684_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP028241_1	1.16\|2019067\|29\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019067-2019095	29	NZ_CP028241.1	475067-475095	0	1.0

1. spacer 1.16|2019067|29|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to position: 475067-475095, mismatch: 0, identity: 1.0

acaaactgctgacgatgacaacgaaagtc	CRISPR spacer
acaaactgctgacgatgacaacgaaagtc	Protospacer
*****************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP037437	Lactobacillus plantarum strain EM plasmid pEM8, complete sequence	19326-19355	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP012284	Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-1, complete sequence	3838-3867	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP021460	Lactobacillus brevis strain ZLB004 plasmid p4, complete sequence	1240-1269	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NC_017018	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-7, complete sequence	14022-14051	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP012270	Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-1, complete sequence	3840-3869	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP033887	Lactobacillus brevis strain LMT1-73 plasmid p2, complete sequence	3641-3670	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP019713	Lactobacillus plantarum strain Q7 plasmid unnamed1, complete sequence	8686-8715	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP014886	Lactobacillus backii strain TMW 1.1991 plasmid pL11991-5, complete sequence	98-127	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP014920	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence	269-298	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP014629	Lactobacillus backii strain TMW 1.1988 plasmid L11988-5, complete sequence	5202-5231	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP035118	Lactobacillus plantarum strain SRCM103295 plasmid unnamed5	604-633	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NC_024988	Lactobacillus plantarum subsp. plantarum plasmid pZL4, complete sequence	849-878	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP016493	Lactobacillus pentosus strain BGM48 plasmid pBGM48-2, complete sequence	15186-15215	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP027193	Lactobacillus sp. CBA3605 plasmid pCBA3605-3, complete sequence	1009-1038	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP023006	Pediococcus pentosaceus strain SS1-3 plasmid pSS1302, complete sequence	11076-11105	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP023006	Pediococcus pentosaceus strain SS1-3 plasmid pSS1302, complete sequence	24170-24199	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP023006	Pediococcus pentosaceus strain SS1-3 plasmid pSS1302, complete sequence	37264-37293	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP019983	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-13, complete sequence	10698-10727	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP019983	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-13, complete sequence	41167-41196	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP033892	Lactobacillus plantarum strain LMT1-48 plasmid p_4, complete sequence	9143-9172	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP017700	Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-6, complete sequence	2741-2770	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP017700	Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-6, complete sequence	14119-14148	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP017700	Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-6, complete sequence	25497-25526	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NC_003320	Lactobacillus curvatus strain CRL705 plasmid pRC18, complete sequence	15153-15182	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP048925	Lactobacillus plantarum strain X7022 plasmid unnamed4, complete sequence	15507-15536	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP013166	Lactobacillus plantarum strain MF1298 plasmid pMF1298-10, complete sequence	858-887	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP021504	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-3 sequence	373-402	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP021504	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-3 sequence	2347-2376	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP004408	Lactobacillus plantarum DOMLa plasmid unnamed200, complete sequence	1457-1486	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP015127	Lactobacillus plantarum strain CAUH2 plasmid pCAUH201, complete sequence	1354-1383	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_KJ868089	Lactobacillus pentosus strain F03 plasmid pF03-2, complete sequence	1632-1661	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_003893	Lactobacillus plantarum plasmid pLP2000, complete sequence	313-342	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_012220	Lactobacillus plantarum plasmid pLD1, complete sequence	2072-2101	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP012654	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK10, complete sequence	1619-1648	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP012654	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK10, complete sequence	3680-3709	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	KX859226	Lactobacillus plantarum plasmid p3-11C, complete sequence	60-89	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_001370	Lactobacillus plantarum plasmid pC30il, complete sequence	71-100	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_011136	Lactobacillus plantarum plasmid pLR1, complete sequence	303-332	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP046660	Lactobacillus plantarum strain 123-17 plasmid p123-18.4, complete sequence	1925-1954	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_019321	Lactobacillus plantarum plasmid pR18, complete sequence	1377-1406	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_011497	Lactobacillus plantarum plasmid pLP2111, complete sequence	2071-2100	0	1.0
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP013168	Lactobacillus plantarum strain MF1298 plasmid pMF1298-13, complete sequence	2794-2823	0	1.0
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP022711	Lactobacillus sakei strain WiKim0063 plasmid pLBS02, complete sequence	3089-3118	1	0.967
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_010914	Weissella cibaria plasmid pKW2126, complete sequence	637-666	1	0.967
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP023495	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed5, complete sequence	2331-2360	2	0.933
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP032362	Lactobacillus plantarum strain ZFM55 plasmid unnamed3, complete sequence	11947-11976	2	0.933
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP032362	Lactobacillus plantarum strain ZFM55 plasmid unnamed3, complete sequence	33908-33937	2	0.933
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP040739	Lactobacillus futsaii strain Y97 plasmid p3, complete sequence	2750-2779	2	0.933
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP040739	Lactobacillus futsaii strain Y97 plasmid p3, complete sequence	15542-15571	2	0.933
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP032647	Lactobacillus plantarum strain ZFM9 plasmid unnamed5, complete sequence	20981-21010	2	0.933
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP026510	Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed5, complete sequence	2902-2931	2	0.933
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NC_021528	Lactobacillus plantarum 16 plasmid Lp16I, complete sequence	9849-9878	2	0.933
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP016493	Lactobacillus pentosus strain BGM48 plasmid pBGM48-2, complete sequence	707-736	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP028328	Lactobacillus sp. D1501 plasmid p2, complete sequence	8613-8642	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP024414	Lactobacillus plantarum strain ATCC 8014 plasmid pLP49, complete sequence	48534-48563	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP024417	Lactobacillus plantarum strain ATCC 8014 plasmid pLP9039, complete sequence	7627-7656	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP021482	Lactobacillus brevis strain SRCM101174 plasmid pLB1174-4 sequence	3154-3183	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP021482	Lactobacillus brevis strain SRCM101174 plasmid pLB1174-4 sequence	13394-13423	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP021482	Lactobacillus brevis strain SRCM101174 plasmid pLB1174-4 sequence	23631-23660	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP021676	Lactobacillus brevis strain SRCM101106 plasmid pLB1106-4 sequence	10225-10254	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP021458	Lactobacillus brevis strain ZLB004 plasmid p2, complete sequence	8592-8621	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP012281	Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-6, complete sequence	8017-8046	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP021477	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-6	6222-6251	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP021998	Lactobacillus plantarum strain LPL-1 plasmid pPLP-1, complete sequence	946-975	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP031213	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_E, complete sequence	6613-6642	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP018328	Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-4, complete sequence	795-824	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP018328	Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-4, complete sequence	16589-16618	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP014632	Lactobacillus backii strain TMW 1.1988 plasmid L11988-8, complete sequence	3078-3107	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP035019	Lactobacillus plantarum strain 12_3 plasmid pldG, complete sequence	3856-3885	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP046039	Lactobacillus sakei strain CBA3614 plasmid unnamed2, complete sequence	17881-17910	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP017411	Lactobacillus plantarum strain RI-113 plasmid pRI113_5, complete sequence	15046-15075	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP015128	Lactobacillus plantarum strain CAUH2 plasmid pCAUH202, complete sequence	830-859	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_LT960786	Lactobacillus sakei isolate MFPB19 plasmid 3, complete sequence	1429-1458	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NC_004944	Lactobacillus plantarum 5057 plasmid pMD5057, complete sequence	1316-1345	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP019984	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-14, complete sequence	1229-1258	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP019984	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-14, complete sequence	15816-15845	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP019984	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-14, complete sequence	30419-30448	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NC_015979	Lactobacillus sanfranciscensis TMW 1.1304 plasmid pLS1, complete sequence	33323-33352	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NC_016636	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-3, complete sequence	733-762	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NC_021228	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp6, complete sequence	7017-7046	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_AP014681	Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-1, complete sequence	11499-11528	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP031203	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_E, complete sequence	707-736	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP031179	Lactobacillus brevis strain UCCLB556 plasmid pUCCLB556_E, complete sequence	201-230	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NC_020824	Lactobacillus brevis KB290 plasmid pKB290-7, complete sequence	3710-3739	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	NZ_CP032658	Lactobacillus pentosus strain ZFM222 plasmid unnamed4, complete sequence	2475-2504	3	0.9
NZ_CP028241_1	1.17\|2019132\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019132-2019161	30	CP019349	Lactobacillus plantarum strain KLDS1.0391 plasmid unnamed1, complete sequence	5128-5157	4	0.867
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_MH671358	Bacillus pumilus strain 63-2-2 plasmid pBP-6322, complete sequence	658-687	4	0.867
NZ_CP028241_1	1.10\|2018671\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018671-2018700	30	MG744354	Lactobacillus phage Satyr, complete genome	2429-2458	5	0.833
NZ_CP028241_1	1.10\|2018671\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018671-2018700	30	MG765274	Lactobacillus phage Maenad, complete genome	2444-2473	5	0.833
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP028984	Lactobacillus plantarum strain LQ80 plasmid pLQ807, complete sequence	2935-2964	5	0.833
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_KM272265	Lactobacillus plantarum strain ATIT-023 plasmid pLP-8, complete sequence	655-684	5	0.833
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_024985	Lactobacillus plantarum subsp. plantarum strain Zhang-11 plasmid pZL2, complete sequence	3012-3041	5	0.833
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_014919	Lactobacillus brevis strain D11 plasmid pSD11, complete sequence	333-362	5	0.833
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_016035	Lactobacillus buchneri subsp. silagei CD034 plasmid pCD034-1, complete sequence	3145-3174	5	0.833
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_007593	Pediococcus damnosus plasmid pF8801, complete sequence	3624-3653	5	0.833
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_012722	Lactobacillus pentosus p1-4 plasmid complete sequence, strain F121-1	1130-1159	5	0.833
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_019372	Lactobacillus plantarum plasmid pG6301, complete sequence	1719-1748	5	0.833
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_009666	Lactobacillus plantarum M4 plasmid pM4, complete sequence	133-162	5	0.833
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP013167	Lactobacillus plantarum strain MF1298 plasmid pMF1298-12, complete sequence	3221-3250	5	0.833
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_001858	Bacillus pumilus plasmid pPL10, complete plasmid sequence	2343-2372	5	0.833
NZ_CP028241_1	1.7\|2018473\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018473-2018502	30	MF999224	Lactobacillus phage LJ, complete genome	20190-20219	6	0.8
NZ_CP028241_1	1.11\|2018737\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018737-2018766	30	MG030347	Proteus phage PM135, complete genome	13665-13694	6	0.8
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_004747	Streptococcus thermophilus ST2-1 plasmid pND103, complete sequence	1910-1939	6	0.8
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_KU574030	Streptococcus thermophilus strain ACA-DC 0040 plasmid pST0040, complete sequence	162-191	6	0.8
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NC_000937	Streptococcus thermophilus ST135 plasmid pER35, complete sequence	84-113	6	0.8
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_LR135285	Enterococcus faecium isolate E6975 plasmid 8	536-565	6	0.8
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_LR135176	Enterococcus faecium isolate E4402 plasmid 3	3173-3202	6	0.8
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP035652	Enterococcus faecium strain UAMSEF_08 plasmid unnamed4, complete sequence	1553-1582	6	0.8
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP035658	Enterococcus faecium strain UAMSEF_09 plasmid unnamed4, complete sequence	1982-2011	6	0.8
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP035664	Enterococcus faecium strain UAMSEF_20 plasmid unnamed4, complete sequence	2890-2919	6	0.8
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP035646	Enterococcus faecium strain UAMSEF_01 plasmid unnamed4, complete sequence	1349-1378	6	0.8
NZ_CP028241_1	1.6\|2018407\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018407-2018436	30	NZ_CP013615	Clostridium perfringens strain JP838 plasmid pJFP838A, complete sequence	137496-137525	7	0.767
NZ_CP028241_1	1.7\|2018473\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018473-2018502	30	NZ_CP032297	Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence	438717-438746	7	0.767
NZ_CP028241_1	1.7\|2018473\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018473-2018502	30	NZ_CP036488	Rahnella aquatilis strain MEM40 plasmid pMEM40-1, complete sequence	130158-130187	7	0.767
NZ_CP028241_1	1.7\|2018473\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018473-2018502	30	NC_017060	Rahnella aquatilis HX2 plasmid PRA1, complete sequence	206520-206549	7	0.767
NZ_CP028241_1	1.7\|2018473\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018473-2018502	30	NC_015062	Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence	209307-209336	7	0.767
NZ_CP028241_1	1.7\|2018473\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018473-2018502	30	NZ_CP034838	Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence	195905-195934	7	0.767
NZ_CP028241_1	1.7\|2018473\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018473-2018502	30	NZ_CP034839	Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence	195905-195934	7	0.767
NZ_CP028241_1	1.7\|2018473\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018473-2018502	30	NZ_CP034837	Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence	156219-156248	7	0.767
NZ_CP028241_1	1.8\|2018539\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018539-2018568	30	CP040041	Acinetobacter baumannii strain VB958 plasmid unnamed1, complete sequence	44809-44838	7	0.767
NZ_CP028241_1	1.9\|2018605\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018605-2018634	30	NC_019909	Yersinia phage phiR1-RT complete genome	58003-58032	7	0.767
NZ_CP028241_1	1.10\|2018671\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018671-2018700	30	JX486088	Lactobacillus phage ATCC 8014-B2, complete genome	78901-78930	7	0.767
NZ_CP028241_1	1.11\|2018737\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018737-2018766	30	MN336265	Salmonella phage vB_SenS-EnJE6, complete genome	26931-26960	7	0.767
NZ_CP028241_1	1.16\|2019067\|29\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019067-2019095	29	KJ603229	Shigella phage POCJ13, complete genome	5228-5256	7	0.759
NZ_CP028241_1	1.16\|2019067\|29\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019067-2019095	29	NC_029120	Shigella phage 75/02 Stx, complete genome	5228-5256	7	0.759
NZ_CP028241_1	1.16\|2019067\|29\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019067-2019095	29	NZ_LR134403	Listeria monocytogenes strain NCTC7974 plasmid 6, complete sequence	158567-158595	7	0.759
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	LR135189	Enterococcus faecium isolate E4413 genome assembly, plasmid: 5	1616-1645	7	0.767
NZ_CP028241_1	1.5\|2018341\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018341-2018370	30	MN693541	Marine virus AFVG_25M436, complete genome	21215-21244	8	0.733
NZ_CP028241_1	1.11\|2018737\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2018737-2018766	30	MH830339	Proteus phage Stubb, complete genome	88638-88667	8	0.733
NZ_CP028241_1	1.16\|2019067\|29\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019067-2019095	29	NZ_CP017592	Pantoea stewartii subsp. stewartii DC283 plasmid ppDSJ01, complete sequence	42214-42242	8	0.724
NZ_CP028241_1	1.18\|2019198\|30\|NZ_CP028241\|CRT,CRISPRCasFinder,PILER-CR	2019198-2019227	30	NZ_CP014325	Borrelia anserina Es isolate UTHSCSA plasmid lpA89, complete sequence	48540-48569	9	0.7

1. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP037437 (Lactobacillus plantarum strain EM plasmid pEM8, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

2. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP012284 (Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

3. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP021460 (Lactobacillus brevis strain ZLB004 plasmid p4, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

4. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_017018 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-7, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

5. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP012270 (Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

6. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP033887 (Lactobacillus brevis strain LMT1-73 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

7. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP019713 (Lactobacillus plantarum strain Q7 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

8. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP014886 (Lactobacillus backii strain TMW 1.1991 plasmid pL11991-5, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

9. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP014920 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

10. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP014629 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-5, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

11. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP035118 (Lactobacillus plantarum strain SRCM103295 plasmid unnamed5) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

12. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_024988 (Lactobacillus plantarum subsp. plantarum plasmid pZL4, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

13. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP016493 (Lactobacillus pentosus strain BGM48 plasmid pBGM48-2, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

14. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP027193 (Lactobacillus sp. CBA3605 plasmid pCBA3605-3, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

15. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP023006 (Pediococcus pentosaceus strain SS1-3 plasmid pSS1302, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

16. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP023006 (Pediococcus pentosaceus strain SS1-3 plasmid pSS1302, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

17. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP023006 (Pediococcus pentosaceus strain SS1-3 plasmid pSS1302, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

18. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP019983 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-13, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

19. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP019983 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-13, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

20. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP033892 (Lactobacillus plantarum strain LMT1-48 plasmid p_4, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

21. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP017700 (Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-6, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

22. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP017700 (Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-6, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

23. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP017700 (Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-6, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

24. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_003320 (Lactobacillus curvatus strain CRL705 plasmid pRC18, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

25. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP048925 (Lactobacillus plantarum strain X7022 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

26. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP013166 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-10, complete sequence) position: , mismatch: 0, identity: 1.0

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaatttcaagatgagcgtcaaaaac	Protospacer
******************************

27. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP021504 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-3 sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

28. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP021504 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-3 sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

29. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP004408 (Lactobacillus plantarum DOMLa plasmid unnamed200, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

30. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP015127 (Lactobacillus plantarum strain CAUH2 plasmid pCAUH201, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

31. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_KJ868089 (Lactobacillus pentosus strain F03 plasmid pF03-2, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

32. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_003893 (Lactobacillus plantarum plasmid pLP2000, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

33. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_012220 (Lactobacillus plantarum plasmid pLD1, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

34. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP012654 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK10, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

35. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP012654 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK10, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

36. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to KX859226 (Lactobacillus plantarum plasmid p3-11C, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

37. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_001370 (Lactobacillus plantarum plasmid pC30il, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

38. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_011136 (Lactobacillus plantarum plasmid pLR1, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

39. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP046660 (Lactobacillus plantarum strain 123-17 plasmid p123-18.4, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

40. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_019321 (Lactobacillus plantarum plasmid pR18, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

41. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_011497 (Lactobacillus plantarum plasmid pLP2111, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

42. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP013168 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-13, complete sequence) position: , mismatch: 0, identity: 1.0

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactagt	Protospacer
******************************

43. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP022711 (Lactobacillus sakei strain WiKim0063 plasmid pLBS02, complete sequence) position: , mismatch: 1, identity: 0.967

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggcaaacttcaagatgagcgtcaaaaac	Protospacer
********.*********************

44. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_010914 (Weissella cibaria plasmid pKW2126, complete sequence) position: , mismatch: 1, identity: 0.967

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagcaacaactcgt	Protospacer
*************************** **

45. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP023495 (Lactobacillus plantarum strain NCIMB 700965 plasmid unamed5, complete sequence) position: , mismatch: 2, identity: 0.933

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggaaaatctcaagatgagcgtcaaaaac	Protospacer
**** ****.********************

46. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP032362 (Lactobacillus plantarum strain ZFM55 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggaaaattccaagatgagcgtcaaaaac	Protospacer
**** *****.*******************

47. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP032362 (Lactobacillus plantarum strain ZFM55 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggaaaattccaagatgagcgtcaaaaac	Protospacer
**** *****.*******************

48. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP040739 (Lactobacillus futsaii strain Y97 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.933

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggaaaattccaagatgagcgtcaaaaac	Protospacer
**** *****.*******************

49. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP040739 (Lactobacillus futsaii strain Y97 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.933

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggaaaattccaagatgagcgtcaaaaac	Protospacer
**** *****.*******************

50. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP032647 (Lactobacillus plantarum strain ZFM9 plasmid unnamed5, complete sequence) position: , mismatch: 2, identity: 0.933

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggaaaattccaagatgagcgtcaaaaac	Protospacer
**** *****.*******************

51. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP026510 (Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed5, complete sequence) position: , mismatch: 2, identity: 0.933

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggaaaatctcaagatgagcgtcaaaaac	Protospacer
**** ****.********************

52. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_021528 (Lactobacillus plantarum 16 plasmid Lp16I, complete sequence) position: , mismatch: 2, identity: 0.933

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggaaaatctcaagatgagcgtcaaaaac	Protospacer
**** ****.********************

53. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP016493 (Lactobacillus pentosus strain BGM48 plasmid pBGM48-2, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

54. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP028328 (Lactobacillus sp. D1501 plasmid p2, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

55. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP024414 (Lactobacillus plantarum strain ATCC 8014 plasmid pLP49, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

56. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP024417 (Lactobacillus plantarum strain ATCC 8014 plasmid pLP9039, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

57. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP021482 (Lactobacillus brevis strain SRCM101174 plasmid pLB1174-4 sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

58. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP021482 (Lactobacillus brevis strain SRCM101174 plasmid pLB1174-4 sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

59. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP021482 (Lactobacillus brevis strain SRCM101174 plasmid pLB1174-4 sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

60. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP021676 (Lactobacillus brevis strain SRCM101106 plasmid pLB1106-4 sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

61. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP021458 (Lactobacillus brevis strain ZLB004 plasmid p2, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

62. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP012281 (Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-6, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

63. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP021477 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-6) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

64. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP021998 (Lactobacillus plantarum strain LPL-1 plasmid pPLP-1, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

65. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP031213 (Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_E, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

66. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP018328 (Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-4, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

67. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP018328 (Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-4, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

68. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP014632 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-8, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

69. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP035019 (Lactobacillus plantarum strain 12_3 plasmid pldG, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

70. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP046039 (Lactobacillus sakei strain CBA3614 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

71. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP017411 (Lactobacillus plantarum strain RI-113 plasmid pRI113_5, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

72. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP015128 (Lactobacillus plantarum strain CAUH2 plasmid pCAUH202, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

73. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_LT960786 (Lactobacillus sakei isolate MFPB19 plasmid 3, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

74. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_004944 (Lactobacillus plantarum 5057 plasmid pMD5057, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

75. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP019984 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-14, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

76. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP019984 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-14, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

77. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP019984 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-14, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

78. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_015979 (Lactobacillus sanfranciscensis TMW 1.1304 plasmid pLS1, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

79. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_016636 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-3, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

80. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_021228 (Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp6, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

81. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_AP014681 (Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-1, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

82. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP031203 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_E, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

83. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP031179 (Lactobacillus brevis strain UCCLB556 plasmid pUCCLB556_E, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

84. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_020824 (Lactobacillus brevis KB290 plasmid pKB290-7, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

85. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP032658 (Lactobacillus pentosus strain ZFM222 plasmid unnamed4, complete sequence) position: , mismatch: 3, identity: 0.9

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaggccaattacaagatgagcgtcaaaagc	Protospacer
***** **** *****************.*

86. spacer 1.17|2019132|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to CP019349 (Lactobacillus plantarum strain KLDS1.0391 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

aaggcaaatttcaagatgagcgtcaaaaac	CRISPR spacer
aaagtcaatttcaagatgaacgtcaaaaac	Protospacer
**.*. *************.**********

87. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_MH671358 (Bacillus pumilus strain 63-2-2 plasmid pBP-6322, complete sequence) position: , mismatch: 4, identity: 0.867

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaacaactcaa	Protospacer
******************* ******* .

88. spacer 1.10|2018671|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to MG744354 (Lactobacillus phage Satyr, complete genome) position: , mismatch: 5, identity: 0.833

taccggctttacaataacgtgatattcctt	CRISPR spacer
agccggctttacaacaacgtggtattcctg	Protospacer
 .************.******.*******

89. spacer 1.10|2018671|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to MG765274 (Lactobacillus phage Maenad, complete genome) position: , mismatch: 5, identity: 0.833

taccggctttacaataacgtgatattcctt	CRISPR spacer
agccggctttacaacaacgtggtattcctg	Protospacer
 .************.******.*******

90. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP028984 (Lactobacillus plantarum strain LQ80 plasmid pLQ807, complete sequence) position: , mismatch: 5, identity: 0.833

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaacaacggac	Protospacer
******************* ****** ...

91. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_KM272265 (Lactobacillus plantarum strain ATIT-023 plasmid pLP-8, complete sequence) position: , mismatch: 5, identity: 0.833

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaacaacgtca	Protospacer
******************* ******

92. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_024985 (Lactobacillus plantarum subsp. plantarum strain Zhang-11 plasmid pZL2, complete sequence) position: , mismatch: 5, identity: 0.833

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaacaacgtca	Protospacer
******************* ******

93. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_014919 (Lactobacillus brevis strain D11 plasmid pSD11, complete sequence) position: , mismatch: 5, identity: 0.833

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaacaacgtca	Protospacer
******************* ******

94. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_016035 (Lactobacillus buchneri subsp. silagei CD034 plasmid pCD034-1, complete sequence) position: , mismatch: 5, identity: 0.833

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaacaacgtca	Protospacer
******************* ******

95. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_007593 (Pediococcus damnosus plasmid pF8801, complete sequence) position: , mismatch: 5, identity: 0.833

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaacaacgtca	Protospacer
******************* ******

96. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_012722 (Lactobacillus pentosus p1-4 plasmid complete sequence, strain F121-1) position: , mismatch: 5, identity: 0.833

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaacaacgtca	Protospacer
******************* ******

97. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_019372 (Lactobacillus plantarum plasmid pG6301, complete sequence) position: , mismatch: 5, identity: 0.833

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaacaacgtca	Protospacer
******************* ******

98. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_009666 (Lactobacillus plantarum M4 plasmid pM4, complete sequence) position: , mismatch: 5, identity: 0.833

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaacaacgtca	Protospacer
******************* ******

99. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP013167 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-12, complete sequence) position: , mismatch: 5, identity: 0.833

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaacaacgtca	Protospacer
******************* ******

100. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_001858 (Bacillus pumilus plasmid pPL10, complete plasmid sequence) position: , mismatch: 5, identity: 0.833

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaacaattcaa	Protospacer
******************* *****.* .

101. spacer 1.7|2018473|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to MF999224 (Lactobacillus phage LJ, complete genome) position: , mismatch: 6, identity: 0.8

acgt-aactttaagctgttgcacaaactgcg	CRISPR spacer
-cgtcaaccttaagctgtttcacaaacttta	Protospacer
 *** ***.********** ******** ..

102. spacer 1.11|2018737|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to MG030347 (Proteus phage PM135, complete genome) position: , mismatch: 6, identity: 0.8

tcatcggttgacctatcagctgattttggt	CRISPR spacer
gcatcggttgacctatcagcagatgctact	Protospacer
 ******************* *** .*. *

103. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_004747 (Streptococcus thermophilus ST2-1 plasmid pND103, complete sequence) position: , mismatch: 6, identity: 0.8

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaataattcac	Protospacer
******************* **.**.* ..

104. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_KU574030 (Streptococcus thermophilus strain ACA-DC 0040 plasmid pST0040, complete sequence) position: , mismatch: 6, identity: 0.8

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaataattcac	Protospacer
******************* **.**.* ..

105. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_000937 (Streptococcus thermophilus ST135 plasmid pER35, complete sequence) position: , mismatch: 6, identity: 0.8

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactattagaaataattcac	Protospacer
******************* **.**.* ..

106. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_LR135285 (Enterococcus faecium isolate E6975 plasmid 8) position: , mismatch: 6, identity: 0.8

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactataggcaactatttct	Protospacer
**************** .***** *.*  *

107. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_LR135176 (Enterococcus faecium isolate E4402 plasmid 3) position: , mismatch: 6, identity: 0.8

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactataggcaactatttct	Protospacer
**************** .***** *.*  *

108. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP035652 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.8

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactataggcaactatttct	Protospacer
**************** .***** *.*  *

109. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP035658 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.8

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactataggcaactatttct	Protospacer
**************** .***** *.*  *

110. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP035664 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.8

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactataggcaactatttct	Protospacer
**************** .***** *.*  *

111. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP035646 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.8

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactataggcaactatttct	Protospacer
**************** .***** *.*  *

112. spacer 1.6|2018407|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP013615 (Clostridium perfringens strain JP838 plasmid pJFP838A, complete sequence) position: , mismatch: 7, identity: 0.767

gtaattgagtgttgatattctctttacttt	CRISPR spacer
taaattgagtttttatattctctttcttct	Protospacer
  ******** ** *********** .*.*

113. spacer 1.7|2018473|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP032297 (Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

114. spacer 1.7|2018473|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP036488 (Rahnella aquatilis strain MEM40 plasmid pMEM40-1, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

115. spacer 1.7|2018473|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_017060 (Rahnella aquatilis HX2 plasmid PRA1, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

116. spacer 1.7|2018473|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_015062 (Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

117. spacer 1.7|2018473|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP034838 (Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

118. spacer 1.7|2018473|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP034839 (Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

119. spacer 1.7|2018473|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP034837 (Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

120. spacer 1.8|2018539|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to CP040041 (Acinetobacter baumannii strain VB958 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

taactcagttctgaacggtgccttattgac	CRISPR spacer
caaggaagttctgaacggtggcttgttgat	Protospacer
.**   ************** ***.****.

121. spacer 1.9|2018605|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_019909 (Yersinia phage phiR1-RT complete genome) position: , mismatch: 7, identity: 0.767

tagagcagtaattgcttgactatagttact	CRISPR spacer
acgagtagtaatagcttgactatagtaatc	Protospacer
  ***.****** ************* *..

122. spacer 1.10|2018671|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to JX486088 (Lactobacillus phage ATCC 8014-B2, complete genome) position: , mismatch: 7, identity: 0.767

taccggctttacaataacgtgatattcctt	CRISPR spacer
ggctggctttacaataacatggtattctct	Protospacer
 .*.**************.**.*****..*

123. spacer 1.11|2018737|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to MN336265 (Salmonella phage vB_SenS-EnJE6, complete genome) position: , mismatch: 7, identity: 0.767

tcatcggttgacctatcagctgattttggt	CRISPR spacer
gcatcggttgacgtatcagcttatgacgga	Protospacer
 *********** ******** **  .**

124. spacer 1.16|2019067|29|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to KJ603229 (Shigella phage POCJ13, complete genome) position: , mismatch: 7, identity: 0.759

acaaactgctgacgatgacaacgaaagtc	CRISPR spacer
cacaactgctggcgatgacaacgataacc	Protospacer
   ********.************ *..*

125. spacer 1.16|2019067|29|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NC_029120 (Shigella phage 75/02 Stx, complete genome) position: , mismatch: 7, identity: 0.759

acaaactgctgacgatgacaacgaaagtc	CRISPR spacer
cacaactgctggcgatgacaacgataacc	Protospacer
   ********.************ *..*

126. spacer 1.16|2019067|29|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_LR134403 (Listeria monocytogenes strain NCTC7974 plasmid 6, complete sequence) position: , mismatch: 7, identity: 0.759

acaaactgctgacgatgacaacgaaagtc	CRISPR spacer
aaccaatggtgacgatgacaacgaaagaa	Protospacer
*   * ** ******************

127. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to LR135189 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.767

cttatcttgatactattagcaacaactagt	CRISPR spacer
cttatcttgatactataggcaactattttc	Protospacer
**************** .***** *.*  .

128. spacer 1.5|2018341|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to MN693541 (Marine virus AFVG_25M436, complete genome) position: , mismatch: 8, identity: 0.733

agtcctgatcttacatctagcaaggctcgg	CRISPR spacer
attgatgatcttacatctagcaatgcaaca	Protospacer
* *  ****************** **   .

129. spacer 1.11|2018737|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to MH830339 (Proteus phage Stubb, complete genome) position: , mismatch: 8, identity: 0.733

tcatcggttgacctatcagctgattttggt	CRISPR spacer
gcatcggttgacctatcggcagatgccact	Protospacer
 ****************.** *** ... *

130. spacer 1.16|2019067|29|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP017592 (Pantoea stewartii subsp. stewartii DC283 plasmid ppDSJ01, complete sequence) position: , mismatch: 8, identity: 0.724

acaaactgctgacgatgacaacgaaagtc	CRISPR spacer
caccacggctgacgatgacaacgaattta	Protospacer
    ** ******************  *

131. spacer 1.18|2019198|30|NZ_CP028241|CRT,CRISPRCasFinder,PILER-CR matches to NZ_CP014325 (Borrelia anserina Es isolate UTHSCSA plasmid lpA89, complete sequence) position: , mismatch: 9, identity: 0.7

cttatcttgatactattagcaacaactagt	CRISPR spacer
caaggtgacatactattatcaacaactagt	Protospacer
*  . .   ********* ***********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

6817 : 34840

Oenococcus_phage(52.17%)

protease,tail,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021356226.1\|6817_7114_+\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	5.6e-10	39.2
WP_044431359.1\|7260_8946_+	hypothetical protein	V5US81	Oenococcus_phage	1.2e-120	58.8
WP_003642815.1\|8920_9199_+	hypothetical protein	NA	NA	NA	NA
WP_003642816.1\|9250_9457_+	hypothetical protein	NA	NA	NA	NA
WP_033608829.1\|9629_10307_+	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	1.1e-16	33.5
WP_003642818.1\|10321_10672_+	hypothetical protein	V5UTH9	Oenococcus_phage	5.8e-30	62.9
WP_003642819.1\|10691_11714_+	hypothetical protein	V5US24	Oenococcus_phage	3.7e-117	62.5
WP_003642820.1\|11726_11903_+	hypothetical protein	NA	NA	NA	NA
WP_024971556.1\|11914_12247_+	hypothetical protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
WP_003642822.1\|12246_12594_+	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
WP_003642823.1\|12595_13147_+	HK97 gp10 family phage protein	V5URV0	Oenococcus_phage	3.3e-64	61.7
WP_003642824.1\|13146_13512_+	hypothetical protein	V5UQS4	Oenococcus_phage	3.0e-29	53.4
WP_099447638.1\|13613_13997_+\|tail	phage tail protein	V5USQ9	Oenococcus_phage	1.8e-37	58.4
WP_003642826.1\|14096_14495_+	hypothetical protein	V9QJA0	Oenococcus_phage	3.0e-46	74.8
WP_063490746.1\|14602_14866_+	hypothetical protein	V9QKH3	Oenococcus_phage	1.5e-22	64.2
WP_063490739.1\|14881_20713_+	hypothetical protein	V5URV5	Oenococcus_phage	1.9e-226	40.8
WP_099739626.1\|20756_21089_+	hypothetical protein	V5UQS8	Oenococcus_phage	2.2e-42	73.4
WP_063490740.1\|21103_26314_+	hypothetical protein	Q6SE68	Lactobacillus_prophage	3.7e-144	59.4
WP_021356216.1\|26320_26770_+	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	6.8e-23	40.5
WP_003642832.1\|26772_27207_+	hypothetical protein	NA	NA	NA	NA
WP_080467238.1\|27367_28489_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	1.2e-28	61.9
WP_060418016.1\|28489_28786_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	2.0e-39	77.6
WP_063490741.1\|28772_29147_+\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	1.8e-16	67.5
WP_114788177.1\|29454_29586_+	LysM peptidoglycan-binding domain-containing protein	A0A0P0HRN9	Lactobacillus_phage	1.7e-06	59.5
WP_063490742.1\|29674_30208_+	DUF4065 domain-containing protein	A0A0R6PCI9	Moraxella_phage	1.9e-19	36.2
WP_063490743.1\|30204_30999_+	hypothetical protein	Q938J2	Temperate_phage	1.4e-07	25.4
WP_003644667.1\|31415_32267_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_011101730.1\|32489_32882_+	YxeA family protein	NA	NA	NA	NA
WP_003644665.1\|33109_34840_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-46	27.6

DBSCAN-SWA_2

863663 : 876441

Lactobacillus_phage(70.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021356804.1\|863663_864608_-	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	6.7e-73	45.8
WP_013355473.1\|864632_865298_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_021356352.1\|866007_866700_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.3e-35	37.6
WP_021356351.1\|866692_868060_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.0e-25	31.4
WP_021356350.1\|868450_868891_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	4.4e-75	95.9
WP_021356349.1\|868961_869522_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	1.0e-100	99.5
WP_160231001.1\|869609_872048_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.4
WP_063723106.1\|872050_872665_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.4e-111	99.5
WP_003643099.1\|873007_873955_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_015825455.1\|874140_875112_+	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.8e-182	99.4
WP_065080349.1\|875202_876441_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	3.0e-214	96.4

DBSCAN-SWA_3

895584 : 966599

Lactobacillus_phage(81.82%)

tRNA,tail,capsid,integrase,protease,portal,holin,terminase,head,transposase

attL 917175:917191|attR 960874:960890

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643128.1\|895584_897273_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.2e-75	32.9
WP_160231007.1\|897544_897991_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003643130.1\|898379_898625_-	hypothetical protein	NA	NA	NA	NA
WP_003643131.1\|898751_900143_-	MATE family efflux transporter	NA	NA	NA	NA
WP_003644260.1\|900418_902194_-	SLC13 family permease	NA	NA	NA	NA
WP_003645241.1\|902703_904443_-	aryl-sulfate sulfotransferase	NA	NA	NA	NA
WP_075060694.1\|904664_905642_-	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_003643136.1\|905610_906234_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	6.3e-27	40.6
WP_044430280.1\|906236_907412_-	sulfate adenylyltransferase	A0A2P1ELS9	Moumouvirus	3.8e-49	31.7
WP_003643138.1\|907389_909027_-	sulfotransferase family protein	NA	NA	NA	NA
WP_160231008.1\|909916_912223_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_011101376.1\|912236_914093_+	bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_003645248.1\|914165_914525_+	YisL family protein	NA	NA	NA	NA
WP_011101375.1\|914623_915139_-	GtrA family protein	NA	NA	NA	NA
WP_160231009.1\|915193_916264_+	hypothetical protein	NA	NA	NA	NA
WP_003643144.1\|916296_916416_+	hypothetical protein	NA	NA	NA	NA
WP_011101374.1\|916428_916854_+	lipoprotein	NA	NA	NA	NA
917175:917191	attL	NA	NA	NA	NA
WP_057874333.1\|917408_917591_+	hypothetical protein	NA	NA	NA	NA
WP_160231010.1\|917580_917928_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_160231011.1\|917999_919547_+\|transposase	IS66 family transposase	S5VLC8	Leptospira_phage	5.6e-24	27.9
WP_016058344.1\|920250_920781_-	hypothetical protein	E9LUS0	Lactobacillus_phage	2.9e-41	100.0
WP_003644510.1\|920793_921057_-\|holin	holin	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_072534410.1\|922087_922300_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	3.6e-19	83.6
WP_072534409.1\|922296_923337_-	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	1.8e-58	96.1
WP_160231012.1\|923485_923734_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	1.6e-29	95.8
WP_160231013.1\|923726_926246_-\|tail	phage tail protein	A0A2K9VDD0	Lactobacillus_phage	8.6e-216	69.9
WP_160231014.1\|926262_928677_-	hypothetical protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	92.9
WP_122036799.1\|928743_930519_-\|tail	phage tail protein	A0A2P0ZLH2	Lactobacillus_phage	1.5e-299	89.3
WP_016058335.1\|935539_935731_-	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
WP_057137284.1\|935727_936111_-	hypothetical protein	E9LUQ9	Lactobacillus_phage	1.5e-63	99.2
WP_021732001.1\|936312_936951_-\|tail	major tail protein	E9LUQ8	Lactobacillus_phage	3.7e-107	92.9
WP_022638398.1\|936951_937335_-	DUF806 family protein	E9LUQ7	Lactobacillus_phage	1.0e-64	96.9
WP_021732003.1\|937331_937772_-	hypothetical protein	E9LUQ6	Lactobacillus_phage	3.2e-78	97.9
WP_021732004.1\|937761_938124_-\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	1.5e-65	99.2
WP_016058329.1\|938107_938446_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	7.0e-57	100.0
WP_114619779.1\|938518_939751_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	1.9e-200	87.7
WP_033608392.1\|939750_940509_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.5e-126	94.4
WP_160231015.1\|940486_941683_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	1.5e-205	89.7
WP_033608390.1\|941685_941880_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	2.0e-24	92.2
WP_122036924.1\|941869_943777_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	9.8e-180	49.7
WP_033608389.1\|943763_944225_-\|terminase	phage terminase small subunit P27 family	A0A286QRF4	Streptococcus_phage	6.5e-45	58.2
WP_122036801.1\|944445_944958_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	6.6e-83	93.6
WP_122036802.1\|944926_945106_-	hypothetical protein	E9LUP6	Lactobacillus_phage	8.6e-14	71.2
WP_122036803.1\|945152_945356_-	hypothetical protein	NA	NA	NA	NA
WP_122036804.1\|945427_946045_-	DUF4145 domain-containing protein	Q20DE2	Lactobacillus_phage	7.8e-54	49.0
WP_122036805.1\|946467_946893_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	7.7e-61	79.4
WP_160231016.1\|947237_947435_-	hypothetical protein	NA	NA	NA	NA
WP_160231017.1\|947507_947888_-	hypothetical protein	A0A2P0ZKS9	Lactobacillus_phage	8.8e-32	56.9
WP_076637232.1\|948128_948620_-	methyltransferase domain-containing protein	O03918	Lactobacillus_phage	1.2e-84	89.9
WP_160231018.1\|948704_949013_-	hypothetical protein	E9LUN7	Lactobacillus_phage	6.0e-47	93.1
WP_122036806.1\|949148_949934_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	3.5e-131	90.8
WP_122036807.1\|949933_950731_-	replication protein	Q9AZA0	Lactobacillus_prophage	1.3e-53	68.9
WP_063487248.1\|950780_951473_-	hypothetical protein	E9LUU3	Lactobacillus_phage	1.5e-117	88.7
WP_063487249.1\|951492_951798_-	hypothetical protein	NA	NA	NA	NA
WP_072534386.1\|952011_952242_-	hypothetical protein	E9LUT8	Lactobacillus_phage	1.3e-22	78.1
WP_063487251.1\|952244_952499_-	hypothetical protein	NA	NA	NA	NA
WP_063487252.1\|952588_952918_-	DUF771 domain-containing protein	E9LUT3	Lactobacillus_phage	4.4e-48	81.7
WP_072534385.1\|953010_953730_+	hypothetical protein	NA	NA	NA	NA
WP_080466786.1\|953893_954637_-	hypothetical protein	A0A1P8BM06	Lactococcus_phage	9.7e-51	44.9
WP_080382821.1\|955110_955338_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_003644552.1\|955423_955639_-	hypothetical protein	NA	NA	NA	NA
WP_003641361.1\|955894_956221_+	helix-turn-helix transcriptional regulator	A0A1B0Y2R0	Lactobacillus_phage	6.9e-17	44.1
WP_003641360.1\|956251_956641_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	4.6e-36	54.3
WP_160231019.1\|956705_956906_+	hypothetical protein	E9LUS6	Lactobacillus_phage	3.2e-25	98.5
WP_128536997.1\|957195_957390_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	3.3e-11	60.3
WP_072534384.1\|957572_958031_+	hypothetical protein	NA	NA	NA	NA
WP_080488510.1\|958237_958642_-	hypothetical protein	NA	NA	NA	NA
WP_072534383.1\|958631_959090_-	SocA family protein	NA	NA	NA	NA
WP_072534382.1\|959165_959507_-	hypothetical protein	NA	NA	NA	NA
WP_064775478.1\|959620_960757_+\|integrase	site-specific integrase	E9LUS1	Lactobacillus_phage	4.0e-213	99.2
WP_011101373.1\|961401_963672_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	6.7e-119	31.5
960874:960890	attR	NA	NA	NA	NA
WP_003643147.1\|963733_964021_-	hypothetical protein	NA	NA	NA	NA
WP_003643148.1\|964135_964648_+	hypothetical protein	NA	NA	NA	NA
WP_003644254.1\|964761_965241_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011101372.1\|965933_966599_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_4

1100062 : 1107588

Enterobacteria_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102170849.1\|1100062_1100992_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	8.0e-18	28.8
WP_102170848.1\|1101248_1101866_-	recombinase family protein	E5FFF9	Burkholderia_phage	1.5e-17	36.0
WP_053566565.1\|1102242_1103163_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.6e-50	37.2
WP_141708335.1\|1103116_1104130_+	flippase	NA	NA	NA	NA
WP_053566563.1\|1104186_1105032_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.6e-33	36.4
WP_160231030.1\|1105095_1106124_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	3.4e-70	43.3
WP_160231031.1\|1106133_1106715_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.1e-37	44.0
WP_053566560.1\|1106718_1107588_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.4e-101	60.1

DBSCAN-SWA_5

1547853 : 1556477

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355240.1\|1547853_1548849_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5
WP_003640969.1\|1548987_1549773_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355239.1\|1549776_1550673_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.4e-82	55.7
WP_003640967.1\|1550771_1551119_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003640966.1\|1551143_1552163_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640965.1\|1552179_1552509_-	hypothetical protein	NA	NA	NA	NA
WP_011101140.1\|1552505_1553171_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640957.1\|1553568_1553820_-	YaaL family protein	NA	NA	NA	NA
WP_003637790.1\|1553834_1554434_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|1554449_1554758_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003644909.1\|1554779_1556477_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0

DBSCAN-SWA_6

1693244 : 1752999

uncultured_Mediterranean_phage(20.0%)

tRNA,protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060684287.1\|1693244_1694516_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.6e-96	43.9
WP_003642042.1\|1694982_1696596_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003642041.1\|1696768_1697377_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642040.1\|1697421_1697862_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003643833.1\|1698224_1699157_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_003643832.1\|1699171_1700524_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_015379810.1\|1700543_1701353_+	sugar-phosphatase	NA	NA	NA	NA
WP_160231069.1\|1701521_1702508_-	hypothetical protein	NA	NA	NA	NA
WP_003642034.1\|1702590_1703613_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|1703901_1704882_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_085438943.1\|1705247_1706072_-	serine hydrolase	NA	NA	NA	NA
WP_003642031.1\|1706307_1707690_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_003642030.1\|1707758_1708595_-	pur operon repressor	NA	NA	NA	NA
WP_063722866.1\|1709087_1709351_-	hypothetical protein	NA	NA	NA	NA
WP_063722867.1\|1709365_1709908_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_003642024.1\|1711088_1711892_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|1711878_1712577_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_003642022.1\|1712844_1713789_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003643828.1\|1714098_1714965_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|1715097_1715349_-	Veg protein	NA	NA	NA	NA
WP_011101015.1\|1715453_1716344_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_011101014.1\|1716340_1716904_-	ribonuclease M5	NA	NA	NA	NA
WP_003643825.1\|1716890_1717667_-	TatD family hydrolase	NA	NA	NA	NA
WP_160231070.1\|1717789_1718974_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_003643823.1\|1719205_1721257_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_011101012.1\|1721578_1721968_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003642012.1\|1722564_1723407_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003646490.1\|1723406_1724111_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_160231071.1\|1724132_1725092_-	IpaB/EvcA family protein	NA	NA	NA	NA
WP_011101011.1\|1725084_1726359_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_011101010.1\|1726404_1727322_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003643820.1\|1727491_1728286_-	hypothetical protein	NA	NA	NA	NA
WP_011101008.1\|1728290_1729523_-	hypothetical protein	NA	NA	NA	NA
WP_011101007.1\|1729878_1730892_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642004.1\|1731004_1731751_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_011101006.1\|1731900_1732797_-	ROK family protein	NA	NA	NA	NA
WP_003642002.1\|1732917_1734354_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_003643816.1\|1734371_1735727_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642000.1\|1735949_1736372_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|1736361_1736550_-	hypothetical protein	NA	NA	NA	NA
WP_160231072.1\|1736556_1737918_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_011101005.1\|1737990_1738701_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011101004.1\|1739108_1740125_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003643814.1\|1740563_1741340_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_011101002.1\|1741598_1743908_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_003646479.1\|1744197_1744491_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	9.9e-07	48.3
WP_063722041.1\|1744502_1744790_-	hypothetical protein	NA	NA	NA	NA
WP_057136860.1\|1744905_1745592_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_160231073.1\|1745685_1746366_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063721086.1\|1746452_1747121_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_062688861.1\|1747965_1749342_-	HlyD family secretion protein	NA	NA	NA	NA
WP_160231074.1\|1749357_1751508_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	1.4e-44	27.7
WP_003641985.1\|1751774_1751945_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_021356667.1\|1751969_1752128_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_021356666.1\|1752225_1752999_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_7

1756417 : 1808260

Streptococcus_phage(25.0%)

protease,transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641979.1\|1756417_1756564_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641978.1\|1756899_1757088_-	hypothetical protein	NA	NA	NA	NA
WP_160231075.1\|1757376_1758684_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.6e-96	41.6
WP_053566566.1\|1758906_1759836_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	5.5e-19	33.0
WP_003641977.1\|1760160_1760907_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_160231076.1\|1760937_1762137_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003641975.1\|1762254_1762422_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641974.1\|1762549_1762750_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641973.1\|1763611_1763779_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641972.1\|1763809_1763983_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641971.1\|1763979_1764648_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003643803.1\|1764672_1764825_+	hypothetical protein	NA	NA	NA	NA
WP_160231077.1\|1765043_1765259_-	hypothetical protein	NA	NA	NA	NA
WP_011100995.1\|1765643_1766828_-	cation:proton antiporter	NA	NA	NA	NA
WP_011100994.1\|1766872_1768249_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_003641966.1\|1768774_1769590_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_160231078.1\|1769749_1770622_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_011100993.1\|1770692_1771484_+	HAD family hydrolase	NA	NA	NA	NA
WP_003641963.1\|1771487_1772642_+	MFS transporter	NA	NA	NA	NA
WP_160231079.1\|1772645_1773263_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_011100991.1\|1773589_1773868_-	hypothetical protein	NA	NA	NA	NA
WP_011100990.1\|1775138_1775546_-	hypothetical protein	NA	NA	NA	NA
WP_160231080.1\|1775622_1775769_-	TNT domain-containing protein	NA	NA	NA	NA
WP_100255599.1\|1775698_1775890_-	hypothetical protein	NA	NA	NA	NA
WP_003646454.1\|1776230_1776386_-	hypothetical protein	NA	NA	NA	NA
WP_003646453.1\|1776611_1776998_-	hypothetical protein	NA	NA	NA	NA
WP_072535411.1\|1777015_1777291_-	hypothetical protein	NA	NA	NA	NA
WP_003643788.1\|1777379_1777583_-	hypothetical protein	NA	NA	NA	NA
WP_011100988.1\|1777699_1777963_-	hypothetical protein	NA	NA	NA	NA
WP_160231081.1\|1777977_1778520_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_016526893.1\|1779064_1779238_-	hypothetical protein	NA	NA	NA	NA
WP_160231082.1\|1779244_1780162_-	hypothetical protein	NA	NA	NA	NA
WP_074161480.1\|1780285_1780402_-	hypothetical protein	NA	NA	NA	NA
WP_015639936.1\|1780782_1780989_-	hypothetical protein	NA	NA	NA	NA
WP_044428967.1\|1782908_1786604_-	MucBP domain-containing protein	NA	NA	NA	NA
WP_003641945.1\|1787190_1787913_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_003643774.1\|1787927_1789757_-	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003643773.1\|1789771_1791289_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_003646444.1\|1791754_1793086_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003641941.1\|1793163_1794135_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003643770.1\|1794135_1795662_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_011100979.1\|1796517_1798398_-	hypothetical protein	NA	NA	NA	NA
WP_015379753.1\|1798837_1799737_-	oxidoreductase	NA	NA	NA	NA
WP_011100977.1\|1799873_1800794_+	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_160231083.1\|1800959_1801532_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_011100976.1\|1801635_1802091_-	hypothetical protein	NA	NA	NA	NA
WP_003646440.1\|1802109_1802580_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_011100975.1\|1802689_1803886_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|1803916_1804426_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003643763.1\|1804538_1804907_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_013355172.1\|1805171_1806677_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_024002428.1\|1806834_1807503_-	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003643762.1\|1807696_1808260_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_8

3001506 : 3010020

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642585.1\|3001506_3001992_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_011101896.1\|3001975_3003106_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642587.1\|3003108_3003840_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003642588.1\|3003841_3004096_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_011101895.1\|3004095_3004776_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_021356102.1\|3004768_3006988_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.5e-144	39.1
WP_003642591.1\|3006972_3008427_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003642592.1\|3008423_3009449_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	8.4e-61	41.7
WP_003642593.1\|3009441_3010020_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.9e-22	35.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP028244

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 7066

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027822610.1\|2544_3207_+	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_027822611.1\|3342_3627_+	thioredoxin family protein	NA	NA	NA	NA
WP_160231355.1\|3648_4572_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	5.2e-78	46.1
WP_053339259.1\|4587_5238_+	DsbA family oxidoreductase	NA	NA	NA	NA
WP_064972126.1\|5392_5707_+	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	2.8e-15	32.7
WP_027822615.1\|5728_7066_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.2e-19	23.5

DBSCAN-SWA_2

13058 : 14743

Vibrio_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160231360.1\|13058_13643_-	recombinase family protein	M4QQC6	Vibrio_phage	5.9e-19	42.4
WP_011373852.1\|13822_14743_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2

DBSCAN-SWA_3

19281 : 24630

Bacillus_phage(66.67%)

integrase,transposase

attL 14801:14814|attR 27479:27492

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
14801:14814	attL	NA	NA	NA	NA
WP_119463189.1\|19281_20697_+	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	1.3e-27	26.7
WP_160231011.1\|21024_22572_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.7e-44	31.1
WP_160231010.1\|22643_22991_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_057874333.1\|22980_23163_-	hypothetical protein	NA	NA	NA	NA
WP_001748110.1\|23355_23700_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_001748109.1\|23693_23957_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_160231363.1\|24042_24630_+\|integrase	site-specific integrase	D2XR58	Bacillus_phage	2.8e-21	33.2
27479:27492	attR	NA	NA	NA	NA

DBSCAN-SWA_4

28269 : 30101

Clostridioides_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064972139.1\|28269_29055_-	ParA family protein	A0A1V0DZZ0	Clostridioides_phage	6.1e-19	34.0
WP_064972140.1\|29216_30101_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	6.4e-41	36.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP028241

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP028244

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection