CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP046665	Lactobacillus plantarum strain 83-18 plasmid p83-18.5, complete sequence	0 crisprs	NA	0	0
NZ_CP046669	Lactobacillus plantarum strain 83-18 chromosome, complete genome	0 crisprs	csa3,DinG,cas3,DEDDh	0	6
NZ_CP046668	Lactobacillus plantarum strain 83-18 plasmid p83-18.8, complete sequence	0 crisprs	NA	0	0
NZ_CP046667	Lactobacillus plantarum strain 83-18 plasmid p83-18.7, complete sequence	0 crisprs	NA	0	0
NZ_CP046661	Lactobacillus plantarum strain 83-18 plasmid p83-18.1, complete sequence	0 crisprs	RT	0	1
NZ_CP046664	Lactobacillus plantarum strain 83-18 plasmid p83-18.4, complete sequence	0 crisprs	csa3	0	1
NZ_CP046666	Lactobacillus plantarum strain 83-18 plasmid p83-18.6, complete sequence	0 crisprs	NA	0	0
NZ_CP046662	Lactobacillus plantarum strain 83-18 plasmid p83-18.2, complete sequence	0 crisprs	NA	0	1
NZ_CP046663	Lactobacillus plantarum strain 83-18 plasmid p83-18.3, complete sequence	1 crisprs	NA	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

38093 : 66232

Staphylococcus_phage(23.08%)

transposase,integrase

attL 39958:40017|attR 65917:66230

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157262055.1\|38093_39023_-\|transposase	IS30 family transposase	H7BW47	unidentified_phage	1.7e-23	33.0
39958:40017	attL	NA	NA	NA	NA
WP_157262056.1\|40383_40986_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	2.8e-32	41.9
WP_157262057.1\|41126_42302_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.8e-27	29.2
WP_041153623.1\|42389_42932_+	hypothetical protein	NA	NA	NA	NA
WP_041153624.1\|43002_43242_+	hypothetical protein	NA	NA	NA	NA
WP_041153625.1\|43799_44375_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_157262058.1\|44539_46384_+	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	9.2e-34	29.0
WP_157262059.1\|46555_47611_+	cell filamentation protein Fic	NA	NA	NA	NA
WP_041153628.1\|47825_48530_+	class I SAM-dependent methyltransferase	A0A097BYE1	Leuconostoc_phage	2.4e-38	42.5
WP_080315022.1\|48538_49057_-\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	1.3e-17	35.0
WP_041153629.1\|49094_49472_+	TOMM precursor leader peptide-binding protein	NA	NA	NA	NA
WP_041153637.1\|49552_50848_+	MFS transporter	NA	NA	NA	NA
WP_041153630.1\|50973_51270_-	hypothetical protein	NA	NA	NA	NA
WP_157262060.1\|52097_53027_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW47	unidentified_phage	1.8e-25	34.4
WP_033615077.1\|53083_53575_-	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_041142903.1\|53602_54451_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	6.2e-09	39.2
WP_152614128.1\|54927_55440_+	hypothetical protein	NA	NA	NA	NA
WP_052470497.1\|55522_56716_+	hypothetical protein	NA	NA	NA	NA
WP_041153598.1\|56921_57782_-	ABC transporter permease	NA	NA	NA	NA
WP_012391064.1\|57783_58647_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-18	28.8
WP_041153599.1\|58695_59280_-	recombinase family protein	A0A219YA40	Aeromonas_phage	8.5e-18	35.0
WP_041153600.1\|59321_59963_-	hypothetical protein	NA	NA	NA	NA
WP_157262061.1\|60552_61935_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.7e-30	27.0
WP_157262062.1\|62040_63405_-	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	2.0e-09	25.0
WP_035454452.1\|63536_63923_-	hypothetical protein	NA	NA	NA	NA
WP_003561746.1\|65056_66232_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.8e-27	29.2
65917:66230	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046669

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

512517 : 567552

Lactobacillus_phage(41.38%)

protease,terminase,capsid,integrase,tRNA,holin,tail,portal

attL 527116:527132|attR 550831:550847

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157262252.1\|512517_513210_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003643927.1\|513398_514730_-	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	5.4e-68	33.3
WP_003640926.1\|514805_515489_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_003640927.1\|515497_515794_-	N-acetyltransferase	NA	NA	NA	NA
WP_011101073.1\|515932_516469_+	dUTP diphosphatase	J9PV85	Bacillus_phage	1.1e-35	46.4
WP_003643928.1\|517516_518896_+	DNA repair protein RadA	NA	NA	NA	NA
WP_046038334.1\|518911_520075_+	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_003640932.1\|520398_521889_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_003644975.1\|522166_523579_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	3.1e-45	30.0
WP_003640934.1\|523580_523991_+	Mini-ribonuclease 3	NA	NA	NA	NA
WP_003643931.1\|523980_524748_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_054396912.1\|524749_525298_+	NYN domain-containing protein	NA	NA	NA	NA
WP_046038339.1\|525804_526407_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_003637768.1\|526468_526618_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_003640939.1\|526629_526815_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003643932.1\|526919_527468_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
527116:527132	attL	NA	NA	NA	NA
WP_046038342.1\|527495_528383_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003640942.1\|528484_528910_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_003640943.1\|529010_529700_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_003643933.1\|529898_530402_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_003637775.1\|530463_530832_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_157262254.1\|530983_532186_-\|integrase	tyrosine-type recombinase/integrase	A0A126GGK4	Streptococcus_phage	1.3e-36	29.2
WP_157262256.1\|532407_533154_-	hypothetical protein	A0A0R6PER3	Moraxella_phage	7.6e-11	26.9
WP_157262258.1\|533158_534187_-	DUF262 domain-containing protein	A0A0R6PKN1	Moraxella_phage	4.1e-55	37.0
WP_157262260.1\|534186_535230_-	DNA (cytosine-5-)-methyltransferase	A0A0R6PG08	Moraxella_phage	1.1e-84	48.8
WP_157262262.1\|535392_536319_-	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_069302404.1\|536370_536802_-	hypothetical protein	O03904	Lactobacillus_phage	1.6e-74	93.0
WP_046039922.1\|536810_537209_-	helix-turn-helix domain-containing protein	O03970	Lactobacillus_phage	1.1e-40	62.9
WP_060417487.1\|537630_537879_+	hypothetical protein	NA	NA	NA	NA
WP_157262264.1\|537908_538112_-	hypothetical protein	NA	NA	NA	NA
WP_060417488.1\|538189_538372_+	hypothetical protein	NA	NA	NA	NA
WP_157262266.1\|538432_538987_+	hypothetical protein	O03909	Lactobacillus_phage	1.9e-96	97.8
WP_063488542.1\|538992_539280_+	hypothetical protein	NA	NA	NA	NA
WP_157262268.1\|539348_539519_+	hypothetical protein	NA	NA	NA	NA
WP_157262270.1\|539659_539773_+	hypothetical protein	NA	NA	NA	NA
WP_157262272.1\|539793_540324_+	hypothetical protein	E9LUU0	Lactobacillus_phage	2.0e-53	59.1
WP_157262274.1\|540335_541301_+	hypothetical protein	A6M982	Geobacillus_virus	2.0e-64	54.5
WP_157262276.1\|541315_542260_+	DnaD domain protein	NA	NA	NA	NA
WP_063851487.1\|542582_543464_+	hypothetical protein	NA	NA	NA	NA
WP_063488409.1\|543531_543765_+	hypothetical protein	NA	NA	NA	NA
WP_157262278.1\|543785_543947_+	hypothetical protein	E9LUP6	Lactobacillus_phage	4.1e-15	79.6
WP_016527195.1\|543915_544188_+	hypothetical protein	A0A2D2W301	Escherichia_phage	1.8e-18	50.6
WP_157262280.1\|544411_544732_+	hypothetical protein	A0A1J1J9Q7	Escherichia_phage	2.3e-17	45.6
WP_063486483.1\|544789_545299_+	helix-turn-helix domain-containing protein	A0A2H4IYT3	uncultured_Caudovirales_phage	4.5e-07	36.8
WP_157262282.1\|545279_546605_+\|terminase	PBSX family phage terminase large subunit	A0A1S5SA45	Streptococcus_phage	1.3e-138	55.7
WP_157262284.1\|546607_548203_+\|portal	phage portal protein	B5LPR1	Bacillus_virus	1.7e-84	37.8
WP_157262286.1\|548195_549281_+	hypothetical protein	Q9T1B9	Listeria_phage	1.8e-37	31.2
WP_157262288.1\|549344_549956_+	hypothetical protein	NA	NA	NA	NA
WP_103851846.1\|549969_550917_+\|capsid	N4-gp56 family major capsid protein	A8ASJ6	Listeria_phage	3.9e-89	59.5
550831:550847	attR	NA	NA	NA	NA
WP_126321051.1\|551276_551681_+	hypothetical protein	A5GYM1	Lactococcus_phage	2.0e-05	27.5
WP_050339426.1\|551681_552071_+	hypothetical protein	NA	NA	NA	NA
WP_046947889.1\|552067_552469_+	hypothetical protein	NA	NA	NA	NA
WP_157262290.1\|552468_552894_+	hypothetical protein	NA	NA	NA	NA
WP_064972010.1\|552911_553520_+	hypothetical protein	NA	NA	NA	NA
WP_126321052.1\|553638_554157_+	hypothetical protein	NA	NA	NA	NA
WP_157262292.1\|554153_554795_+	hypothetical protein	U3PFU8	Lactobacillus_phage	4.4e-07	30.6
WP_157262294.1\|554810_560441_+\|tail	phage tail tape measure protein	A0A1S5SFC1	Streptococcus_phage	1.6e-23	25.5
WP_157262296.1\|560441_561260_+	hypothetical protein	NA	NA	NA	NA
WP_157262298.1\|561271_562399_+	hypothetical protein	O03938	Lactobacillus_phage	4.9e-70	41.2
WP_157262300.1\|562391_562640_+	hypothetical protein	NA	NA	NA	NA
WP_157262302.1\|562614_562905_+	hypothetical protein	O03939	Lactobacillus_phage	4.4e-07	32.7
WP_157262304.1\|562904_565238_+	DUF2479 domain-containing protein	O03968	Lactobacillus_phage	3.0e-66	59.1
WP_157262306.1\|565253_565535_+	hypothetical protein	NA	NA	NA	NA
WP_157262308.1\|565527_565695_+	XkdX family protein	NA	NA	NA	NA
WP_157262823.1\|565763_566891_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	2.2e-46	70.7
WP_016511481.1\|566891_567188_+	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	7.6e-39	75.5
WP_157262310.1\|567174_567552_+\|holin	holin	A0A2P0ZLG6	Lactobacillus_phage	3.7e-14	81.2

DBSCAN-SWA_2

583601 : 592225

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644909.1\|583601_585299_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640956.1\|585320_585629_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|585644_586244_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|586258_586510_+	YaaL family protein	NA	NA	NA	NA
WP_016510978.1\|586907_587573_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640965.1\|587569_587899_+	hypothetical protein	NA	NA	NA	NA
WP_003640966.1\|587915_588935_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640967.1\|588959_589307_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_016510979.1\|589405_590302_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.3e-81	55.7
WP_003640969.1\|590305_591091_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_016510980.1\|591229_592225_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.0e-50	37.9

DBSCAN-SWA_3

1189231 : 1199533

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_070085445.1\|1189231_1190470_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	1.4e-219	99.0
WP_046038954.1\|1190560_1191532_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.1e-179	97.8
WP_046038955.1\|1191717_1192665_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.0e-177	99.7
WP_046038956.1\|1193008_1193623_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	1.4e-111	99.5
WP_046038957.1\|1193625_1196064_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.5
WP_021356349.1\|1196151_1196712_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	1.0e-100	99.5
WP_021356350.1\|1196782_1197223_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	4.4e-75	95.9
WP_157262434.1\|1197613_1199533_+	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	1.7e-54	72.2

DBSCAN-SWA_4

2047738 : 2126651

Lactobacillus_phage(51.02%)

terminase,capsid,integrase,transposase,holin,tail,portal,head

attL 2112141:2112154|attR 2126711:2126724

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060677159.1\|2047738_2049469_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.6e-46	27.4
WP_015825756.1\|2049691_2050084_-	YxeA family protein	NA	NA	NA	NA
WP_070085270.1\|2050306_2051158_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_157262582.1\|2051680_2052835_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	4.4e-42	38.6
WP_157262584.1\|2052818_2052962_-	hypothetical protein	NA	NA	NA	NA
WP_157262586.1\|2053905_2054367_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	4.1e-39	56.3
WP_157262588.1\|2054745_2055165_-	DUF1642 domain-containing protein	A0A1S5RCV9	Lactobacillus_phage	3.0e-25	44.1
WP_157262590.1\|2055157_2055496_-	hypothetical protein	A0A2H4PBD2	Lactobacillus_phage	1.1e-28	79.2
WP_157262592.1\|2055621_2056587_-	hypothetical protein	A6M982	Geobacillus_virus	1.2e-64	54.5
WP_024002536.1\|2056598_2057129_-	phage protein	E9LUU0	Lactobacillus_phage	6.1e-55	59.2
WP_046811047.1\|2057146_2057260_-	hypothetical protein	NA	NA	NA	NA
WP_072557401.1\|2057392_2057563_-	hypothetical protein	NA	NA	NA	NA
WP_157262594.1\|2057630_2058143_-	transcriptional regulator	D6PST4	Lactobacillus_phage	1.6e-28	44.7
WP_157262596.1\|2058209_2058515_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_033608054.1\|2058693_2058948_-	helix-turn-helix transcriptional regulator	A0A2H4JFN1	uncultured_Caudovirales_phage	1.5e-06	41.3
WP_053267722.1\|2060137_2060656_+	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	9.3e-16	34.8
WP_053267721.1\|2060670_2061093_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_053267720.1\|2061193_2061652_+	hypothetical protein	NA	NA	NA	NA
WP_053267719.1\|2061737_2062799_+	endonuclease	A0A1S5SAB0	Streptococcus_phage	4.6e-86	45.1
WP_157262598.1\|2062972_2063242_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_157262600.1\|2063245_2064021_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	7.8e-27	52.3
WP_157262602.1\|2064025_2064205_+	hypothetical protein	NA	NA	NA	NA
WP_099739055.1\|2064231_2064591_+	hypothetical protein	NA	NA	NA	NA
WP_022638129.1\|2064621_2064903_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_157262604.1\|2065286_2066789_+	hypothetical protein	NA	NA	NA	NA
WP_157262606.1\|2066887_2068009_+\|integrase	tyrosine-type recombinase/integrase	D6PSS4	Lactobacillus_phage	7.6e-47	32.4
WP_003642774.1\|2068360_2068567_-	hypothetical protein	NA	NA	NA	NA
WP_003643340.1\|2069285_2069486_-	cold-shock protein	Q9AZD3	Lactococcus_phage	1.4e-20	71.4
WP_157262608.1\|2069608_2069986_-	hypothetical protein	NA	NA	NA	NA
WP_157262610.1\|2070159_2070429_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_157262612.1\|2070521_2072063_-\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	6.3e-44	25.5
WP_157262614.1\|2072059_2073160_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	1.0e-48	34.9
WP_079111826.1\|2073160_2073361_-	hypothetical protein	NA	NA	NA	NA
WP_157262616.1\|2073314_2075018_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	1.2e-120	40.5
WP_157262618.1\|2075014_2075488_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_157262620.1\|2076102_2076492_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	1.5e-18	45.6
WP_157262622.1\|2076484_2076823_-\|head,tail	head-tail adaptor protein	A0A2P0ZLF0	Lactobacillus_phage	3.9e-07	34.7
WP_157262624.1\|2076809_2077001_-	hypothetical protein	NA	NA	NA	NA
WP_157262626.1\|2077000_2077357_-	pathogenicity island protein	NA	NA	NA	NA
WP_157262628.1\|2077618_2079193_-	hypothetical protein	NA	NA	NA	NA
WP_157262630.1\|2079192_2079996_-	DNA replication protein	NA	NA	NA	NA
WP_157262632.1\|2080009_2080240_-	hypothetical protein	NA	NA	NA	NA
WP_021336917.1\|2080359_2080467_-	hypothetical protein	NA	NA	NA	NA
WP_016527234.1\|2080509_2080689_-	helix-turn-helix domain-containing protein	E9LUT5	Lactobacillus_phage	3.0e-22	89.7
WP_104795871.1\|2080845_2081466_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_063493492.1\|2081523_2082681_+\|integrase	site-specific integrase	Q938N9	Temperate_phage	3.9e-54	34.8
WP_003642773.1\|2083169_2083403_+	hypothetical protein	NA	NA	NA	NA
WP_003642772.1\|2083427_2083700_+	hypothetical protein	NA	NA	NA	NA
WP_003642762.1\|2085258_2086836_-	glycosyltransferase	NA	NA	NA	NA
WP_021356622.1\|2086853_2088848_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.2e-32	41.3
WP_003646619.1\|2089252_2089444_-	hypothetical protein	NA	NA	NA	NA
WP_157262634.1\|2090323_2090698_-\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	1.3e-22	78.8
WP_016511481.1\|2090684_2090981_-	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	7.6e-39	75.5
WP_157262830.1\|2090981_2092112_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	3.0e-35	71.9
WP_157262636.1\|2092141_2092306_-	hypothetical protein	A0A2D1GPM8	Lactobacillus_phage	1.8e-05	74.4
WP_157262638.1\|2092373_2094917_-	DUF2479 domain-containing protein	O03968	Lactobacillus_phage	2.3e-59	56.7
WP_157262640.1\|2094932_2095169_-	hypothetical protein	A0A291I9J9	Lactobacillus_phage	1.4e-06	40.6
WP_157262642.1\|2095196_2095325_-	XkdX family protein	NA	NA	NA	NA
WP_157262644.1\|2095337_2095730_-	DUF2977 domain-containing protein	NA	NA	NA	NA
WP_157262646.1\|2095729_2096467_-	hypothetical protein	NA	NA	NA	NA
WP_157262648.1\|2096472_2097087_-	DUF2479 domain-containing protein	A0A1J0MFQ3	Staphylococcus_phage	1.0e-45	49.3
WP_157262650.1\|2097101_2098094_-	SGNH/GDSL hydrolase family protein	I6TFU2	Staphylococcus_virus	4.2e-41	37.8
WP_157262652.1\|2098098_2099973_-	endolysin	A0A1X9IGI5	Lactococcus_phage	3.4e-52	34.4
WP_157262654.1\|2099972_2100710_-\|tail	phage tail protein	A0A1S5SA63	Streptococcus_phage	2.2e-42	37.4
WP_157262656.1\|2100703_2104714_-	tape measure protein	E9LUR1	Lactobacillus_phage	2.6e-81	44.0
WP_057717834.1\|2104713_2104950_-	hypothetical protein	NA	NA	NA	NA
WP_157262658.1\|2105042_2105531_-	hypothetical protein	NA	NA	NA	NA
WP_157262660.1\|2105548_2106109_-\|tail	phage tail protein	NA	NA	NA	NA
WP_157262662.1\|2106120_2106507_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_157262664.1\|2106508_2107063_-\|tail	phage tail protein	NA	NA	NA	NA
WP_157262666.1\|2107052_2107376_-	hypothetical protein	NA	NA	NA	NA
WP_157262668.1\|2107380_2107746_-	hypothetical protein	A0A1W6JNH7	Staphylococcus_phage	4.0e-05	39.6
WP_157262670.1\|2107760_2108819_-\|capsid	phage capsid protein	A0A0S0N2Q7	Pseudomonas_phage	9.0e-34	31.2
WP_157262672.1\|2108835_2109483_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_157262674.1\|2109589_2110534_-\|head	phage head morphogenesis protein	NA	NA	NA	NA
WP_157262676.1\|2110536_2112177_-\|portal	phage portal protein	D2IZF6	Enterococcus_phage	2.2e-63	31.7
2112141:2112154	attL	NA	NA	NA	NA
WP_157262678.1\|2112166_2113465_-\|terminase	PBSX family phage terminase large subunit	B7T0C6	Staphylococcus_virus	1.4e-113	49.9
WP_157262679.1\|2113668_2114208_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	6.2e-15	37.0
WP_157262280.1\|2114265_2114586_-	hypothetical protein	A0A1J1J9Q7	Escherichia_phage	2.3e-17	45.6
WP_016527195.1\|2114809_2115082_-	hypothetical protein	A0A2D2W301	Escherichia_phage	1.8e-18	50.6
WP_157262278.1\|2115050_2115212_-	hypothetical protein	E9LUP6	Lactobacillus_phage	4.1e-15	79.6
WP_063488409.1\|2115232_2115466_-	hypothetical protein	NA	NA	NA	NA
WP_063851487.1\|2115533_2116415_-	hypothetical protein	NA	NA	NA	NA
WP_157262680.1\|2116737_2117637_-	DUF4373 domain-containing protein	A0A0P0HRQ2	Lactobacillus_phage	7.1e-56	43.4
WP_157262681.1\|2117719_2118580_-	hypothetical protein	A0A0P0IZH9	Lactobacillus_phage	6.6e-75	50.0
WP_157262682.1\|2118503_2119391_-	recombinase RecT	E9LUM3	Lactobacillus_phage	2.0e-63	48.1
WP_157262683.1\|2119387_2119774_-	hypothetical protein	NA	NA	NA	NA
WP_157262684.1\|2119906_2120077_-	hypothetical protein	NA	NA	NA	NA
WP_157262685.1\|2120134_2120380_-	hypothetical protein	NA	NA	NA	NA
WP_157262686.1\|2120392_2120908_-	transcriptional regulator	D6PST4	Lactobacillus_phage	1.2e-23	37.4
WP_157262687.1\|2121154_2121385_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016511202.1\|2121557_2121920_+	helix-turn-helix domain-containing protein	A0A0U4KKM4	Exiguobacterium_phage	2.6e-09	32.0
WP_003644968.1\|2121931_2122345_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3
WP_157262688.1\|2122371_2122707_+	hypothetical protein	A0A1B0Y4P2	Lactobacillus_phage	4.9e-26	53.9
WP_157262689.1\|2122950_2123661_+	hypothetical protein	NA	NA	NA	NA
WP_157262690.1\|2123858_2124665_+	hypothetical protein	NA	NA	NA	NA
WP_157262691.1\|2125325_2126651_+\|integrase	tyrosine-type recombinase/integrase	A0A0P0I3D2	Lactobacillus_phage	2.7e-88	42.0
2126711:2126724	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2307835 : 2316349

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046040135.1\|2307835_2308414_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.1e-21	33.9
WP_046040137.1\|2308406_2309432_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.6e-59	41.0
WP_003642591.1\|2309428_2310883_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003645864.1\|2310867_2313087_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_011101895.1\|2313079_2313760_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_070084868.1\|2313759_2314014_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2314015_2314747_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_015380738.1\|2314749_2315880_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642585.1\|2315863_2316349_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

DBSCAN-SWA_6

2638928 : 2661229

unidentified_phage(28.57%)

integrase,transposase

attL 2632924:2632938|attR 2669305:2669319

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2632924:2632938	attL	NA	NA	NA	NA
WP_157262762.1\|2638928_2639703_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	5.1e-26	52.3
WP_060677396.1\|2640845_2641283_-	DUF1643 domain-containing protein	NA	NA	NA	NA
WP_046040563.1\|2641583_2642198_-	hypothetical protein	NA	NA	NA	NA
WP_046040565.1\|2642703_2643468_-	HAD family phosphatase	NA	NA	NA	NA
WP_046040567.1\|2643649_2643895_-	hypothetical protein	NA	NA	NA	NA
WP_046040569.1\|2643928_2644666_-	class I SAM-dependent methyltransferase	A0A097BYE1	Leuconostoc_phage	2.0e-40	37.2
WP_046040571.1\|2644931_2645135_-	hypothetical protein	NA	NA	NA	NA
WP_080487839.1\|2645763_2646798_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	2.0e-41	34.1
WP_016265827.1\|2647688_2648351_-	beta-phosphoglucomutase	NA	NA	NA	NA
WP_016265828.1\|2648353_2649373_-	aldose 1-epimerase	NA	NA	NA	NA
WP_071542840.1\|2649442_2651695_-	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_157262763.1\|2651715_2653080_-	MFS transporter	NA	NA	NA	NA
WP_157262833.1\|2653203_2654157_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_072567003.1\|2654561_2655596_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	5.2e-42	34.4
WP_157262764.1\|2655901_2656970_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	3.4e-28	30.7
WP_072566980.1\|2657111_2657354_-	hypothetical protein	NA	NA	NA	NA
WP_072566979.1\|2657478_2658609_-\|integrase	site-specific integrase	A0A0M9JJ77	Lactobacillus_phage	2.2e-30	25.7
WP_072566978.1\|2658601_2659231_-	DUF1643 domain-containing protein	NA	NA	NA	NA
WP_072566977.1\|2659373_2659634_-	hypothetical protein	NA	NA	NA	NA
WP_070083754.1\|2659640_2659925_-	hypothetical protein	NA	NA	NA	NA
WP_072566976.1\|2660095_2661229_-\|integrase	site-specific integrase	B3GVW7	Streptococcus_phage	7.7e-23	26.1
2669305:2669319	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP046663

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046663_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046663_1

43979-44086

Orphan

Consensus_repeat	Method
TTGAACTCGACGCGCTCGCACCACTGGTGGCAGTGGTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046663_1

>merge|NZ_CP046663|1|43979-44086|CRISPRCasFinder
TTGAACTCGACGCGCTCGCACCACTGGTGGCAGTGGTGGTAGCGGCAGGTGTCGTCGTGGTGGCAGCGCTTGAACTCGACGCGCTCGCACCACTGGTGGCAGTGGTGG

>NZ_CP046663|1|1|43979-44086|CRISPRCasFinder
TTGAACTCGACGCGCTCGCACCACTGGTGGCAGTGGTGG	TAGCGGCAGGTGTCGTCGTGGTGGCAGCGC
TTGAACTCGACGCGCTCGCACCACTGGTGGCAGTGGTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046663.1\|WP_157262109.1\|26709_27485_-\|IS5-like-element-ISLpl3-family-transposase	unknown	unknown	gnl\|CDD\|379129
NZ_CP046663.1\|WP_157262110.1\|29473_30583_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237537
NZ_CP046663.1\|WP_063493471.1\|28029_29472_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046663.1\|WP_002833999.1\|21899_22142_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046663.1\|WP_105316429.1\|19493_20396_-\|YitT-family-protein	unknown	unknown	gnl\|CDD\|224203
NZ_CP046663.1\|WP_020923832.1\|37623_38220_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP046663.1\|WP_046041057.1\|20482_21115_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP046663.1\|WP_003586778.1\|30827_31226_-\|DUF1722-domain-containing-protein	unknown	unknown	gnl\|CDD\|377982
NZ_CP046663.1\|WP_027821214.1\|35472_37509_-\|KUP/HAK/KT-family-potassium-transporter	unknown	unknown	gnl\|CDD\|376906
NZ_CP046663.1\|WP_157262111.1\|34651_35089_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670

Protein	Function_ID	Function_description	E-value
NZ_CP046663.1\|WP_157262109.1\|26709_27485_-\|IS5-like-element-ISLpl3-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	1.10742e-32
NZ_CP046663.1\|WP_157262110.1\|29473_30583_+\|hypothetical-protein	gnl\|CDD\|237537	PRK13875, PRK13875, conjugal transfer protein TrbL; Provisional.	5.56664e-05
NZ_CP046663.1\|WP_105316429.1\|19493_20396_-\|YitT-family-protein	gnl\|CDD\|224203	COG1284, COG1284, Uncharacterized conserved protein [Function unknown].	5.34332e-80
NZ_CP046663.1\|WP_020923832.1\|37623_38220_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	8.22667e-45
NZ_CP046663.1\|WP_046041057.1\|20482_21115_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	4.82167e-37
NZ_CP046663.1\|WP_003586778.1\|30827_31226_-\|DUF1722-domain-containing-protein	gnl\|CDD\|377982	pfam08349, DUF1722, Protein of unknown function (DUF1722). This domain of unknown function is found in bacteria and archaea and is homologous to the hypothetical protein ybgA from E. coli.	5.88267e-18
NZ_CP046663.1\|WP_027821214.1\|35472_37509_-\|KUP/HAK/KT-family-potassium-transporter	gnl\|CDD\|376906	pfam02705, K_trans, K+ potassium transporter. This is a family of K+ potassium transporters that are conserved across phyla, having both bacterial (KUP), yeast (HAK), and plant (AtKT) sequences as members.	0
NZ_CP046663.1\|WP_157262111.1\|34651_35089_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	3.40946e-13

>NZ_CP046663.1|WP_020923832.1|37623_38220_-|recombinase-family-protein
MAKIGYARVSSKEQHLDRQLAALKDVDKLFTDKLSGANTNRPELQKMLAYIREGDIVMVTELDRLGRNNHDLTKIMNSIQNKGATLDVLNLPSMTGIADPNLRQLMTNLIIELYKYQAESERKRIIERQQQGIALAKQQGKYHGRKPQYTQDDPRLQHAFKLYQAGMSDVDVARNTGIKRTTFIRYRKKFNVKVDCKL
>NZ_CP046663.1|WP_027821214.1|35472_37509_-|KUP/HAK/KT-family-potassium-transporter
MNKQLERVSFAGALVTLGIVYGDIGTSPLYVMNALIGDAGKMGNISPNYVIGSISLIFWTLMIITTLKYVVIAMQADNKREGGIFALYALVRKNSKWLIWPALIGGAAILADGTLTPAVTVTSAIEGLKKQHLGPVVFSNSQHNVLIITTVVLLVLFMIQRFGTGVIGKSFGPVMILWFGFLAVFGIVNLINYPMILKAISPYYAIRILFSPVNKVGIFILGSIFLATTGAEALYSDMGHVGKQNIYVTWPLVYSTLFLNYLGQGAWIIRHAGDTAYRNLSNLNPFYEMLPGTWRLVGIVLATLAAIIASQALITGSYTLADEAIGLKFLPRMVIRHPSNIKNQIYIATVNWILCIITISVVWFFGSSQKMEAAYGLAITITMLMTTVLLHEFLKKHLAKGTALIIALFFGFIELIFLISSLVKFIHGGYVTLTIMLGILYIMWLWYFGNKRREHYEKESEYVSLLDYRDQLSKLSADNTVPLFTTNLVYMTKIKGDYQIKRSTMYSILDRQPKRAKVYWFVTVNETNAPYESNYTVDLLETHNVVNVQFYLGFKKSQSVSVYLHQIVNHLVEQGILEPQIPTYSTERQRKVGDFKFVIIKEQPADLIANDKLSSLDRRLIGGRIYLQKITASPISWYGLEFSNVIEESSPLFITQDQDQYLIQKKIYHRGRLSKTEK
>NZ_CP046663.1|WP_157262111.1|34651_35089_-|MarR-family-transcriptional-regulator
MVNHQQIKNQFESLTTLQAIQNQAYQMLVQGLAKTEFSMREWGILVYLEQHGQATASELSDAFTVTRTLISRNTWRLIQDNLIQSQVNPNDRRIVWLSLTVNGQERVQEDVRQVQANLKTFDQSHNLEKLTKQVEALLQQLARIN
>NZ_CP046663.1|WP_003586778.1|30827_31226_-|DUF1722-domain-containing-protein
MNWQKIWAVNKYWVMSKSQQQYDHIRLLAKNNQWTPQKSQELDKILDSLGSVSPTRKTLVTTYQHIWGYFKKKCTDEELHQYLKLLDELQPDNDSLGPFLVQLTAKYQIDYLQKSRLIIELNEREGQSISKN
>NZ_CP046663.1|WP_157262110.1|29473_30583_+|hypothetical-protein
MAKKSSKLKKAQQKAKAAAQKTNQKINELGKYTSSLYTSLTTIQSLFDRIRNVPEKNMLKYEKLKTIRVNWKQQAEKIELEYKKAEVKATGQGVAGVGAGVAVAALGPTAAMGIATTFGAASTGTAISALSGAAFTNAALAWLGGGALATGGGGMAAGSAFLALAGPVGWTIAGVSIVASGLMFFKTNSDKERLENTYTLISNRDIKSYELAIVELSKRITRIIDESEKLREAIVKIETFGTDYTKMTEAQQYELGAYVNLMEASTALLVNPILGLQPKYSEQDFDKLCASESELYRRYFKTHKTMIISMANLLYKIKLDDKDKKLLAKSLKKNKDFLSSVQMAKKEFDAADISMIERALDYRYKYSTY
>NZ_CP046663.1|WP_063493471.1|28029_29472_+|hypothetical-protein
MDNAIIKKNILLNLSVEDGGFDFSTSIADAMAKAETELVVLNETVDSIKGLKPDCDKLDYILATSSGALCGIIDIFLVGKPGESPLGNITDKWFVARTIDFAKLCNPEKKNFDSLDSALRFLEKKFKVPYDQTGLGDAGKTIFDLTAKNHHFKSLAHNPSLLGLFFSILDQFSNTSHFVTDGQLVSLQQADEKWELRGGNIPSKLFCGFANWIGHLISDVSGSSSSAAKGNRGTGLPSPLWTWTNDIIAIKAKLGLSVTETDKAMNELALNIFEKGYDIRFQTAQAIPVFLNELLVRLIYAIRRLFRYFSEIPKTERSFALMWKKCEPFSNATVKRMLTVAHGTFCLVDVGDAVGRSLIAGGGTFNAVEFVLRLNVVGVGRFAISLYGETRRAISYNHAKKEFDFASKETVIVNNYIEGLKILAHQYDDHHLLMFISDFEKSDAYIEAFGKSVTLAEVRNVPVNRILKSKPDIDKYFGGK
>NZ_CP046663.1|WP_157262109.1|26709_27485_-|IS5-like-element-ISLpl3-family-transposase
MTTPKRYELEDAQWDRIKGYFPPYRTGRPSSLDNRTALNAILWLMRSGAPWRDLPERYGSWKTVYSRFRAWVSSGLFEQVFLELIDDPDMENLSLDSTIVRAHQKATGGKKNAECMVENQAIGLSRGGRTTKIHALVDGLGNPLGFRLTGGQVHDSQVASELLEGFDISQSNIIADKAYGTAKLRQYIEDKAGVYTIPPKENTKDKWTCAYHVYCERHLIENFFNQLKNFRRIATRYDKLAHVYLATVYIASICILLK
>NZ_CP046663.1|WP_002833999.1|21899_22142_-|hypothetical-protein
MIFIAAELVAISLTCVAGFVLGVAAVTVVKLMSAFLVVVAWRFTALEATDVALLVFSVLAADLTAVLLTWLIEPEAALVV
>NZ_CP046663.1|WP_046041057.1|20482_21115_-|recombinase-family-protein
MKIGYARVSSENQNLARQIEALKKSGVEKIFQEKVSGKSVQNRPELQKMLELIREKDIVTVLDLDRLGRNAQDITDTINLIQQKKATLDVLSLPSFTDIQDVNLRGLLTNLVFEIYKYTAEEERNKIHARQNQGIQLAKERGEYKGRRRQYSPHGSKRYLYKRVVQMLRDGMNIAQIARSTGVQRRQIYRIKEYALKVGDLGTPKREVNS
>NZ_CP046663.1|WP_105316429.1|19493_20396_-|YitT-family-protein
MFFKDWTKYNSFELVMITLGCSIYAFSLDLVSIPSGLADGGLSGITLIIRHFFHINLGISTLFLNIPLILIGLRYLGKRMMAYTIYGTICLSIFLIIWSQQPLIQPLPLRNDLLLSSLVAGVLSGLGIGLVFRYNGTTGGSDIIARVGQRSLGFSSGKGILIIDYVVLGLSLSYLDLYHIAYSLIVSFVLSKVIDMVQEGPNRAKVLFIVSDKSQKISQLIDVSLNRGLTYLQAEGGYQHDQKQVIYLVVQPREIPQLKQLIKAIDERAFVTVLDAHEVIGEGFSYQRKRYHVNWQHSKE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP046663	Lactobacillus plantarum strain 83-18 plasmid p83-18.3, complete sequence	44018-44047	0	1.0
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP030883	Lactobacillus plantarum strain nF1 plasmid unnamed2, complete sequence	4474-4503	0	1.0
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP030883	Lactobacillus plantarum strain nF1 plasmid unnamed2, complete sequence	4543-4572	0	1.0
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP030883	Lactobacillus plantarum strain nF1 plasmid unnamed2, complete sequence	4612-4641	0	1.0
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NC_021517	Lactobacillus plantarum 16 plasmid Lp16E, complete sequence	11332-11361	0	1.0
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NC_021517	Lactobacillus plantarum 16 plasmid Lp16E, complete sequence	11401-11430	0	1.0
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP025283	Lactobacillus plantarum subsp. plantarum strain nF1-FD plasmid pnF1FD02, complete sequence	11075-11104	0	1.0
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP025283	Lactobacillus plantarum subsp. plantarum strain nF1-FD plasmid pnF1FD02, complete sequence	11144-11173	0	1.0
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP025283	Lactobacillus plantarum subsp. plantarum strain nF1-FD plasmid pnF1FD02, complete sequence	11213-11242	0	1.0
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP013152	Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence	39485-39514	0	1.0
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP013152	Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence	39554-39583	0	1.0
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP013152	Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence	39623-39652	0	1.0
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP046663	Lactobacillus plantarum strain 83-18 plasmid p83-18.3, complete sequence	43949-43978	1	0.967
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP030883	Lactobacillus plantarum strain nF1 plasmid unnamed2, complete sequence	4681-4710	1	0.967
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NC_021517	Lactobacillus plantarum 16 plasmid Lp16E, complete sequence	11470-11499	1	0.967
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP025283	Lactobacillus plantarum subsp. plantarum strain nF1-FD plasmid pnF1FD02, complete sequence	11282-11311	1	0.967
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP013152	Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence	39692-39721	1	0.967
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP034950	Enterococcus faecium strain NM213 plasmid unnamed1, complete sequence	7796-7825	1	0.967
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NC_021225	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp2, complete sequence	14136-14165	1	0.967
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP035027	Lactobacillus plantarum strain YW11 plasmid plsm_YW11_pB, complete sequence	25408-25437	1	0.967
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP035013	Lactobacillus plantarum strain 12_3 plasmid pldA, complete sequence	24119-24148	1	0.967
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP035022	Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pB	25408-25437	1	0.967
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NC_021517	Lactobacillus plantarum 16 plasmid Lp16E, complete sequence	11263-11292	2	0.933
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NC_021225	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp2, complete sequence	14205-14234	2	0.933
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NC_021225	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp2, complete sequence	14067-14096	2	0.933
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP035027	Lactobacillus plantarum strain YW11 plasmid plsm_YW11_pB, complete sequence	25477-25506	2	0.933
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP035027	Lactobacillus plantarum strain YW11 plasmid plsm_YW11_pB, complete sequence	25339-25368	2	0.933
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP035013	Lactobacillus plantarum strain 12_3 plasmid pldA, complete sequence	24050-24079	2	0.933
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP035022	Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pB	25477-25506	2	0.933
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP035022	Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pB	25339-25368	2	0.933
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP012010	Leuconostoc mesenteroides subsp. dextranicum strain DSM 20484 plasmid pDSM20484, complete sequence	15862-15891	2	0.933
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP012010	Leuconostoc mesenteroides subsp. dextranicum strain DSM 20484 plasmid pDSM20484, complete sequence	32798-32827	2	0.933
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	254611-254640	8	0.733
NZ_CP046663_1	1.1\|44018\|30\|NZ_CP046663\|CRISPRCasFinder	44018-44047	30	MK620896	Streptomyces phage Circinus, complete genome	57580-57609	8	0.733

1. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP046663 (Lactobacillus plantarum strain 83-18 plasmid p83-18.3, complete sequence) position: , mismatch: 0, identity: 1.0

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgc	Protospacer
******************************

2. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP030883 (Lactobacillus plantarum strain nF1 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgc	Protospacer
******************************

3. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP030883 (Lactobacillus plantarum strain nF1 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgc	Protospacer
******************************

4. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP030883 (Lactobacillus plantarum strain nF1 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgc	Protospacer
******************************

5. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NC_021517 (Lactobacillus plantarum 16 plasmid Lp16E, complete sequence) position: , mismatch: 0, identity: 1.0

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgc	Protospacer
******************************

6. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NC_021517 (Lactobacillus plantarum 16 plasmid Lp16E, complete sequence) position: , mismatch: 0, identity: 1.0

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgc	Protospacer
******************************

7. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP025283 (Lactobacillus plantarum subsp. plantarum strain nF1-FD plasmid pnF1FD02, complete sequence) position: , mismatch: 0, identity: 1.0

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgc	Protospacer
******************************

8. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP025283 (Lactobacillus plantarum subsp. plantarum strain nF1-FD plasmid pnF1FD02, complete sequence) position: , mismatch: 0, identity: 1.0

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgc	Protospacer
******************************

9. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP025283 (Lactobacillus plantarum subsp. plantarum strain nF1-FD plasmid pnF1FD02, complete sequence) position: , mismatch: 0, identity: 1.0

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgc	Protospacer
******************************

10. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP013152 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence) position: , mismatch: 0, identity: 1.0

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgc	Protospacer
******************************

11. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP013152 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence) position: , mismatch: 0, identity: 1.0

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgc	Protospacer
******************************

12. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP013152 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence) position: , mismatch: 0, identity: 1.0

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgc	Protospacer
******************************

13. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP046663 (Lactobacillus plantarum strain 83-18 plasmid p83-18.3, complete sequence) position: , mismatch: 1, identity: 0.967

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgt	Protospacer
*****************************.

14. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP030883 (Lactobacillus plantarum strain nF1 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgt	Protospacer
*****************************.

15. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NC_021517 (Lactobacillus plantarum 16 plasmid Lp16E, complete sequence) position: , mismatch: 1, identity: 0.967

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgt	Protospacer
*****************************.

16. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP025283 (Lactobacillus plantarum subsp. plantarum strain nF1-FD plasmid pnF1FD02, complete sequence) position: , mismatch: 1, identity: 0.967

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagcgt	Protospacer
*****************************.

17. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP013152 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence) position: , mismatch: 1, identity: 0.967

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagtgc	Protospacer
***************************.**

18. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP034950 (Enterococcus faecium strain NM213 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggttgcagcgc	Protospacer
********************** *******

19. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NC_021225 (Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp2, complete sequence) position: , mismatch: 1, identity: 0.967

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggttgcagcgc	Protospacer
********************** *******

20. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP035027 (Lactobacillus plantarum strain YW11 plasmid plsm_YW11_pB, complete sequence) position: , mismatch: 1, identity: 0.967

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggttgcagcgc	Protospacer
********************** *******

21. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP035013 (Lactobacillus plantarum strain 12_3 plasmid pldA, complete sequence) position: , mismatch: 1, identity: 0.967

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggttgcagcgc	Protospacer
********************** *******

22. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP035022 (Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pB) position: , mismatch: 1, identity: 0.967

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggttgcagcgc	Protospacer
********************** *******

23. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NC_021517 (Lactobacillus plantarum 16 plasmid Lp16E, complete sequence) position: , mismatch: 2, identity: 0.933

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggtggcagtgg	Protospacer
***************************.*

24. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NC_021225 (Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp2, complete sequence) position: , mismatch: 2, identity: 0.933

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggttgcagcgt	Protospacer
********************** ******.

25. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NC_021225 (Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp2, complete sequence) position: , mismatch: 2, identity: 0.933

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcagcaggtgtcgtcgtggttgcagcgc	Protospacer
****.***************** *******

26. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP035027 (Lactobacillus plantarum strain YW11 plasmid plsm_YW11_pB, complete sequence) position: , mismatch: 2, identity: 0.933

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggttgcagcgt	Protospacer
********************** ******.

27. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP035027 (Lactobacillus plantarum strain YW11 plasmid plsm_YW11_pB, complete sequence) position: , mismatch: 2, identity: 0.933

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcagcaggtgtcgtcgtggttgcagcgc	Protospacer
****.***************** *******

28. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP035013 (Lactobacillus plantarum strain 12_3 plasmid pldA, complete sequence) position: , mismatch: 2, identity: 0.933

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcagcaggtgtcgtcgtggttgcagcgc	Protospacer
****.***************** *******

29. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP035022 (Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pB) position: , mismatch: 2, identity: 0.933

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggttgcagcgt	Protospacer
********************** ******.

30. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP035022 (Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pB) position: , mismatch: 2, identity: 0.933

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcagcaggtgtcgtcgtggttgcagcgc	Protospacer
****.***************** *******

31. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP012010 (Leuconostoc mesenteroides subsp. dextranicum strain DSM 20484 plasmid pDSM20484, complete sequence) position: , mismatch: 2, identity: 0.933

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggttgcggcgc	Protospacer
********************** **.****

32. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP012010 (Leuconostoc mesenteroides subsp. dextranicum strain DSM 20484 plasmid pDSM20484, complete sequence) position: , mismatch: 2, identity: 0.933

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcgtcgtggttgcggcgc	Protospacer
********************** **.****

33. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 8, identity: 0.733

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
ggggcccaggtgtcgtcgtggtggtcgcgt	Protospacer
 .*   ******************. ***.

34. spacer 1.1|44018|30|NZ_CP046663|CRISPRCasFinder matches to MK620896 (Streptomyces phage Circinus, complete genome) position: , mismatch: 8, identity: 0.733

tagcggcaggtgtcgtcgtggtggcagcgc	CRISPR spacer
tagcggcaggtgtcatcgtggccctctcgg	Protospacer
**************.******.  .  **

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP046664

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8586 : 16077

Staphylococcus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003582114.1\|8586_8910_-	winged helix-turn-helix transcriptional regulator	A0A2H4PQT4	Staphylococcus_phage	5.2e-17	42.7
WP_003582117.1\|9032_9629_-	recombinase family protein	A0A219Y9V9	Aeromonas_phage	3.5e-27	37.4
WP_157262115.1\|9807_12801_+\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	5.1e-207	38.7
WP_157262116.1\|13290_13878_+	recombinase family protein	M4QQC6	Vibrio_phage	1.0e-18	42.8
WP_020923860.1\|14185_15136_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	9.4e-99	54.6
WP_010623241.1\|15150_16077_-	ribonucleoside-diphosphate reductase subunit beta	A0A2H4P8A9	Corynebacterium_phage	5.9e-37	32.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP046662

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 28542

Lactobacillus_phage(28.57%)

holin,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157262063.1\|0_924_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.0e-50	40.9
WP_157262064.1\|1589_2606_-	glycosyltransferase	NA	NA	NA	NA
WP_157262065.1\|2639_3356_-	acyltransferase	NA	NA	NA	NA
WP_157262066.1\|3375_4338_-	glycosyltransferase	NA	NA	NA	NA
WP_157262067.1\|4356_5796_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_157262068.1\|5795_6782_-	hypothetical protein	NA	NA	NA	NA
WP_157262069.1\|6878_8060_-	hypothetical protein	NA	NA	NA	NA
WP_157262102.1\|8077_8578_-	glycosyltransferase	NA	NA	NA	NA
WP_157262070.1\|8595_9045_-	UDP-N-acetylglucosamine--LPS N-acetylglucosamine transferase	NA	NA	NA	NA
WP_157262103.1\|9245_10304_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	3.8e-40	35.3
WP_157262071.1\|10433_11276_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	3.1e-154	98.6
WP_002816285.1\|11329_11581_-\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4
WP_157262072.1\|11826_12597_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_157262073.1\|12608_13337_+	polysaccharide biosynthesis tyrosine autokinase	NA	NA	NA	NA
WP_157262074.1\|14683_15088_+	glycosyltransferase	NA	NA	NA	NA
WP_157262075.1\|16166_17087_+\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2
WP_157262076.1\|17447_19568_-	hypothetical protein	NA	NA	NA	NA
WP_016526775.1\|19663_19978_-	hypothetical protein	NA	NA	NA	NA
WP_157262077.1\|20044_21829_-	AAA domain-containing protein	A0A223W0B1	Agrobacterium_phage	8.8e-82	33.5
WP_157262078.1\|21831_22437_-	hypothetical protein	NA	NA	NA	NA
WP_157262079.1\|22439_22634_-	hypothetical protein	NA	NA	NA	NA
WP_157262080.1\|22630_23596_-	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_157262081.1\|23671_24280_-	hypothetical protein	NA	NA	NA	NA
WP_128537224.1\|24332_24635_-	hypothetical protein	NA	NA	NA	NA
WP_157262082.1\|24792_26955_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	9.9e-104	47.3
WP_006293514.1\|27521_27626_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_128703948.1\|27906_28542_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046661

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046669

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP046663

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP046664

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

5. NZ_CP046662

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection