CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP040718	Aeromonas veronii strain HX3 plasmid pHX3, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP040717	Aeromonas veronii strain HX3 chromosome, complete genome	5 crisprs	DEDDh,cas3,DinG,csa3,WYL	1	1	9	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040717_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040717_1

1667983-1668158

Orphan

Consensus_repeat	Method
GCAGGTGCGGCAGGTGCGGCAGGTGC	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP040717_1

>merge|NZ_CP040717|1|1667983-1668158|CRISPRCasFinder
GCAGGCGCCGCCTTAGCGGCAGGCGCTGGTGCTTTGGCTGCTTCAGCGGGTTTTGCGGGGGCCGCCGGTGCAGGTTTGGCTACAGGAGTGGCCGGTTTGGGCGGAGTCACCGCAGCAGGTGCGGCAGGTGCGGCAGGTGCGGCAGGTGCGGCAGGTGCGGCAGGTGCGGCAGGTGC

>NZ_CP040717|1|1|1667983-1668158|CRISPRCasFinder
GCAGGCGCCGCCTTAGCGGCAGGCGC	TGGTGCTTTGGCTGCTTCA
GCGGGTTTTGCGGGGGCCGCCGGTGC	AGGTTTGGCTACAGGAGTGGCCGGTTTGGGCGGA
GTCACCGCAGCAGGTGCGGCAGGTGC	GGCAGGTGCGGCAGGTGCG
GCAGGTGCGGCAGGTGCGGCAGGTGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040717.1\|WP_019444725.1\|1665639_1666755_-\|chemotaxis-response-regulator-protein-glutamate-methylesterase	unknown	unknown	gnl\|CDD\|234828
NZ_CP040717.1\|WP_005334696.1\|1663177_1663972_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP040717.1\|WP_088868784.1\|1664899_1665631_-\|flagellar-motor-protein	unknown	unknown	gnl\|CDD\|181654
NZ_CP040717.1\|WP_157162376.1\|1661344_1661731_-\|DUF2802-domain-containing-protein	unknown	unknown	gnl\|CDD\|378523
NZ_CP040717.1\|WP_157161178.1\|1663976_1664897_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|181618
NZ_CP040717.1\|WP_005298836.1\|1661750_1662239_-\|chemotaxis-protein-CheW	unknown	unknown	gnl\|CDD\|238374
NZ_CP040717.1\|WP_157161181.1\|1676638_1677436_-\|flagellar-type-III-secretion-system-protein-FliR	unknown	unknown	gnl\|CDD\|235568
NZ_CP040717.1\|WP_085942124.1\|1670987_1671857_-\|MinD/ParA-family-protein	unknown	unknown	gnl\|CDD\|349758
NZ_CP040717.1\|WP_013723552.1\|1669780_1670164_-\|chemotaxis-protein-CheY	unknown	unknown	gnl\|CDD\|381150
NZ_CP040717.1\|WP_157161182.1\|1677729_1678503_-\|flagellar-type-III-secretion-system-pore-protein-FliP	unknown	unknown	gnl\|CDD\|235566
NZ_CP040717.1\|WP_157161176.1\|1658917_1659658_-\|heme-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|273492
NZ_CP040717.1\|WP_149152443.1\|1673305_1675408_-\|flagellar-biosynthesis-protein-FlhA	unknown	unknown	gnl\|CDD\|235672
NZ_CP040717.1\|WP_047439647.1\|1670275_1670995_-\|RNA-polymerase-sigma-factor-FliA	unknown	unknown	gnl\|CDD\|235901
NZ_CP040717.1\|WP_005353659.1\|1660501_1661146_-\|cytochrome-c-biogenesis-heme-transporting-ATPase-CcmA	unknown	unknown	gnl\|CDD\|184125
NZ_CP040717.1\|WP_005362047.1\|1671864_1673289_-\|flagellar-biosynthesis-protein-FlhF	unknown	unknown	gnl\|CDD\|235570
NZ_CP040717.1\|WP_157161177.1\|1662308_1663181_-\|chemotaxis-protein-CheW	unknown	unknown	gnl\|CDD\|366716
NZ_CP040717.1\|WP_005353668.1\|1669027_1669768_-\|protein-phosphatase-CheZ	unknown	unknown	gnl\|CDD\|377318
NZ_CP040717.1\|WP_139730760.1\|1677432_1677702_-\|flagellar-biosynthesis-protein-FliQ	unknown	unknown	gnl\|CDD\|235567
NZ_CP040717.1\|WP_157161180.1\|1675515_1676646_-\|flagellar-biosynthesis-protein-FlhB	unknown	unknown	gnl\|CDD\|235569
NZ_CP040717.1\|WP_005353658.1\|1659828_1660497_-\|heme-exporter-protein-CcmB	unknown	unknown	gnl\|CDD\|200083

Protein	Function_ID	Function_description	E-value
NZ_CP040717.1\|WP_019444725.1\|1665639_1666755_-\|chemotaxis-response-regulator-protein-glutamate-methylesterase	gnl\|CDD\|234828	PRK00742, PRK00742, chemotaxis-specific protein-glutamate methyltransferase CheB.	0
NZ_CP040717.1\|WP_005334696.1\|1663177_1663972_-\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	1.38671e-65
NZ_CP040717.1\|WP_088868784.1\|1664899_1665631_-\|flagellar-motor-protein	gnl\|CDD\|181654	PRK09109, motC, flagellar motor protein; Reviewed.	3.21866e-102
NZ_CP040717.1\|WP_157162376.1\|1661344_1661731_-\|DUF2802-domain-containing-protein	gnl\|CDD\|378523	pfam10975, DUF2802, Protein of unknown function (DUF2802). This bacterial family of proteins has no known function.	1.45409e-18
NZ_CP040717.1\|WP_157161178.1\|1663976_1664897_-\|OmpA-family-protein	gnl\|CDD\|181618	PRK09038, PRK09038, flagellar motor protein MotD; Reviewed.	2.29018e-74
NZ_CP040717.1\|WP_005298836.1\|1661750_1662239_-\|chemotaxis-protein-CheW	gnl\|CDD\|238374	cd00732, CheW, CheW, a small regulator protein, unique to the chemotaxis signalling in prokaryotes and archea. CheW interacts with the histidine kinase CheA, most likely with the related regulatory domain of CheA. CheW is proposed to form signalling arrays together with CheA and the methyl-accepting chemotaxis proteins (MCPs), which are involved in response modulation.	1.33093e-53
NZ_CP040717.1\|WP_157161181.1\|1676638_1677436_-\|flagellar-type-III-secretion-system-protein-FliR	gnl\|CDD\|235568	PRK05701, fliR, flagellar type III secretion system protein FliR.	6.13415e-72
NZ_CP040717.1\|WP_085942124.1\|1670987_1671857_-\|MinD/ParA-family-protein	gnl\|CDD\|349758	cd02038, FlhG-like, MinD-like ATPase FlhG. FlhG is a member of the SIMIBI superfamily. FlhG (also known as YlxH) is a major determinant for a variety of flagellation patterns. It effects location and number of bacterial flagella during C-ring assembly.	1.33933e-107
NZ_CP040717.1\|WP_013723552.1\|1669780_1670164_-\|chemotaxis-protein-CheY	gnl\|CDD\|381150	cd19923, REC_CheY_CheY3, phosphoacceptor receiver (REC) domain of chemotaxis response regulator CheY3 and similar CheY family proteins. CheY family chemotaxis response regulators (RRs) comprise about 17% of bacterial RRs and almost half of all RRs in archaea. This subfamily contains Vibrio cholerae CheY3, Escherichia coli CheY, and similar CheY family RRs. CheY proteins control bacterial motility and participate in signaling phosphorelays and in protein-protein interactions. CheY RRs contain only the REC domain with no output/effector domain. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	3.24143e-71
NZ_CP040717.1\|WP_157161182.1\|1677729_1678503_-\|flagellar-type-III-secretion-system-pore-protein-FliP	gnl\|CDD\|235566	PRK05699, fliP, flagellar biosynthesis protein FliP; Reviewed.	7.70224e-130
NZ_CP040717.1\|WP_157161176.1\|1658917_1659658_-\|heme-ABC-transporter-permease	gnl\|CDD\|273492	TIGR01191, Heme_exporter_protein_C, heme exporter protein CcmC. This model describes the cyt c biogenesis protein encoded by ccmC in bacteria. It must be noted an arabidopsis, a tritcum and a piscum plant proteins were recognizable in the clade. Quite likely they are of organellar origin. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes, ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in the heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c. [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Other].	1.41714e-85
NZ_CP040717.1\|WP_149152443.1\|1673305_1675408_-\|flagellar-biosynthesis-protein-FlhA	gnl\|CDD\|235672	PRK06012, flhA, flagellar type III secretion system protein FlhA.	0
NZ_CP040717.1\|WP_047439647.1\|1670275_1670995_-\|RNA-polymerase-sigma-factor-FliA	gnl\|CDD\|235901	PRK06986, fliA, flagellar biosynthesis sigma factor; Validated.	4.35806e-127
NZ_CP040717.1\|WP_005353659.1\|1660501_1661146_-\|cytochrome-c-biogenesis-heme-transporting-ATPase-CcmA	gnl\|CDD\|184125	PRK13538, PRK13538, cytochrome c biogenesis heme-transporting ATPase CcmA.	2.49963e-127
NZ_CP040717.1\|WP_005362047.1\|1671864_1673289_-\|flagellar-biosynthesis-protein-FlhF	gnl\|CDD\|235570	PRK05703, flhF, flagellar biosynthesis protein FlhF.	1.99144e-176
NZ_CP040717.1\|WP_157161177.1\|1662308_1663181_-\|chemotaxis-protein-CheW	gnl\|CDD\|366716	pfam01584, CheW, CheW-like domain. CheW proteins are part of the chemotaxis signaling mechanism in bacteria. CheW interacts with the methyl accepting chemotaxis proteins (MCPs) and relays signals to CheY, which affects flageller rotation. This family includes CheW and other related proteins that are involved in chemotaxis. The CheW-like regulatory domain in CheA binds to CheW, suggesting that these domains can interact with each other.	7.55417e-15
NZ_CP040717.1\|WP_005353668.1\|1669027_1669768_-\|protein-phosphatase-CheZ	gnl\|CDD\|377318	pfam04344, CheZ, Chemotaxis phosphatase, CheZ. This family represents the bacterial chemotaxis phosphatase, CheZ. This protein forms a dimer characterized by a long four-helix bundle, composed of two helices from each monomer. CheZ dephosphorylates CheY in a reaction that is essential to maintain a continuous chemotactic response to environmental changes. It is thought that CheZ's conserved residue Gln 147 orientates a water molecule for nucleophilic attack at the CheY active site.	1.09088e-101
NZ_CP040717.1\|WP_139730760.1\|1677432_1677702_-\|flagellar-biosynthesis-protein-FliQ	gnl\|CDD\|235567	PRK05700, fliQ, flagellar type III secretion system protein FliQ.	2.89373e-26
NZ_CP040717.1\|WP_157161180.1\|1675515_1676646_-\|flagellar-biosynthesis-protein-FlhB	gnl\|CDD\|235569	PRK05702, flhB, flagellar type III secretion system protein FlhB.	0
NZ_CP040717.1\|WP_005353658.1\|1659828_1660497_-\|heme-exporter-protein-CcmB	gnl\|CDD\|200083	TIGR01190, Heme_exporter_protein_B, heme exporter protein CcmB. This model describes the cyt c biogenesis protein encoded by ccmB in bacteria. Bacterial c-type cytochromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome C. [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Other].	3.16456e-72

>NZ_CP040717.1|WP_019444725.1|1665639_1666755_-|chemotaxis-response-regulator-protein-glutamate-methylesterase
MAVKVLVVDDSSFFRRRVSEIINQDPMLTVIDTAQNGREAVDKAMSLRPDVITMDIEMPVMDGISAVREIMAKCPTPILMFSSLTHEGAKATLDALDAGALDFLPKKFEDIARDKDEAVRLLQQRVKEISRKRFLMTSTARPKAPEPVARAPLGSIAPRTPDRQPDLQRTVPSASFKRSGKSYQLVAIGTSTGGPVALQNVLTKLPGDFPHPILLIQHMPATFTAAFAARLNGLCQIGVKEAEDGDVLKPGHAYLAPGGKQMLLEGRGAGARIRIVDGNDKVNYKPCVDITFASAAKTYADKVLAIVLTGMGADGRDGARLLKEQGSTIWAQDEASCVVYGMPQAVAKAGIASESLPLDKVAQRILVELGR
>NZ_CP040717.1|WP_088868784.1|1664899_1665631_-|flagellar-motor-protein
MLGLLLALGAIAIAQLWHGGSLLTLVDGPAFLIVLGGTVGAVTLQTPAKYILLALRQLLWIFTPPHQDLAAQAERLQSWAVFARQQGLLALENQAEQEEDNFTRQGLGMIVDGVSTEDIRMLLEADIDIEQERNEHAARVFEAMGGYSPTIGIIGAVLGLIQAMFHLEDPSALGAGIAVAFVATIYGVGFANLIYLPIANRLRAFHYHYALFQEMTLEGLLAIAHGENGLQVERRLRAYLKGE
>NZ_CP040717.1|WP_157161178.1|1663976_1664897_-|OmpA-family-protein
MRKRYRLHLQGREHLDRWLVSYADYMTLIFALFVVLYSVALVNKDKYRAVIDGMSQAFSVMQSGGNGLLEGQGNSLLDNPVSASPSLLESPASPSPSLAPISGVPVLQDGATLAKLDMQLQQNMGSLVDAGIVKVTQDENWLTIELSSGLLFGSGSAFLGPNAAPVINTLSSILKPVDNYVRVRGYTDNQQINNEIYRSNWALSAARAEAVLNGLIADGIAPQRLAFEAYGEFSPFADNSSEQGRLQNRKVVVAISKFAWVPPAPVVVTPRVVAEPVPAVQQAVDAGEIKVITLPGGGIRITTRQD
>NZ_CP040717.1|WP_005334696.1|1663177_1663972_-|ParA-family-protein
MIVWTVANQKGGVGKTTTVVSLAGILAQRGQRVLLIDTDPHASLTAYLDFDSDRLDGTLYELFQAVKPTAELVNKLTLKTKFENINLLPASITLATLDRVMGNREGMGLVLKRALLRIQDQYDYVLIDCPPVLGVMMVNALAACDRILVPVQTEFLALKGLERMMKTFEIMQRSKRDKFRYTVIPTMFDKRTRASLMTLKSIKDQYGDSVWNAVIPIDTKFRDASLLHIPPSIYSPGSRGTYAYETLLNHLDALERQRVHEVTA
>NZ_CP040717.1|WP_157161177.1|1662308_1663181_-|chemotaxis-protein-CheW
MRDTIQVRAMDDYFHSLLLDEPLVLDEVEEAQPAPVLQLQRQPQSVPEVVVAPYLESDPRLAQLGELLAQVGQVQFENDAFTQEITLTTPLEIVAEESLLPVEPEWPEEVLLPEVAEPHTTILTETALEVAPVEASEPVAWENIDTGKEFQALFFEVAGVTFAVPLTELGGIHQLGEITSLFGQPGWYKGIMTSREQKMNVVDTAQWVMPGQHLEMDDYKYLIMLGESPWGLACHHLKGTELLHRDQVKWRHQEGKRPWLAGMVKEKMCALLHVRELLLLLERGVNIEGR
>NZ_CP040717.1|WP_005298836.1|1661750_1662239_-|chemotaxis-protein-CheW
MTEKRNIAQNLAEDEVLQWVTFQLENETYGINVMQVQEVLRYTEIAPVPGAPEYVLGIINLRGNVVTVIDTRSRFGLPSGDVSENSRIVIIEAEKQVIGIMVDSVAEVVYLRSSEIDAAPAVGTEESAKFIQGVSNRDGQLLILVDLNKLLSDEEWEDIGSL
>NZ_CP040717.1|WP_157162376.1|1661344_1661731_-|DUF2802-domain-containing-protein
MIEMVALGVSLIALAFASYIWFKSKRSKQESEACVATLQGQLESLRKQMMELHTGAIGMGHRLQSVEGAMQQVNERQQELTMQDPERRLYSRAAKMVELGADLDEVMSECELPKAEAELLISLRKGRS
>NZ_CP040717.1|WP_005353659.1|1660501_1661146_-|cytochrome-c-biogenesis-heme-transporting-ATPase-CcmA
MLLQVNNLSCVREDRTLFEHLSFSVAPGDLVQIEGPNGVGKTSLLRLLTGLSQPFAGEVCWNGENIRHCRDEYHANLLYLGHQPGVKAALTPFENLKFYQQLHHPQQTETDLWQILARVGLAGFEENPTGQLSAGQQRRVALARLWLSQKPALWILDEPFTAIDKQGVKVLEQLFLAHAERGGMVILTTHQDLTLMQGRLKTISLTPFASTLQE
>NZ_CP040717.1|WP_005353658.1|1659828_1660497_-|heme-exporter-protein-CcmB
MLRAVMHLIHRELLMALRQRSDILNPLWFFLIVITLFPLGIGPEPKLLARIAPGIIWVAALLAAMLSLERLFRDDFADGALEQMMLMPHPLGLLALAKVVAHWLLTGLPLLLISPLLAILLSLDMNTYLAVVATLALGTPVLSLLGAVGVALTVGLRKGGVLLSLLILPLYIPVLIFATSAIDAAGMSLPYGGQLAILAAMLVGALTLTPLAVSAALRVSLN
>NZ_CP040717.1|WP_157161176.1|1658917_1659658_-|heme-ABC-transporter-permease
MWKWLHPYAKPERAYQLAGTLLPWFAVISLLSFVIGSVWGLAFAPADYQQGDSFRIIYIHVPSAILSMGAYSTMAVAAFIGLVWQLRMADMTVAAIAPVGAVFTFIALFTGAAWGKPMWGTWWVWDARLTSELILLFLYLGVIALYNAFSDKVVAGRAAGILALVGVINLPIIHYSVEWWNTLHQGATITKFDKPSISPEMLWPLLIMILAFAAFLGALTLMRFRNELLMREWHRPWVKEIAEQEK
>NZ_CP040717.1|WP_005353668.1|1669027_1669768_-|protein-phosphatase-CheZ
MMAKTRAMISLDQARMLVAHLEQGEFELADELLAEVCAPNAADLFEKVGQLTRQLHDSLQEFRLDPRIPDLATHDIPDARERLSYVIDMTDKAANRTMDAVEASLPIADRLNDNIQLVMPNWNALMSRDMSVGQFKSLCHQLDDFIKASESDADKLRQLLTEILMAQDFQDLTGQMIRKVIKLVQEVETKLIEMLTMFGEASAEHSTRSIPVNGIEAEGPIMNPEARADVVNGQDDVDDLLSSLGF
>NZ_CP040717.1|WP_013723552.1|1669780_1670164_-|chemotaxis-protein-CheY
MDKNMKILIVDDFSTMRRIIKNLLRDLGFNNTHEADDGNTALPMLKNGDFQFVVTDWNMPGMQGIDLLKAIRVDEKLKHLPVLMVTAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFERIG
>NZ_CP040717.1|WP_047439647.1|1670275_1670995_-|RNA-polymerase-sigma-factor-FliA
MNKAQAYLRHQDSYVLVERHAPLVKRIAQHLLARLPSSVLLDDLIQAGMIGLLEASRNFDGSKGASFETYAGIRIRGAMLDEIRRGDWVPRSVHRNSRAIAEAIESVEQTHGRDARDTEVAAEMGVSIADYHAMLQDVSCGKIIGIEDLGVSEDVIGNPDDAPSGSGFDELAAERFQIQLSEQIGRLPEREALVLSLYYDEELNLREIGEVLNVSESRVSQIHSQAMHRLRARLRDWHL
>NZ_CP040717.1|WP_085942124.1|1670987_1671857_-|MinD/ParA-family-protein
MDQASGLRKMRQNNRVKVIAVSGGKGGVGKTNVTLNVAGAMAAQGKRVMVLDADLGLANVDVMLGLRVHRNLSHVLAGECTIDDIIVEGPYGMMIVPATSGTQSMVELSPVQHAELIRAFSEMKTQVDILLVDTAAGISDMVLSFTRAAQDIMVVVCDEPTSITDAYALIKILSKDHGVFRFKVVANMVRSLREGQELFAKLTRVTDRFLDTSLELVACVPYDTNLRAAVRKQKLIVEAFPKSPAALAFRALANKAASWPVPNQPGGHLEFFLENLLQKPATTQEGSRE
>NZ_CP040717.1|WP_005362047.1|1671864_1673289_-|flagellar-biosynthesis-protein-FlhF
MKIKRFFAKDMRTALAEVKETLGPDAVIMSNKKVTGGVEIVAAVDYQSQVPGPKDAPVRRQLNDESVNISSAARQMIRPEPTPAKEQNEHYADTLAALLARQQKLKPGNGAPLGNTQSAGLAAANAAPRTLAEQGQWGAAPEPAKPKARVASGQRPPQPAQRDQEMEGMRKEMASIRKLLEHQISGLMWQEVERREPMRALLIKELKKLGFDDAFADQLAGLIPEDMSIHQAMAQLAEVLTAQLKISEDEIMRQGGAVALLGPTGVGKTTTIAKLAARFAMKYGAEQVALITTDNYRIGAHEQLQTYGRIMGCPVRQVRDAEELANALYQFRHRRLVLIDTAGVGQRDIRLTEQLDTLVKNAKVRIRSYLVMSATSQRRVMQEAVDHFRRIPLSGCILTKLDESLNLGEVINVCIQNSLPISYITDGQRVPEDIQVANAAQLVGAAMGSLERETEEPYFWGAGFGEAEDSEFYE
>NZ_CP040717.1|WP_149152443.1|1673305_1675408_-|flagellar-biosynthesis-protein-FlhA
MEFKAVLGQFKEYRGVLGKGLGTPLLVLAALGMVVLPIPPLMLDVLFSFNIALSIVVLLVSVYTRRPLEFAAFPTVLLLATLLRLALNVASTRVVLLEGHNGSAAAGHVIEAFGNVVIGGNYAVGIIVFTILMIINFVVITKGAGRIAEVSARFTLDAMPGKQMAIDADLNAGLINQEEAKNRRQDVTQEADFYGSMDGASKFVKGDAVAGVMILFINIIGGFIIGMMQHQLTFSESAEIYTLLAIGDGLVAQIPSLLLSIAAAIIVTRQNTDQDMGTAVLGQLFDNPKALIISAGILLMMGLVPGMPHFAFLSLGALAAAGAWWLLRREKLAAAKAAKGELLPATAEQPHEQKELSWDDVMPVDIIGLEVGYQLIPLVDRNQGGELLNRIKGVRKKLSQELGFLVPAVHIRDNLDLAPNQYRITLMGVSTGEANVYHDKEMAINPGQVFGQIQGIATRDPAFGLEAVWVAKEMVSQAQTLGYTVVDTATVVATHLSQILTNHAALLLGHDEVQQLLDMIGKHQSKLVEGLVPEVISMGNLVKVLQNLLNEGVPIRDMRTILQTLVEYAPRSPDPEVLTAACRIALRRLIVQEIAGPDPELPVITLAPELERILHQSLQAGGGDGAGIEPGLAERMQRSLVEATQRQELEGQPAVLLTSGILRNTLAKFVKNAIPGLRVLSYQEVPDDKQIRIVSAVGQN
>NZ_CP040717.1|WP_157161180.1|1675515_1676646_-|flagellar-biosynthesis-protein-FlhB
MADTDQERTEQPTGKRLQQAREKGQIARSKELGTACVLLSAVFGLLMFKGSLATAMVKVVTMGFTLDREQAFDPNAMIAMVPALLGELVLPLGLLFALVAIAAFIGNTLMGGMNFSTEAMMPKFSKLSPLSGIKRMFGVQSLIELVKSIAKVVFITLFAWWMLSSQFNHLLNLSMEGFPGGIIDALELFLWMLIILCCALLPIVAIDVPFQQWNHMRQLKMTKQEVKDEFKDSEGKPEVKGKIRQLQMQMAMRRMMGDVPKADVVITNPTHYSVALKYDAGKPGAAPKVVAKGTDEIAMKIREIAREYEIPIMPSPALTRAVYHSTELGHEIPEGLFAAVAQVLAYVFQLKKFRRGQGRRPQPLAKDLPIPTEYRK
>NZ_CP040717.1|WP_157161181.1|1676638_1677436_-|flagellar-type-III-secretion-system-protein-FliR
MTYTTALIMEWLSSILWPLARVSSLLMVMAVFGSRLAPARVRMGLALAITFLIAPLLPKMPLIELFSAGSFLVLGQQLLIGIALGLMTQFLMESFVMAGQVIAMQTSLGFATLVDPMNGQSAPVVGQFYLMLATLVFLALDGHLVMLRLVILSFETLPVSDAGLTLPAIRTLIGFLGVMYQASLVMALSAIVALLLINFAFGVMTRAAPQLNIFSIGFAVSMMSGLLILWLTIGGFLGHFDIMWERVQEVSCELINTQCFGGAHG
>NZ_CP040717.1|WP_139730760.1|1677432_1677702_-|flagellar-biosynthesis-protein-FliQ
MSPETFIDVFREALWLVTIMVTAVILPSLAIGLVVAIFQAATSINEQTLSFLPRLIVTLFALGAGAHWGLQSLMDFFVLMVNQIPEVVG
>NZ_CP040717.1|WP_157161182.1|1677729_1678503_-|flagellar-type-III-secretion-system-pore-protein-FliP
MKKANGLWLNTGLLVSLLIPLFCSWPALAQDAMSAVTVKTMGDGSQEYSLTLQVLALMTALSFLPAMVIMMTSFTRIIVVLGILRQAIGLQQSPSNQVLIGIALFMSFFIMSPVLDRINDEALQPYLAETIQAKEALERAELPIHQFMLAQTRIKDLNTFMEIANVQVEKPADVPLRVLIPAFVTSELKTAFQIGFMLFLPFLVIDLVVASILMAMGMMMLSPMIVSLPFKLMLFVMVDGWNLILGSLANSFGLGAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040717_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040717_2

3343520-3343679

Orphan

Consensus_repeat	Method
TTTTACAGCCCTAACAGCACAGGAATGCACGATGTTGATAGATTGTTCCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040717_2

>merge|NZ_CP040717|2|3343520-3343679|CRISPRCasFinder
TTTTACAGCCCTAACAGCACAGGAATGCACGATGTTGATAGATTGTTCCAGGATGCATGGGGCTTTGGACAACGACTTCATAGCGCTTGGCGACCCTTGGTTCGGTGAATTTTTACAGCCCTAACAGCACAGGAATGCACGATGTTGATAGATTTTTCCA

>NZ_CP040717|2|2|3343520-3343679|CRISPRCasFinder
TTTTACAGCCCTAACAGCACAGGAATGCACGATGTTGATAGATTGTTCCA	GGATGCATGGGGCTTTGGACAACGACTTCATAGCGCTTGGCGACCCTTGGTTCGGTGAAT
TTTTACAGCCCTAACAGCACAGGAATGCACGATGTTGATAGATTTTTCCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040717.1\|WP_031227939.1\|3350744_3351290_-\|ribosome-associated-protein	unknown	unknown	gnl\|CDD\|235377
NZ_CP040717.1\|WP_157161820.1\|3349565_3350348_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|336781
NZ_CP040717.1\|WP_069554181.1\|3341648_3341963_-\|iron-donor-protein-CyaY	unknown	unknown	gnl\|CDD\|274572
NZ_CP040717.1\|WP_157161817.1\|3346266_3346977_+\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|182696
NZ_CP040717.1\|WP_019444858.1\|3342036_3342213_+\|lipoprotein	unknown	unknown	gnl\|CDD\|338858
NZ_CP040717.1\|WP_005336384.1\|3333886_3334138_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|308985
NZ_CP040717.1\|WP_100646922.1\|3334208_3335372_-\|heme-biosynthesis-protein-HemY	unknown	unknown	gnl\|CDD\|273126
NZ_CP040717.1\|WP_076495577.1\|3335382_3336432_-\|heme-biosynthesis-operon-protein-HemX	unknown	unknown	gnl\|CDD\|377333
NZ_CP040717.1\|WP_157161822.1\|3353042_3353729_-\|KilA-N-domain-containing-protein	unknown	unknown	gnl\|CDD\|367917
NZ_CP040717.1\|WP_157161819.1\|3347497_3349024_-\|mechanosensitive-ion-channel	unknown	unknown	gnl\|CDD\|366370
NZ_CP040717.1\|WP_157161815.1\|3340998_3341652_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|334855
NZ_CP040717.1\|WP_157161814.1\|3338412_3340932_+\|class-I-adenylate-cyclase	unknown	unknown	gnl\|CDD\|236522
NZ_CP040717.1\|WP_085942101.1\|3344613_3345264_+\|DUF484-family-protein	unknown	unknown	gnl\|CDD\|225701
NZ_CP040717.1\|WP_157161818.1\|3347053_3347452_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161821.1\|3351498_3352794_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271184
NZ_CP040717.1\|WP_157161816.1\|3345256_3346234_+\|tyrosine-recombinase-XerC	unknown	unknown	gnl\|CDD\|234698
NZ_CP040717.1\|WP_040069030.1\|3349169_3349553_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157162424.1\|3337159_3338089_-\|hydroxymethylbilane-synthase	unknown	unknown	gnl\|CDD\|234612
NZ_CP040717.1\|WP_075115816.1\|3342245_3343496_+\|diaminopimelate-decarboxylase	unknown	unknown	gnl\|CDD\|273415
NZ_CP040717.1\|WP_157161813.1\|3336428_3337163_-\|uroporphyrinogen-III-synthase	unknown	unknown	gnl\|CDD\|235647

Protein	Function_ID	Function_description	E-value
NZ_CP040717.1\|WP_031227939.1\|3350744_3351290_-\|ribosome-associated-protein	gnl\|CDD\|235377	PRK05255, PRK05255, ribosome-associated protein.	5.92071e-71
NZ_CP040717.1\|WP_157161820.1\|3349565_3350348_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|336781	pfam07722, Peptidase_C26, Peptidase C26. These peptidases have gamma-glutamyl hydrolase activity; that is they catalyze the cleavage of the gamma-glutamyl bond in poly-gamma-glutamyl substrates. They are structurally related to pfam00117, but contain extensions in four loops and at the C-terminus.	5.84849e-87
NZ_CP040717.1\|WP_069554181.1\|3341648_3341963_-\|iron-donor-protein-CyaY	gnl\|CDD\|274572	TIGR03421, FeS_CyaY, iron donor protein CyaY. Members of this protein family are the iron-sulfur cluster (FeS) metabolism protein CyaY, a homolog of eukaryotic frataxin. ISC is one of several bacterial systems for FeS assembly; we find by Partial Phylogenetic Profiling vs. the ISC system that CyaY most like work with the ISC system for FeS cluster biosynthesis. A study of of cyaY mutants in Salmonella enterica bears this out. Although the trusted cutoff is set low enough to include eukaryotic frataxin sequences, a narrower, exception-type model (TIGR03421) identifies identifies members of that specific set. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	1.21144e-53
NZ_CP040717.1\|WP_157161817.1\|3346266_3346977_+\|HAD-IA-family-hydrolase	gnl\|CDD\|182696	PRK10748, PRK10748, 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB.	1.27244e-61
NZ_CP040717.1\|WP_019444858.1\|3342036_3342213_+\|lipoprotein	gnl\|CDD\|338858	pfam13627, LPAM_2, Prokaryotic lipoprotein-attachment site. In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognizes a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached.	2.27097e-05
NZ_CP040717.1\|WP_005336384.1\|3333886_3334138_+\|hypothetical-protein	gnl\|CDD\|308985	pfam03692, CxxCxxCC, Putative zinc- or iron-chelating domain. This family of proteins contains 8 conserved cysteines. It has in the past been annotated as being one of the complex of proteins of the flagellar Fli complex. However this was due to a mis-annotation of the original Salmonella LT2 Genbank entry of 'fliB'. With all its conserved cysteines it is possibly a domain that chelates iron or zinc ions.	0.00373047
NZ_CP040717.1\|WP_100646922.1\|3334208_3335372_-\|heme-biosynthesis-protein-HemY	gnl\|CDD\|273126	TIGR00540, TPR_hemY_coli, heme biosynthesis-associated TPR protein. Members of this protein family are uncharacterized tetratricopeptide repeat (TPR) proteins invariably found in heme biosynthesis gene clusters. The absence of any invariant residues other than Ala argues against this protein serving as an enzyme per se. The gene symbol hemY assigned in E. coli is unfortunate in that an unrelated protein, protoporphyrinogen oxidase (HemG in E. coli) is designated HemY in Bacillus subtilis. [Unknown function, General].	1.26445e-80
NZ_CP040717.1\|WP_076495577.1\|3335382_3336432_-\|heme-biosynthesis-operon-protein-HemX	gnl\|CDD\|377333	pfam04375, HemX, HemX, putative uroporphyrinogen-III C-methyltransferase. This is a family of bacterial putative uroporphyrinogen-III C-methyltransferase proteins. It forms one of the members of a complex of proteins involved in the biogenesis of the inner membrane in E.coli. Uroporphorphyrin-III C-methyltransferase (HemX) is a single spanning inner membrane protein that regulates the activity of NAD(P)H:glutamyl-tRNA reductase (HemA) in the tetrapyrrole biosynthesis pathway.	2.36771e-94
NZ_CP040717.1\|WP_157161822.1\|3353042_3353729_-\|KilA-N-domain-containing-protein	gnl\|CDD\|367917	pfam04383, KilA-N, KilA-N domain. The amino-terminal module of the D6R/N1R proteins defines a novel, conserved DNA-binding domain (the KilA-N domain) that is found in a wide range of proteins of large bacterial and eukaryotic DNA viruses. The KilA-N domain family also includes the previously defined APSES domain. The KilA-N and APSES domains may also share a common fold with the nucleic acid-binding modules of the LAGLIDADG nucleases and the amino-terminal domains of the tRNA endonuclease.	2.76136e-09
NZ_CP040717.1\|WP_157161819.1\|3347497_3349024_-\|mechanosensitive-ion-channel	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	3.64479e-24
NZ_CP040717.1\|WP_157161815.1\|3340998_3341652_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|334855	pfam02230, Abhydrolase_2, Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.	5.67568e-37
NZ_CP040717.1\|WP_157161814.1\|3338412_3340932_+\|class-I-adenylate-cyclase	gnl\|CDD\|236522	PRK09450, cyaA, class I adenylate cyclase.	0
NZ_CP040717.1\|WP_085942101.1\|3344613_3345264_+\|DUF484-family-protein	gnl\|CDD\|225701	COG3159, COG3159, Uncharacterized protein conserved in bacteria [Function unknown].	7.52086e-37
NZ_CP040717.1\|WP_157161821.1\|3351498_3352794_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271184	cd01184, INT_C_like_1, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain containing six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	2.41069e-21
NZ_CP040717.1\|WP_157161816.1\|3345256_3346234_+\|tyrosine-recombinase-XerC	gnl\|CDD\|234698	PRK00236, xerC, site-specific tyrosine recombinase XerC; Reviewed.	1.71864e-153
NZ_CP040717.1\|WP_157162424.1\|3337159_3338089_-\|hydroxymethylbilane-synthase	gnl\|CDD\|234612	PRK00072, hemC, porphobilinogen deaminase; Reviewed.	0
NZ_CP040717.1\|WP_075115816.1\|3342245_3343496_+\|diaminopimelate-decarboxylase	gnl\|CDD\|273415	TIGR01048, Diaminopimelate_decarboxylase, diaminopimelate decarboxylase. This family consists of diaminopimelate decarboxylase, an enzyme which catalyzes the conversion of diaminopimelic acid into lysine during the last step of lysine biosynthesis. [Amino acid biosynthesis, Aspartate family].	0
NZ_CP040717.1\|WP_157161813.1\|3336428_3337163_-\|uroporphyrinogen-III-synthase	gnl\|CDD\|235647	PRK05928, hemD, uroporphyrinogen-III synthase; Reviewed.	1.42663e-58

>NZ_CP040717.1|WP_075115816.1|3342245_3343496_+|diaminopimelate-decarboxylase
MDHFNYDAAGQLQAEQTSLQQLAEQYGTPLYVYSRATLERHWHAFDKAAGDIPHLICYAVKANSNLALLNLLARLGSGFDIVSGGELSRVLAAGGDPAKVVFSGVAKSEAEMRLALDKEILCFNLESEAELERLNRVAGSMGKKARVSVRVNPDIDAGTHPYISTGLKQNKFGIPIELAPAIYRKAAAMANIEIVGVDCHIGSQLTELNPFMEAADKLLRLIDGLAAEGIHIHHLDVGGGLGVNYGSEQPPHPTEYAEALKQKLAGRDLTLLFEPGRAIVANAGVLLTRVEYLKPGETRNFALIDAGMNDMLRPSLYGAWMNIIEVDSRAGHAPALYDVVGPVCETGDFLGKERTLAIAEGSLLAVRSAGAYGFTMSSNYNTRPRAAEVLVDGAEAHLIREREQLADLWRGEHLLP
>NZ_CP040717.1|WP_019444858.1|3342036_3342213_+|lipoprotein
MITQFTKCLLATLLSLGLAACGLKGPLYMPPPEQPQSQSTPQAAPPATTEAATEAAPH
>NZ_CP040717.1|WP_069554181.1|3341648_3341963_-|iron-donor-protein-CyaY
MKDHEYHALTDAFFQYVEDTLDEGYPDIDCERNGGVLTLSFENKTKVIINKQEPLHQIWVATRENGFHFELQGDTWIDNRFGHELKALLSQSCTAQAGEEVVFP
>NZ_CP040717.1|WP_157161815.1|3340998_3341652_-|alpha/beta-fold-hydrolase
MIDLHPQGARHAVIWLHGLGDSGAGLAPLVDALDLPADLPVRHLLPDAPERPITINMGYKMRGWYDIRSFEDPAERAVESHVRESADQIAALLDQLVADGFAPEHIVLAGFSQGGVIASFTALRYQATLAGLLCMSTYLAAPDKLLGEMSEAARTLPICYMHGIYDDVVSLSLGWDAKNRLENAGLAPEWHEYPMRHEICRPQLGDIRSWLLARLAA
>NZ_CP040717.1|WP_157161814.1|3338412_3340932_+|class-I-adenylate-cyclase
MQEHIDTLVARYDDITRLKTQRALGLMSRYGQQVFQLLPVMLHFNHPLLPGYVSGDVPHGIWSFSATAEQQAFIDDLCRNANCQSGLATHDRAIQGLYSMGSTSSIGQCCHSDLDIWVCHVAGLSQERLDLLELKCQQLSKWAEQRGVDLNFFLIPEDKFRQTNDAQMQGESCGSAQHLLLLDEFYRSAMRIAGKRLIWYLVPTECDDHYDAYVNELFESGKLKQDDWLDLGSFDRIPAEEYFGSALWQLYKGIDSPYKAVLKSVLMEAYSHEYPNTRLLSMIGRDWFQHNEGMHYRLDNYCLMLDKVTNYLKSIGDMARLDLVRRCFYLKVCDGLSHPKDDHSPEWRREQMSQLVSYWGWSQDKLYQLDHRHEWKIEEVKIAHAELLEALMLSYRNLIQFARRNNISESINPEDIGILSRKLYAAFESLPGKVQRINLKIAPDLSEPDLSFVQVPHGRLNRAGWYLYKHSLEPVDIIGRAPLEFNGYISKLVSWAYFNDLLTPQSRVHLFNQGSDLHIDNLHQFCRDLSGCFPEKYPLATNLALSRPCEIRQLSIFLNLEMDPTSHWVGQVIEFDANTVDVFSFGRNQECLVGSVDLVYRNSWSEIRTLHFQGDEAVVDALTTILGKMHQDAAAPEMIEVFCYSQHFRSLVRSRFQTLVAECIDLRLARDKQQLVKTMALGREKYGIFFERRGVSVKKLENAIDFYRHISHNKLDHLPLRLDKTHSQHLPSIVDAYASEGLVQFFFDTRDAGTNIYILDEANRVEIYQHFAGNKDELVAGVNRFYTSNHERFSDDGQFINFNLPQYYEIVQVNGELDVIPYRSQGTLREQVPPTREVG
>NZ_CP040717.1|WP_157162424.1|3337159_3338089_-|hydroxymethylbilane-synthase
MAARTLKIATRKSPLALWQANFVKDRLEALHPELQVELVPMSTQGDKILDTPLAKVGGKGLFVKELETAMLEGRADIAVHSMKDVPVEFPEGLGLHTICEREDPRDAFVSNRFQAIAELPQGAVVGTSSLRRQCQLRAARPDLVIRDLRGNVNTRLAKLDAGEYDAIILAAAGLKRLEMAHRITAFIEPEQSLPANGQGAVGIECRLDDVELHALLAPLEHAETRARVLTERAMNRALQGGCQVPIGAYALVEGEQIWLRGLVGSPDGSQVIRDEIRGPLADGEAIGEQLAQRLLAAGADEILAEVYRA
>NZ_CP040717.1|WP_157161813.1|3336428_3337163_-|uroporphyrinogen-III-synthase
MTPLVVRPAIQAAELVQLLRQHGHAPLCCPLLETVAGSELPLLPDLLRSAEAVIAVSIHAVHFAHDFLLQTGQTWPHIEYFAVGQASADAFAAIGITASCPDDPRSEGLLALPALQQVAGKRVLILRGNGGRDLIASTLASRGALVHYCAAYERHYPELDGETLTHHWQAAGLDSLLITSGELLQRLLELVPDHQRPWLFDRLLVVPSPRVAEMASAAGFIHITIAQGASNQALTAALELRKME
>NZ_CP040717.1|WP_076495577.1|3335382_3336432_-|heme-biosynthesis-operon-protein-HemX
MTEQQESQVKPQPTAVVNGSKSRSGAVLGGVAILLALGLTGGLYLHGHKNAVAQQAELAQLKQQLASALSKIDQTSSKDAEQLAALDQTQQRLQGEMQGLQNRVLDLNDKRPNDWMLAESEYLVRMAGRKLWLEHDLVSAITLLGNADERIAALNDPSLMPIRKALAEDIAKLKGMPRIDREGLTLKLAALSDQIELLPLSTVSMPEAKAEPDQAVSTNPDEWESNLKKNWVKFTENFVTIRRRDGAVEALLSPQQEIFLRENLKTKLLQAQLSVYREQQALYEDSLDKAQRWLTQYFDTDNSATRYMQGEIDKLKGEQIQIDYPAQFKTQAMLEQVLTERLQRILASS
>NZ_CP040717.1|WP_100646922.1|3334208_3335372_-|heme-biosynthesis-protein-HemY
MIRIIILVAVMVAGLIFGPQASGNKGYVLIALGNYTIESSVTSAVILAVLFYGALLIVEWLLGRVFGLRRKTLGWYGSRRRRKANQQTVAATLAMAEGHYSQAEKLMIKGASNSDTPLLNYLSAAKAAQARGDDARRDQYLQKAQEENPKAELALTLTQTQLQIEQGQYDTALAMLESVYALNPRHPMVLDQLRQVHLARQDWSALCDLIPALHKVGKLTPKQEEDLLQQAWCGRLQQAAGSLETLKAVWQDLPRKLRLEPELLACYGDLLRQLGADGEAATLWQEALRKQPMPQLLARLPKLKLDSYQPLLALLQKQQGQPEVDTALAQLYLLAGQLDDAQKLLEQEVERAPSAAAYHALGQLMDKRRLTNKANEYYRQALELAGI
>NZ_CP040717.1|WP_005336384.1|3333886_3334138_+|hypothetical-protein
MECRSGCAACCIAPSISSAIPGMPDGKPAGVPCIQLDSALGCKIFGQPERPAVCGGFRPMMDVCGSHRAEAIWLIGELERLTT
>NZ_CP040717.1|WP_085942101.1|3344613_3345264_+|DUF484-family-protein
MDEATVLEYLARYPEFFQRHAAVLDRIRIPHERKGSVSLVERQLERQRERIEQLEQEITELMGIASENERIFRVYADLYGELYGCQTLFEVSAVMGKAFVQRLRLTGLRLWLNPKKFALSGPEQRFLAQGKQLESLLGQRLPGQDYYFGRLSQSEKQALFGHDVLVNSVALMRLGDLGVLAFASSDPGHFTPHNDTLLLGQLGRLLQLRLPELTHG
>NZ_CP040717.1|WP_157161816.1|3345256_3346234_+|tyrosine-recombinase-XerC
MARTPAKGPAKAPVIAPPLPAALAEELAAFIEYLRVERQLSPHTRNNYQAHLEAMTAELVALGLTDWGRLEASQVRTLVTRMHKAGLAPRSLSTKVSALRSFCDWQVRQGRLTANPARGIVTPKQGRPLPKNLDVDEMHQLLNITDEQDPLAVRDRAIMELMYSSGLRLAELVGINLVDLKLDDRQLKVTGKGSRERVLPIGRMAVEWLQKWLKVRSLLAGDESEALFVSSRKQRLSARSVQARLDGWGNKQALNAHVHPHKLRHSFATHMLESSGDLRAVQELLGHADLSTTQIYTHLDFQHLAKVYDSAHPRAKRDPDAQDDE
>NZ_CP040717.1|WP_157161817.1|3346266_3346977_+|HAD-IA-family-hydrolase
MHFYRRWQPVAAISFDLDDTLYDNGPAIVRAEQWMLSHLRSEYLATAMLDKPRWLELKRNVLNSAPELRHDVSLARQQTIRAAMVEGGMADQLASREAEQVFAAFLAERSKIEVSESTHQLLARLADRYPLVVITNGNLDLSQVGLDRYFTLVCKAGAGARMKPAPDMFEQTRSALKLPAERILHVGDHPETDVLGARLHGFRAAWLNERQQPWQQLQLLPDVELTALEELADLLL
>NZ_CP040717.1|WP_157161818.1|3347053_3347452_-|hypothetical-protein
MLLTTLALAASLQFDCPATIETRQQLLTPQQGWQAFTRNDDGKPDEPLSHRLDNLALFDGDPAELAQLKPDNGDSDEIHYWSQLDSSLRPLYLVCRYQNSAITLQQPLPVGISYCRVNQRDRYTLLGLVCRK
>NZ_CP040717.1|WP_157161819.1|3347497_3349024_-|mechanosensitive-ion-channel
MAGENLTALPTLIWIGEHPFWTLLTLSLMLIHFWRRPGQRRELLSELSFVMISAVVILLIQLEGGWFKLPLPHQLLIEISTLLAGLILVKIWGILLFEFLLPLCHVRIPRIIADIVITIGYIGWGLFRLYASGMALGEIVTTSAVITAVIAFAMQDTLGNLLAGVSIQLDNSIAIGDWLQVDTTQGRVVEINWRATTIETRNWETVVISNSHLLKQRFTVLGRRRGEPLQWRRWVWFDLTLDTLPTQIIALIEKSLRETKLPCVAKHPQPDCLLMNVEGGIARYAVRYWLTDLARDDPTDSMVRSLIDAALRRNDRRLTPPIFNVFMAKEKQHLDARHKRHTAERTDTLRKLPLFAMLQENELLQLADQVKFAPFVSGDIMLEQGDVSSWLFVLVKGEAEMVVNVEGRELKLGTLNAGDFFGELSLLTGEPSSFTVRAVATVETYRINQAMFQELVMQREALVEPLYRVLSDRQQEQRALLEREAEAMKQPPQQLDLLDKLMKLFGGR
>NZ_CP040717.1|WP_040069030.1|3349169_3349553_+|hypothetical-protein
MALLPLAGCDLLAEKYRVEFRDGSWREIAITPFSSEARWREGCATGEVLSDMKVPIKRGDTVNGREQLLIGGEKFELDDNNLYRSNGMVFGHSPDHIQRGLKGMDICRTLRPERGGLPKLKARGFGD
>NZ_CP040717.1|WP_157161820.1|3349565_3350348_-|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MPNPQPPATRKPVVLMTMGAQPRNGHAYQVMTHKYIMPLVEISGCVPLLVPTCCGTTDLEQYLDLADGIYLSGAGSNIDPALYGQENLTPEKQQDRDRDLFDVPLIKGALARGLPILGICRGMQEINVALGGDIHQKVYNEPGYDDHREDADDPVDEQYGPSHQIKLLPGSWFAELMGEEQIPVNSLHGQGINRLGKGLEPLAHAEDGLIEALHAPALSPFLLAVQWHPEWKANENPHSIKIFQAFGDACRQRCALMAAS
>NZ_CP040717.1|WP_031227939.1|3350744_3351290_-|ribosome-associated-protein
MTGIKRPMSQYQDDNEFEDWGPSKSQLKRDAEALQKMGEEIVSLSHSELEKIPLDEELAEAVELGRKLKPKKDESFRRHLQFIGRLMRSRDIEPIAEALSIIKNRHSTVNARLHRLEQWRERLITEGDSALNELMSQFHELDRQKLRQLIRSANKERELNKPPVAYREMYQYLRGEIEDLL
>NZ_CP040717.1|WP_157161821.1|3351498_3352794_+|tyrosine-type-recombinase/integrase
MKHLVKKANRYYIHWNIPKDVRHLFDGLAIYSRSLKTDNLGQAIMRRDQLLAELEGVVRKARVNPERQQFLALVKEIRKAAGEPPIEQDEENIEEAWSTELQVAIEKGDTVRADAIRAAMGWGAEGIEAKYGITLMEATKLYTETTEESLDPSTLSRLNLAPVSFASFLKLKDIHLADIDKRDVIAWVLECAKDKAPRTVKAYATCLSKVWDWAYRSKEVSGENPFKDLDIRLTSSGTKRTAFTVEQVAALLEGAGPAMYSLMKFALVTGCRLGELVTITAADFHETDGVHYFTIKDGKTANAARNVPLPVALWEELKAVVESELWTRTETRTRPSSAQYWSVMFQKHKDAVLGDQCSAVFHSFRKMAATGYQRAQVFEGIAAGILGHSRKGLTLSYGLYATGFELQQQLEAVETMLASDYMSQFLKLFNK
>NZ_CP040717.1|WP_157161822.1|3353042_3353729_-|KilA-N-domain-containing-protein
MKITFNGNTYPIRKNAEGLYSLTDIEKAWLAEGNTGGQLDNWKRAPEVTELIELREIHVFQKRGGNRTPDRGTWGCKEAVIEYASYCSNEFRRAVRKAFIALTEGDTMQAAAIAESVAVSPELLEKHDATRKAMNDAIKAKGIDMCGKAYGNFYRLACKAATGYVPSVLTGKNGSAKEYIKQVSNVPCMNALIACMETITMGLKVGLDYHKVAAMLNVETSQNGELLG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040717_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040717_4

3360342-3360438

Orphan

Consensus_repeat	Method
GTGCGTCTTCAGGTCGTCCTCGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040717_4

>merge|NZ_CP040717|4|3360342-3360438|CRISPRCasFinder
AGGTGGCTTCAGGTCGTCCTCGGGGTTGGGATCTTGGCGGAATCCGCTGTTTTCCCAGTGCATCTTCAGGAGCGGGCGTCCTCGGGTCCTCTTCCGG

>NZ_CP040717|4|4|3360342-3360438|CRISPRCasFinder
AGGTGGCTTCAGGTCGTCCTCGGG	GTTGGGATCTTGGCGGAATCCGCTGTTTTCCCAGTGCATCTTCAGGAGC
GGGCGTCCTCGGGTCCTCTTCCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040717.1\|WP_157161834.1\|3365535_3366090_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161830.1\|3358373_3359459_-\|capsid-protein	unknown	unknown	gnl\|CDD\|177268
NZ_CP040717.1\|WP_005336355.1\|3368925_3370182_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NZ_CP040717.1\|WP_005343746.1\|3364402_3365032_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161823.1\|3353933_3355697_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161825.1\|3356276_3356477_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161827.1\|3356745_3357249_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161831.1\|3360046_3360283_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379154
NZ_CP040717.1\|WP_157161822.1\|3353042_3353729_-\|KilA-N-domain-containing-protein	unknown	unknown	gnl\|CDD\|367917
NZ_CP040717.1\|WP_024944628.1\|3362886_3363099_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368385
NZ_CP040717.1\|WP_157161828.1\|3357365_3357950_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161826.1\|3356473_3356689_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161833.1\|3365329_3365539_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161829.1\|3357949_3358168_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_114522673.1\|3362303_3362873_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP040717.1\|WP_157161824.1\|3355809_3356280_-\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|260010
NZ_CP040717.1\|WP_005336352.1\|3370457_3370730_-\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|379202
NZ_CP040717.1\|WP_058057516.1\|3366168_3367512_+\|metalloprotease-PmbA	unknown	unknown	gnl\|CDD\|182922
NZ_CP040717.1\|WP_157161832.1\|3363293_3363980_-\|antirestriction-protein-ArdA	unknown	unknown	gnl\|CDD\|377800
NZ_CP040717.1\|WP_005306001.1\|3370200_3370458_-\|BolA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227340

Protein	Function_ID	Function_description	E-value
NZ_CP040717.1\|WP_157161824.1\|3355809_3356280_-\|ribonuclease-HI	gnl\|CDD\|260010	cd09278, RNase_HI_prokaryote_like, RNase HI family found mainly in prokaryotes. Ribonuclease H (RNase H) is classified into two evolutionarily unrelated families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is involved in DNA replication, repair and transcription. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes and most prokaryotic and eukaryotic genomes contain multiple RNase H genes. Despite the lack of amino acid sequence homology, type 1 and type 2 RNase H share a main-chain fold and steric configurations of the four acidic active-site (DEDD), residues and have the same catalytic mechanism and functions in cells. One of the important functions of RNase H is to remove Okazaki fragments during DNA replication. Prokaryotic RNase H varies greatly in domain structures and substrate specificities. Prokaryotes and some single-cell eukaryotes do not require RNase H for viability.	8.93957e-60
NZ_CP040717.1\|WP_157161830.1\|3358373_3359459_-\|capsid-protein	gnl\|CDD\|177268	PHA00201, PHA00201, major capsid protein.	1.99775e-21
NZ_CP040717.1\|WP_005336355.1\|3368925_3370182_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NZ_CP040717.1\|WP_157161832.1\|3363293_3363980_-\|antirestriction-protein-ArdA	gnl\|CDD\|377800	pfam07275, ArdA, Antirestriction protein (ArdA). This family consists of several bacterial antirestriction (ArdA) proteins. ArdA functions in bacterial conjugation to allow an unmodified plasmid to evade restriction in the recipient bacterium and yet acquire cognate modification.	6.70419e-16
NZ_CP040717.1\|WP_058057516.1\|3366168_3367512_+\|metalloprotease-PmbA	gnl\|CDD\|182922	PRK11040, PRK11040, peptidase PmbA; Provisional.	0
NZ_CP040717.1\|WP_114522673.1\|3362303_3362873_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	3.06167e-55
NZ_CP040717.1\|WP_005336352.1\|3370457_3370730_-\|STAS-domain-containing-protein	gnl\|CDD\|379202	pfam13466, STAS_2, STAS domain. The STAS (after Sulphate Transporter and AntiSigma factor antagonist) domain is found in the C-terminal region of Sulphate transporters and bacterial antisigma factor antagonists. It has been suggested that this domain may have a general NTP binding function.	2.56028e-09
NZ_CP040717.1\|WP_157161831.1\|3360046_3360283_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379154	pfam13384, HTH_23, Homeodomain-like domain.	0.00281938
NZ_CP040717.1\|WP_157161822.1\|3353042_3353729_-\|KilA-N-domain-containing-protein	gnl\|CDD\|367917	pfam04383, KilA-N, KilA-N domain. The amino-terminal module of the D6R/N1R proteins defines a novel, conserved DNA-binding domain (the KilA-N domain) that is found in a wide range of proteins of large bacterial and eukaryotic DNA viruses. The KilA-N domain family also includes the previously defined APSES domain. The KilA-N and APSES domains may also share a common fold with the nucleic acid-binding modules of the LAGLIDADG nucleases and the amino-terminal domains of the tRNA endonuclease.	2.76136e-09
NZ_CP040717.1\|WP_024944628.1\|3362886_3363099_-\|hypothetical-protein	gnl\|CDD\|368385	pfam05321, HHA, Haemolysin expression modulating protein. This family consists of haemolysin expression modulating protein (HHA) homologs. YmoA and Hha are highly similar bacterial proteins downregulating gene expression in Yersinia enterocolitica and Escherichia coli, respectively.	4.56809e-09
NZ_CP040717.1\|WP_005306001.1\|3370200_3370458_-\|BolA-family-transcriptional-regulator	gnl\|CDD\|227340	COG5007, COG5007, Predicted transcriptional regulator, BolA superfamily [Transcription].	2.82789e-38

>NZ_CP040717.1|WP_157161831.1|3360046_3360283_-|helix-turn-helix-domain-containing-protein
MQLKEKRDAAILEKHKEGMSSHKIAALFGMNQKTVSNVISELSKTADSAKLLTPEVSTSAVPMVSTEDRSDTREDARS
>NZ_CP040717.1|WP_157161830.1|3358373_3359459_-|capsid-protein
MSSYGTFPTFQNVTHVGQNNGQGDTRALFMKLFAGEVLTMFRNQCVSLGTTRVMTLKDGKAFDFPVLGMSHNAKYHKPGELIQAGGIKNVLRTVTVDDVAVAAVFVAEQDEDLSTFEVRSHYARELAYELSNMIDKNVFRTIANAAFITNKELAIARFGENGVLDDETFTENITLRATDAAGRPMTRGQQIVDAIYRARTEFRKASVPGIPVCVLKPDDFEALTNAAAGIGNMAWLDKRFLGQTGEDKSNGNADTGLRIAGMKIFESNNLPDQDESNGLIGSPEPLSVEDGGSGRTAAYRGNFSKLLGLVYTKDCAATVKVRDIATKWVPEPLRVGNTVLAKMFVGHNILRPACAVALLEA
>NZ_CP040717.1|WP_157161829.1|3357949_3358168_-|hypothetical-protein
MSAPTTRIAPKKVKSHTTAVLWPDVIPKADALTLHFSKQAGFALTRTQMLNALINREFDKLRSQGELAGEVQ
>NZ_CP040717.1|WP_157161828.1|3357365_3357950_-|hypothetical-protein
MDYQTADYGFSVETYDLPSYSSGVNDQGEALYELDGIEMTKAQAEDFKDYFFDDEDDHSLSQDNDTESLPDTILSGLNAVNDALGGDGVAEFYADELLGLGESRMDSVVSSSGMSREEIQSHATAVMIDMAAQVGMPSDYLMNELQNDINRVRSLNSQSGLKLLREAIADGIAGEYDSAMTKWDRLRRALKSVK
>NZ_CP040717.1|WP_157161827.1|3356745_3357249_-|hypothetical-protein
MNKITIADLSEELLDVINGQRALINKLAELAGLSSGQVRVLQMEASQRHQRAKAAEAKAKANREAYEEDHQQMAAWVYATRFDFNNAKEWNKAAATEWLVICERNGSEHGRDHSFKYHEPTQDELLEALKDLEGWSRATEEHNKDRREHAQRTLPKVKAKLAALLTA
>NZ_CP040717.1|WP_157161826.1|3356473_3356689_-|hypothetical-protein
MTANETFLVHPSDFVKRLQAFATLSLGRRPSTGQVQNAINRYVMQSHGTDRESMLALARELFPTTEQEAAL
>NZ_CP040717.1|WP_157161825.1|3356276_3356477_-|hypothetical-protein
MITIEDWSHIRKAKIRHALFCVAYRRLQGDTFRTACRTTAKRLKLHEPTLRLLARHYIKLTGDNTK
>NZ_CP040717.1|WP_157161824.1|3355809_3356280_-|ribonuclease-HI
MTQPYTYTLATDGACNTNHTKASVRVAGWGFLAVRSDGRKVERCGYCVGAGESNQTGELEAVIQGLSLLKPGSVVEVLTDSAYVINGATQWLAGWKAKGWKRADNKPVQNKDRWEQLDDLLSTRQVTFKKVKGHSGHPMNERADQLAVAGMNRAGH
>NZ_CP040717.1|WP_157161823.1|3353933_3355697_-|hypothetical-protein
MTIRQSGFGSLEPTRQVTAQRYQASVAPAPRQLSGLEKLAEFGMQSLKYKHQIDQEVLQADLSIAVEKYEDAIKGMDPSDFAKDPEGSLKAAGIDDLYGLIEKAPIGRQSEIRKKIDYLRDKTTASMTAAHDTREKVRAAVYNTSNELRATGDVSPEHWESVMALKGEAQQHAIASMAQIAITEGRMELFDRMAQDQRLAPELHDNVEVWKRQAQSMIDAKKREEEAAARRRAIEANKAHKEALKAQRQMAVLGMLSQGTPMEVVMSLAPINDGVKRDEVEWAVRSNPALHRTVAATSVLNTDKHLMEAMFANPVSPDGKTPSQTFQAAANTLQMYLDVRGGVDALEGVGLTKTQRQAVQAALMLSRKSGEDFAGSLYRSLTTATPYMLPVNSADERKRDSEVMAGLNMTQRDAYKREKEGLMHFGLSPAEASEKAAEYVTADTHDANGVTVTGITGVRNMLGETLGVHIEDKVLNEVINTTIDKTLANASSAYFGSNQPLDKWHQFTDMDGTLIFQHKDNFGLMVQVTPDMFKKTASEFKQQDVTYGKDEPSRRTEHADQYERVGAGYPVRKLKEVSSNPFESFFR
>NZ_CP040717.1|WP_157161822.1|3353042_3353729_-|KilA-N-domain-containing-protein
MKITFNGNTYPIRKNAEGLYSLTDIEKAWLAEGNTGGQLDNWKRAPEVTELIELREIHVFQKRGGNRTPDRGTWGCKEAVIEYASYCSNEFRRAVRKAFIALTEGDTMQAAAIAESVAVSPELLEKHDATRKAMNDAIKAKGIDMCGKAYGNFYRLACKAATGYVPSVLTGKNGSAKEYIKQVSNVPCMNALIACMETITMGLKVGLDYHKVAAMLNVETSQNGELLG
>NZ_CP040717.1|WP_114522673.1|3362303_3362873_-|recombinase-family-protein
MGQVIGYARVSSVGQSLDVQLDKLAEAGAEKVYQEKMSGKSAKDRQQLQAMLGYVREGDTVVITKLDRLGRSLADLLAIVEKLEEKGVTLRVLDQTFDTGSAQGRLMLSMLGAFAEFELELRKERQMDGIAKAKEQGKHLGRPKELDEEKVKERLKVGDLSPAGVAKELGIGRSTAYRIAKAMKDEGEL
>NZ_CP040717.1|WP_024944628.1|3362886_3363099_-|hypothetical-protein
MIDLVIRLRRFKSRKSLERVAPRMLDRASSAGLQEELKVIAAIDHRKAEIAAGRLYDAGKVPMTAWALVD
>NZ_CP040717.1|WP_157161832.1|3363293_3363980_-|antirestriction-protein-ArdA
MNIESRAADLRTSIKLMTGDLCYCKTRAQVASLRETIRQREEELKRLEDQAFINRCVAVLDTTGMGEHNVYIHWFRIDYGCWIDAEEVVNAGGLSDYLESLGMEPADVAELMTQDWDCQDAEGLASHCLHKYGSFDWKALEELLEVDCEPEVLAAGLACEIAPEEIQDRYMGSWDSDEDMAMEQWEEGGLLEAIPASARGYIDWQAVARDMELNGEFVRSGTCYFRNC
>NZ_CP040717.1|WP_005343746.1|3364402_3365032_+|hypothetical-protein
MPVSITVSDEIFNRLEKLAIGFDTPERVIERLLDEVDSDSPKSAGARPKLTFTPDETAFKNELLTRKKAQVILHFKDGERDVLHWNAERFQPSSNLRANLWSGFLRGWKEKGIIAAEFSVLPRGSNLPDDDTELRVAIAGEVHWTVEEVDQYFIDVEEVCSDDGFPYYYLATFDEETPAELKKIAGLNSCNQIHLDLNFLPSRDEYEPD
>NZ_CP040717.1|WP_157161833.1|3365329_3365539_-|hypothetical-protein
MKITFDVERIQEALANPEQSGLNDVDLALLPTLLELAGGSNHCVIIDDTRAPKKKRKPRPSRIKRSKRK
>NZ_CP040717.1|WP_157161834.1|3365535_3366090_-|hypothetical-protein
MASPILQHSDQLVATIAKQPVSTFGTHYTKEVALFIARHLNKAQGWAASLYLRTIAEGIGCTTRTVRNSLRRLEAIGFFKTEFRKHAQIANWNLASVYRIGSALLALFRTPSTKRPAKSLTSSKQKQSNKDHAPVSSSVDKFAMFDRKRVNRTPEEWEASQKASQEHNRSALEKLKALFVRGQS
>NZ_CP040717.1|WP_058057516.1|3366168_3367512_+|metalloprotease-PmbA
MDQQDQIRQDQAHLEAVVAEALEIAKGLGASLAEVSISKQTGLSVNTRGCELESIEFNKDGALGIAVYRDGCKGSSSTTDLSKPAIRAAVEAAIEIARHTSADDCAGLADAELLAWDAPDLQLCHQIELDPQRGIELAIECERLALGRDARIKHSDGAGFSSHLGIKVYGNSHGFVKGYAASRNSLSCVLIGEQDGDMQRDYGYSSSRTLDGLWSPQRIADEAVERTVSRLGARKISTRHAPVLFHPDTASGLWGHLVMAISGGNLYRKSSFLLDKLGKQILPEWLTIQEFPHLLGGLASTPFDGEGVRTRDMDIVRNGELMSWLLTSYSARKLGLTTTGHAGGIHNWQVSNTGQDFQGMLKEMGTGLLVTELMGQGVNIVNGDYSRGAAGFWVENGEIAYPVEEITIAGNLAEMFSHIVAVGRDEDERSSLKTGSVLVENMKLAGH
>NZ_CP040717.1|WP_005336355.1|3368925_3370182_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MDKFKIDGRCTLNGEVTISGAKNAALPILFATLLCDEEVHLSNVPRLKDVGTTIKLLEMLGATTKVNGNVTVLTGAVNNHVAPYELVKTMRASILALGPLAARFGAADVSLPGGCAIGARPVNLHVHGLELMGAKITIEDGYIKARVDGRLKGAHILMDMVSVTGTENLMMAATLADGRTVIENAAREPEVVDLANFLNTLGAKIQGAGTDTLTIDGVERLHGGNYSVQPDRIETGTFLVGAAVTGGKITCRKTDPTLLEAVLVKLEEAGALIEKGEDWITLDMTGRTLKPVTIKTAPYPAFPTDMQAQFTVLNAVAKGTGMVTETIFENRFMHVPELVRMGADIELQGNVAICRDTEQLKGAQVMATDLRASASLVLAGFVAEGSTIVDRIYHIDRGYEDIEQKLQGLGGRIERIKG
>NZ_CP040717.1|WP_005306001.1|3370200_3370458_-|BolA-family-transcriptional-regulator
MQVSEIEAILLEALPLSEVHVKGDGSHYQVIAVGDMFDGMSRVKKQQAIYAPLMDKIASNAIHALSIKAFTDAEWKRERKFLLPS
>NZ_CP040717.1|WP_005336352.1|3370457_3370730_-|STAS-domain-containing-protein
MTLSGELQAPQVNDLWQRRAEWWQDDQLELGGVTTLDSAGLALLVKWAKAVLARGATPQLVGASSDFYTLANLYGVAGLFQSTPLTTEDA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040717_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040717_3

3359857-3360004

Orphan

Consensus_repeat	Method
GTGCGTCTTCAGGTCGTCCTCGGG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP040717_3

>merge|NZ_CP040717|3|3359857-3360004|CRISPRCasFinder
GTGCGTCTTCAGGTCGTCCTCGGGCCTGACTTAGAAATTTGTCCCAAGGGCATTTTTCTAAGTGGTGCGTCTTCAGGTCGTCCTCGAGGGTGGTCGGTTTTCGGGATTCCCGATTTCCGACCAGAGTGTCTTCAGGCCGTCCTCGGGG

>NZ_CP040717|3|3|3359857-3360004|CRISPRCasFinder
GTGCGTCTTCAGGTCGTCCTCGGG	CCTGACTTAGAAATTTGTCCCAAGGGCATTTTTCTAAGTG
GTGCGTCTTCAGGTCGTCCTCGAG	GGTGGTCGGTTTTCGGGATTCCCGATTTCCGACCA
GAGTGTCTTCAGGCCGTCCTCGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040717.1\|WP_157161834.1\|3365535_3366090_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161830.1\|3358373_3359459_-\|capsid-protein	unknown	unknown	gnl\|CDD\|177268
NZ_CP040717.1\|WP_005336355.1\|3368925_3370182_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NZ_CP040717.1\|WP_157161829.1\|3357949_3358168_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_005343746.1\|3364402_3365032_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161823.1\|3353933_3355697_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161825.1\|3356276_3356477_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161827.1\|3356745_3357249_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161831.1\|3360046_3360283_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379154
NZ_CP040717.1\|WP_157161822.1\|3353042_3353729_-\|KilA-N-domain-containing-protein	unknown	unknown	gnl\|CDD\|367917
NZ_CP040717.1\|WP_024944628.1\|3362886_3363099_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368385
NZ_CP040717.1\|WP_157161828.1\|3357365_3357950_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161826.1\|3356473_3356689_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161833.1\|3365329_3365539_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040717.1\|WP_157161821.1\|3351498_3352794_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271184
NZ_CP040717.1\|WP_114522673.1\|3362303_3362873_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP040717.1\|WP_157161824.1\|3355809_3356280_-\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|260010
NZ_CP040717.1\|WP_058057516.1\|3366168_3367512_+\|metalloprotease-PmbA	unknown	unknown	gnl\|CDD\|182922
NZ_CP040717.1\|WP_157161832.1\|3363293_3363980_-\|antirestriction-protein-ArdA	unknown	unknown	gnl\|CDD\|377800
NZ_CP040717.1\|WP_005306001.1\|3370200_3370458_-\|BolA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227340

Protein	Function_ID	Function_description	E-value
NZ_CP040717.1\|WP_157161824.1\|3355809_3356280_-\|ribonuclease-HI	gnl\|CDD\|260010	cd09278, RNase_HI_prokaryote_like, RNase HI family found mainly in prokaryotes. Ribonuclease H (RNase H) is classified into two evolutionarily unrelated families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is involved in DNA replication, repair and transcription. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes and most prokaryotic and eukaryotic genomes contain multiple RNase H genes. Despite the lack of amino acid sequence homology, type 1 and type 2 RNase H share a main-chain fold and steric configurations of the four acidic active-site (DEDD), residues and have the same catalytic mechanism and functions in cells. One of the important functions of RNase H is to remove Okazaki fragments during DNA replication. Prokaryotic RNase H varies greatly in domain structures and substrate specificities. Prokaryotes and some single-cell eukaryotes do not require RNase H for viability.	8.93957e-60
NZ_CP040717.1\|WP_157161830.1\|3358373_3359459_-\|capsid-protein	gnl\|CDD\|177268	PHA00201, PHA00201, major capsid protein.	1.99775e-21
NZ_CP040717.1\|WP_005336355.1\|3368925_3370182_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NZ_CP040717.1\|WP_157161832.1\|3363293_3363980_-\|antirestriction-protein-ArdA	gnl\|CDD\|377800	pfam07275, ArdA, Antirestriction protein (ArdA). This family consists of several bacterial antirestriction (ArdA) proteins. ArdA functions in bacterial conjugation to allow an unmodified plasmid to evade restriction in the recipient bacterium and yet acquire cognate modification.	6.70419e-16
NZ_CP040717.1\|WP_157161821.1\|3351498_3352794_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271184	cd01184, INT_C_like_1, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain containing six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	2.41069e-21
NZ_CP040717.1\|WP_058057516.1\|3366168_3367512_+\|metalloprotease-PmbA	gnl\|CDD\|182922	PRK11040, PRK11040, peptidase PmbA; Provisional.	0
NZ_CP040717.1\|WP_114522673.1\|3362303_3362873_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	3.06167e-55
NZ_CP040717.1\|WP_157161831.1\|3360046_3360283_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379154	pfam13384, HTH_23, Homeodomain-like domain.	0.00281938
NZ_CP040717.1\|WP_157161822.1\|3353042_3353729_-\|KilA-N-domain-containing-protein	gnl\|CDD\|367917	pfam04383, KilA-N, KilA-N domain. The amino-terminal module of the D6R/N1R proteins defines a novel, conserved DNA-binding domain (the KilA-N domain) that is found in a wide range of proteins of large bacterial and eukaryotic DNA viruses. The KilA-N domain family also includes the previously defined APSES domain. The KilA-N and APSES domains may also share a common fold with the nucleic acid-binding modules of the LAGLIDADG nucleases and the amino-terminal domains of the tRNA endonuclease.	2.76136e-09
NZ_CP040717.1\|WP_024944628.1\|3362886_3363099_-\|hypothetical-protein	gnl\|CDD\|368385	pfam05321, HHA, Haemolysin expression modulating protein. This family consists of haemolysin expression modulating protein (HHA) homologs. YmoA and Hha are highly similar bacterial proteins downregulating gene expression in Yersinia enterocolitica and Escherichia coli, respectively.	4.56809e-09
NZ_CP040717.1\|WP_005306001.1\|3370200_3370458_-\|BolA-family-transcriptional-regulator	gnl\|CDD\|227340	COG5007, COG5007, Predicted transcriptional regulator, BolA superfamily [Transcription].	2.82789e-38

>NZ_CP040717.1|WP_157161830.1|3358373_3359459_-|capsid-protein
MSSYGTFPTFQNVTHVGQNNGQGDTRALFMKLFAGEVLTMFRNQCVSLGTTRVMTLKDGKAFDFPVLGMSHNAKYHKPGELIQAGGIKNVLRTVTVDDVAVAAVFVAEQDEDLSTFEVRSHYARELAYELSNMIDKNVFRTIANAAFITNKELAIARFGENGVLDDETFTENITLRATDAAGRPMTRGQQIVDAIYRARTEFRKASVPGIPVCVLKPDDFEALTNAAAGIGNMAWLDKRFLGQTGEDKSNGNADTGLRIAGMKIFESNNLPDQDESNGLIGSPEPLSVEDGGSGRTAAYRGNFSKLLGLVYTKDCAATVKVRDIATKWVPEPLRVGNTVLAKMFVGHNILRPACAVALLEA
>NZ_CP040717.1|WP_157161829.1|3357949_3358168_-|hypothetical-protein
MSAPTTRIAPKKVKSHTTAVLWPDVIPKADALTLHFSKQAGFALTRTQMLNALINREFDKLRSQGELAGEVQ
>NZ_CP040717.1|WP_157161828.1|3357365_3357950_-|hypothetical-protein
MDYQTADYGFSVETYDLPSYSSGVNDQGEALYELDGIEMTKAQAEDFKDYFFDDEDDHSLSQDNDTESLPDTILSGLNAVNDALGGDGVAEFYADELLGLGESRMDSVVSSSGMSREEIQSHATAVMIDMAAQVGMPSDYLMNELQNDINRVRSLNSQSGLKLLREAIADGIAGEYDSAMTKWDRLRRALKSVK
>NZ_CP040717.1|WP_157161827.1|3356745_3357249_-|hypothetical-protein
MNKITIADLSEELLDVINGQRALINKLAELAGLSSGQVRVLQMEASQRHQRAKAAEAKAKANREAYEEDHQQMAAWVYATRFDFNNAKEWNKAAATEWLVICERNGSEHGRDHSFKYHEPTQDELLEALKDLEGWSRATEEHNKDRREHAQRTLPKVKAKLAALLTA
>NZ_CP040717.1|WP_157161826.1|3356473_3356689_-|hypothetical-protein
MTANETFLVHPSDFVKRLQAFATLSLGRRPSTGQVQNAINRYVMQSHGTDRESMLALARELFPTTEQEAAL
>NZ_CP040717.1|WP_157161825.1|3356276_3356477_-|hypothetical-protein
MITIEDWSHIRKAKIRHALFCVAYRRLQGDTFRTACRTTAKRLKLHEPTLRLLARHYIKLTGDNTK
>NZ_CP040717.1|WP_157161824.1|3355809_3356280_-|ribonuclease-HI
MTQPYTYTLATDGACNTNHTKASVRVAGWGFLAVRSDGRKVERCGYCVGAGESNQTGELEAVIQGLSLLKPGSVVEVLTDSAYVINGATQWLAGWKAKGWKRADNKPVQNKDRWEQLDDLLSTRQVTFKKVKGHSGHPMNERADQLAVAGMNRAGH
>NZ_CP040717.1|WP_157161823.1|3353933_3355697_-|hypothetical-protein
MTIRQSGFGSLEPTRQVTAQRYQASVAPAPRQLSGLEKLAEFGMQSLKYKHQIDQEVLQADLSIAVEKYEDAIKGMDPSDFAKDPEGSLKAAGIDDLYGLIEKAPIGRQSEIRKKIDYLRDKTTASMTAAHDTREKVRAAVYNTSNELRATGDVSPEHWESVMALKGEAQQHAIASMAQIAITEGRMELFDRMAQDQRLAPELHDNVEVWKRQAQSMIDAKKREEEAAARRRAIEANKAHKEALKAQRQMAVLGMLSQGTPMEVVMSLAPINDGVKRDEVEWAVRSNPALHRTVAATSVLNTDKHLMEAMFANPVSPDGKTPSQTFQAAANTLQMYLDVRGGVDALEGVGLTKTQRQAVQAALMLSRKSGEDFAGSLYRSLTTATPYMLPVNSADERKRDSEVMAGLNMTQRDAYKREKEGLMHFGLSPAEASEKAAEYVTADTHDANGVTVTGITGVRNMLGETLGVHIEDKVLNEVINTTIDKTLANASSAYFGSNQPLDKWHQFTDMDGTLIFQHKDNFGLMVQVTPDMFKKTASEFKQQDVTYGKDEPSRRTEHADQYERVGAGYPVRKLKEVSSNPFESFFR
>NZ_CP040717.1|WP_157161822.1|3353042_3353729_-|KilA-N-domain-containing-protein
MKITFNGNTYPIRKNAEGLYSLTDIEKAWLAEGNTGGQLDNWKRAPEVTELIELREIHVFQKRGGNRTPDRGTWGCKEAVIEYASYCSNEFRRAVRKAFIALTEGDTMQAAAIAESVAVSPELLEKHDATRKAMNDAIKAKGIDMCGKAYGNFYRLACKAATGYVPSVLTGKNGSAKEYIKQVSNVPCMNALIACMETITMGLKVGLDYHKVAAMLNVETSQNGELLG
>NZ_CP040717.1|WP_157161821.1|3351498_3352794_+|tyrosine-type-recombinase/integrase
MKHLVKKANRYYIHWNIPKDVRHLFDGLAIYSRSLKTDNLGQAIMRRDQLLAELEGVVRKARVNPERQQFLALVKEIRKAAGEPPIEQDEENIEEAWSTELQVAIEKGDTVRADAIRAAMGWGAEGIEAKYGITLMEATKLYTETTEESLDPSTLSRLNLAPVSFASFLKLKDIHLADIDKRDVIAWVLECAKDKAPRTVKAYATCLSKVWDWAYRSKEVSGENPFKDLDIRLTSSGTKRTAFTVEQVAALLEGAGPAMYSLMKFALVTGCRLGELVTITAADFHETDGVHYFTIKDGKTANAARNVPLPVALWEELKAVVESELWTRTETRTRPSSAQYWSVMFQKHKDAVLGDQCSAVFHSFRKMAATGYQRAQVFEGIAAGILGHSRKGLTLSYGLYATGFELQQQLEAVETMLASDYMSQFLKLFNK
>NZ_CP040717.1|WP_157161831.1|3360046_3360283_-|helix-turn-helix-domain-containing-protein
MQLKEKRDAAILEKHKEGMSSHKIAALFGMNQKTVSNVISELSKTADSAKLLTPEVSTSAVPMVSTEDRSDTREDARS
>NZ_CP040717.1|WP_114522673.1|3362303_3362873_-|recombinase-family-protein
MGQVIGYARVSSVGQSLDVQLDKLAEAGAEKVYQEKMSGKSAKDRQQLQAMLGYVREGDTVVITKLDRLGRSLADLLAIVEKLEEKGVTLRVLDQTFDTGSAQGRLMLSMLGAFAEFELELRKERQMDGIAKAKEQGKHLGRPKELDEEKVKERLKVGDLSPAGVAKELGIGRSTAYRIAKAMKDEGEL
>NZ_CP040717.1|WP_024944628.1|3362886_3363099_-|hypothetical-protein
MIDLVIRLRRFKSRKSLERVAPRMLDRASSAGLQEELKVIAAIDHRKAEIAAGRLYDAGKVPMTAWALVD
>NZ_CP040717.1|WP_157161832.1|3363293_3363980_-|antirestriction-protein-ArdA
MNIESRAADLRTSIKLMTGDLCYCKTRAQVASLRETIRQREEELKRLEDQAFINRCVAVLDTTGMGEHNVYIHWFRIDYGCWIDAEEVVNAGGLSDYLESLGMEPADVAELMTQDWDCQDAEGLASHCLHKYGSFDWKALEELLEVDCEPEVLAAGLACEIAPEEIQDRYMGSWDSDEDMAMEQWEEGGLLEAIPASARGYIDWQAVARDMELNGEFVRSGTCYFRNC
>NZ_CP040717.1|WP_005343746.1|3364402_3365032_+|hypothetical-protein
MPVSITVSDEIFNRLEKLAIGFDTPERVIERLLDEVDSDSPKSAGARPKLTFTPDETAFKNELLTRKKAQVILHFKDGERDVLHWNAERFQPSSNLRANLWSGFLRGWKEKGIIAAEFSVLPRGSNLPDDDTELRVAIAGEVHWTVEEVDQYFIDVEEVCSDDGFPYYYLATFDEETPAELKKIAGLNSCNQIHLDLNFLPSRDEYEPD
>NZ_CP040717.1|WP_157161833.1|3365329_3365539_-|hypothetical-protein
MKITFDVERIQEALANPEQSGLNDVDLALLPTLLELAGGSNHCVIIDDTRAPKKKRKPRPSRIKRSKRK
>NZ_CP040717.1|WP_157161834.1|3365535_3366090_-|hypothetical-protein
MASPILQHSDQLVATIAKQPVSTFGTHYTKEVALFIARHLNKAQGWAASLYLRTIAEGIGCTTRTVRNSLRRLEAIGFFKTEFRKHAQIANWNLASVYRIGSALLALFRTPSTKRPAKSLTSSKQKQSNKDHAPVSSSVDKFAMFDRKRVNRTPEEWEASQKASQEHNRSALEKLKALFVRGQS
>NZ_CP040717.1|WP_058057516.1|3366168_3367512_+|metalloprotease-PmbA
MDQQDQIRQDQAHLEAVVAEALEIAKGLGASLAEVSISKQTGLSVNTRGCELESIEFNKDGALGIAVYRDGCKGSSSTTDLSKPAIRAAVEAAIEIARHTSADDCAGLADAELLAWDAPDLQLCHQIELDPQRGIELAIECERLALGRDARIKHSDGAGFSSHLGIKVYGNSHGFVKGYAASRNSLSCVLIGEQDGDMQRDYGYSSSRTLDGLWSPQRIADEAVERTVSRLGARKISTRHAPVLFHPDTASGLWGHLVMAISGGNLYRKSSFLLDKLGKQILPEWLTIQEFPHLLGGLASTPFDGEGVRTRDMDIVRNGELMSWLLTSYSARKLGLTTTGHAGGIHNWQVSNTGQDFQGMLKEMGTGLLVTELMGQGVNIVNGDYSRGAAGFWVENGEIAYPVEEITIAGNLAEMFSHIVAVGRDEDERSSLKTGSVLVENMKLAGH
>NZ_CP040717.1|WP_005336355.1|3368925_3370182_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MDKFKIDGRCTLNGEVTISGAKNAALPILFATLLCDEEVHLSNVPRLKDVGTTIKLLEMLGATTKVNGNVTVLTGAVNNHVAPYELVKTMRASILALGPLAARFGAADVSLPGGCAIGARPVNLHVHGLELMGAKITIEDGYIKARVDGRLKGAHILMDMVSVTGTENLMMAATLADGRTVIENAAREPEVVDLANFLNTLGAKIQGAGTDTLTIDGVERLHGGNYSVQPDRIETGTFLVGAAVTGGKITCRKTDPTLLEAVLVKLEEAGALIEKGEDWITLDMTGRTLKPVTIKTAPYPAFPTDMQAQFTVLNAVAKGTGMVTETIFENRFMHVPELVRMGADIELQGNVAICRDTEQLKGAQVMATDLRASASLVLAGFVAEGSTIVDRIYHIDRGYEDIEQKLQGLGGRIERIKG
>NZ_CP040717.1|WP_005306001.1|3370200_3370458_-|BolA-family-transcriptional-regulator
MQVSEIEAILLEALPLSEVHVKGDGSHYQVIAVGDMFDGMSRVKKQQAIYAPLMDKIASNAIHALSIKAFTDAEWKRERKFLLPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040717_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040717_5

3689746-3689851

Orphan

Consensus_repeat	Method
ACTAAACGCCAAGGTTTGATCCGAATGAAATCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040717_5

>merge|NZ_CP040717|5|3689746-3689851|CRISPRCasFinder
ACTAAACGCCAAGGTTTGATCCGAATGAAATCTGCATATGCGAGCGACGATGGCGCTGGCCGTTTTATCTGTACTAAACGCTAAGGTTTGATCCGAATGAAATCTG

>NZ_CP040717|5|5|3689746-3689851|CRISPRCasFinder
ACTAAACGCCAAGGTTTGATCCGAATGAAATCTG	CATATGCGAGCGACGATGGCGCTGGCCGTTTTATCTGT
ACTAAACGCTAAGGTTTGATCCGAATGAAATCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040717.1\|WP_111900214.1\|3697911_3698730_-\|Cof-type-HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|182523
NZ_CP040717.1\|WP_005335735.1\|3685413_3686103_+\|protein-TolQ	unknown	unknown	gnl\|CDD\|131843
NZ_CP040717.1\|WP_005335728.1\|3687783_3689109_+\|Tol-Pal-system-protein-TolB	unknown	unknown	gnl\|CDD\|235312
NZ_CP040717.1\|WP_005343224.1\|3701718_3702036_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225653
NZ_CP040717.1\|WP_005335737.1\|3685016_3685424_+\|tol-pal-system-associated-acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|274304
NZ_CP040717.1\|WP_157161954.1\|3694725_3696039_-\|sodium-dependent-transporter	unknown	unknown	gnl\|CDD\|271367
NZ_CP040717.1\|WP_005335733.1\|3686102_3686549_+\|protein-TolR	unknown	unknown	gnl\|CDD\|274306
NZ_CP040717.1\|WP_005335740.1\|3684665_3684911_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370577
NZ_CP040717.1\|WP_013723471.1\|3686554_3687688_+\|cell-envelope-integrity-protein-TolA	unknown	unknown	gnl\|CDD\|368950
NZ_CP040717.1\|WP_005335743.1\|3681777_3683334_+\|cytochrome-bd-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|185052
NZ_CP040717.1\|WP_157161952.1\|3692258_3693572_-\|sodium-dependent-transporter	unknown	unknown	gnl\|CDD\|271367
NZ_CP040717.1\|WP_005304908.1\|3689158_3689683_+\|peptidoglycan-associated-lipoprotein-Pal	unknown	unknown	gnl\|CDD\|182744
NZ_CP040717.1\|WP_157161955.1\|3696249_3697089_-\|isopenicillin-N-synthase-family-oxygenase	unknown	unknown	gnl\|CDD\|226022
NZ_CP040717.1\|WP_157161956.1\|3698840_3700070_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP040717.1\|WP_005335741.1\|3683345_3684482_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|184965
NZ_CP040717.1\|WP_157161957.1\|3700176_3700800_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225222
NZ_CP040717.1\|WP_005304933.1\|3684496_3684613_+\|cytochrome-bd-I-oxidase-subunit-CydX	unknown	unknown	gnl\|CDD\|227227
NZ_CP040717.1\|WP_005304871.1\|3701111_3701588_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP040717.1\|WP_005362971.1\|3697296_3697860_+\|DUF2799-domain-containing-protein	unknown	unknown	gnl\|CDD\|378521
NZ_CP040717.1\|WP_157161953.1\|3694002_3694722_+\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270422

Protein	Function_ID	Function_description	E-value
NZ_CP040717.1\|WP_111900214.1\|3697911_3698730_-\|Cof-type-HAD-IIB-family-hydrolase	gnl\|CDD\|182523	PRK10530, PRK10530, pyridoxal phosphate (PLP) phosphatase; Provisional.	9.79391e-82
NZ_CP040717.1\|WP_005335735.1\|3685413_3686103_+\|protein-TolQ	gnl\|CDD\|131843	TIGR02796, Protein_TolQ, TolQ protein. TolQ is one of the essential components of the Tol-Pal system. Together with TolR, it harnesses protonmotive force to energize TolA, which spans the periplasm to reach the complex of TolB and Pal at the outer member. The tol-pal system proves to be important for maintaining outer membrane integrity. Gene pairs similar to the TolQ and TolR gene pair often number several per genome, but this model describes specificially TolQ per se, as found in tol-pal operons. A close homolog, excluded from this model, is ExbB of the ExbB/ExbD/TonB protein complex, which powers transport of siderophores and vitamin B12 across the bacterial outer membrane. The Tol-Pal system is exploited by colicin and filamentous phage DNA to enter the cell. It is also implicated in pathogenesis in several bacterial species [Transport and binding proteins, Other, Cellular processes, Pathogenesis].	3.85704e-106
NZ_CP040717.1\|WP_005335728.1\|3687783_3689109_+\|Tol-Pal-system-protein-TolB	gnl\|CDD\|235312	PRK04792, tolB, Tol-Pal system protein TolB.	0
NZ_CP040717.1\|WP_005343224.1\|3701718_3702036_-\|hypothetical-protein	gnl\|CDD\|225653	COG3111, COG3111, Periplasmic protein with OB-fold [Function unknown].	0.00140439
NZ_CP040717.1\|WP_005335737.1\|3685016_3685424_+\|tol-pal-system-associated-acyl-CoA-thioesterase	gnl\|CDD\|274304	TIGR02799, Acyl-CoA_thioesterase_YbgC, tol-pal system-associated acyl-CoA thioesterase. The tol-pal system consists of five critical genes. Inner membrane proteins TolQ and TolR convert protomotive force to energy that is transduced through TolA to an outer membrane complex of TolB and Pal. The system is known to be required to maintain outer membrane integrity. In a system with several homologous parts, ExbB and ExbD transduces energy through TonB to a variety of outer membrane proteins, many of which are siderophore receptors. The tol-pal system therefore may also be involved in transport. This family consists of a protein nearly always found in operons with the genes of the tol-pal system. The significance of this thioesterase to the tol-pal system is unclear, but either of two observations may be relevant. First, Pal, or peptidoglycan-associated lipoprotein, has a conserved N-terminal cleavage and acylation that makes it a lipoprotein. Second, the tol-pal system is implicated not only in the import of certain organics but also in the maintenance of outer membrane integrity (by an unknown mechanism).	4.63634e-55
NZ_CP040717.1\|WP_157161954.1\|3694725_3696039_-\|sodium-dependent-transporter	gnl\|CDD\|271367	cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain. SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, involved in regulating neurotransmitter signaling and homeostasis, and the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter. An arrangement of 12 transmembrane (TM) helices appears to be as a common topological motif for eukaryotic and some prokaryotic and archaeal NTTs. However, this subfamily which contains the majority of bacterial members and some archaeal members, appears to contain only 11 TMs; for example the functional Fusobacterium nucleatum tyrosine transporter Tyt1.	2.62633e-164
NZ_CP040717.1\|WP_005335733.1\|3686102_3686549_+\|protein-TolR	gnl\|CDD\|274306	TIGR02801, Protein_TolR, TolR protein. The model describes the inner membrane protein TolR, part of the TolR/TolQ complex that transduces energy from the proton-motive force, through TolA, to an outer membrane complex made up of TolB and Pal (peptidoglycan-associated lipoprotein). The complex is required to maintain outer membrane integrity, and defects may cause a defect in the import of some organic compounds in addition to the resulting morphologic. While several gene pairs homologous to talR and tolQ may be found in a single genome, but the scope of this model is set to favor finding only bone fide TolR, supported by operon structure as well as by score. [Transport and binding proteins, Other, Cellular processes, Pathogenesis].	9.04242e-42
NZ_CP040717.1\|WP_005335740.1\|3684665_3684911_+\|hypothetical-protein	gnl\|CDD\|370577	pfam09600, Cyd_oper_YbgE, Cyd operon protein YbgE (Cyd_oper_YbgE). This entry describes a small protein of unknown function, about 100 amino acids in length, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It appears to be an integral membrane protein. It is found so far only in the Proteobacteria.	1.50037e-14
NZ_CP040717.1\|WP_013723471.1\|3686554_3687688_+\|cell-envelope-integrity-protein-TolA	gnl\|CDD\|368950	pfam06519, TolA, TolA C-terminal. This family consists of several bacterial TolA proteins as well as two eukaryotic proteins of unknown function. Tol proteins are involved in the translocation of group A colicins. Colicins are bacterial protein toxins, which are active against Escherichia coli and other related species (See pfam01024). TolA is anchored to the cytoplasmic membrane by a single membrane spanning segment near the N-terminus, leaving most of the protein exposed to the periplasm.	1.87806e-20
NZ_CP040717.1\|WP_005335743.1\|3681777_3683334_+\|cytochrome-bd-oxidase-subunit-I	gnl\|CDD\|185052	PRK15097, PRK15097, cytochrome bd-I ubiquinol oxidase subunit CydA.	0
NZ_CP040717.1\|WP_157161952.1\|3692258_3693572_-\|sodium-dependent-transporter	gnl\|CDD\|271367	cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain. SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, involved in regulating neurotransmitter signaling and homeostasis, and the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter. An arrangement of 12 transmembrane (TM) helices appears to be as a common topological motif for eukaryotic and some prokaryotic and archaeal NTTs. However, this subfamily which contains the majority of bacterial members and some archaeal members, appears to contain only 11 TMs; for example the functional Fusobacterium nucleatum tyrosine transporter Tyt1.	4.41132e-165
NZ_CP040717.1\|WP_005304908.1\|3689158_3689683_+\|peptidoglycan-associated-lipoprotein-Pal	gnl\|CDD\|182744	PRK10802, PRK10802, peptidoglycan-associated lipoprotein Pal.	3.5678e-77
NZ_CP040717.1\|WP_157161955.1\|3696249_3697089_-\|isopenicillin-N-synthase-family-oxygenase	gnl\|CDD\|226022	COG3491, PcbC, Isopenicillin N synthase and related dioxygenases [General function prediction only].	1.64783e-39
NZ_CP040717.1\|WP_157161956.1\|3698840_3700070_-\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.32124e-41
NZ_CP040717.1\|WP_005335741.1\|3683345_3684482_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|184965	PRK15003, PRK15003, cytochrome d ubiquinol oxidase subunit II.	7.4003e-160
NZ_CP040717.1\|WP_157161957.1\|3700176_3700800_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|225222	COG2345, COG2345, Predicted transcriptional regulator [Transcription].	1.89317e-58
NZ_CP040717.1\|WP_005304933.1\|3684496_3684613_+\|cytochrome-bd-I-oxidase-subunit-CydX	gnl\|CDD\|227227	COG4890, COG4890, Predicted outer membrane lipoprotein [Function unknown].	9.94001e-13
NZ_CP040717.1\|WP_005304871.1\|3701111_3701588_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	3.22775e-48
NZ_CP040717.1\|WP_005362971.1\|3697296_3697860_+\|DUF2799-domain-containing-protein	gnl\|CDD\|378521	pfam10973, DUF2799, Protein of unknown function (DUF2799). Some members in this family of proteins are annotated as yfiL which has no known function.	2.14062e-28
NZ_CP040717.1\|WP_157161953.1\|3694002_3694722_+\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270422	cd13704, PBP2_HisK, The periplasmic sensor domain of histidine kinase receptors; the type 2 periplasmic binding fold protein. This subfamily includes the periplasmic sensor domain of the histidine kinase receptors (HisK) which are elements of the two-component signal transduction systems commonly found in bacteria and lower eukaryotes. Typically, the two-component system consists of a membrane-spanning histidine kinase sensor and a cytoplasmic response regulator. The two-component systems serve as a stimulus-response coupling mechanism to enable microorganisms to sense and respond to changes in environmental conditions. Extracellular stimuli such as small molecule ligands and ions are detected by the N-terminal periplasmic sensing domain of the sensor kinase receptor, which regulate the catalytic activity of the cytoplasmic kinase domain and promote ATP-dependent autophosphorylation of a conserved histidine residue. The phosphate is then transferred to a conserved aspartate in the response regulator through a phospho-transfer mechanism, and the activity of the response regulator is in turn regulated. The sensor domain belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space through their function as an initial high-affinity binding component. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.88098e-14

>NZ_CP040717.1|WP_005304908.1|3689158_3689683_+|peptidoglycan-associated-lipoprotein-Pal
MQLNKLLKGLAIALPLFTLAACSSSSDSDAAGAESGMTDGMGGVQTGGANGMLSPEEQMRQKFEALQRDNVIYFPFDGYDIQGQYADLLDAHASYLRERPSVKVLIEGHADERGTPEYNIALGERRAKAVAKYLQTLGVQAEQLSIVSYGEEKPLDMSHTEDAFAKNRRAVLVY
>NZ_CP040717.1|WP_005335728.1|3687783_3689109_+|Tol-Pal-system-protein-TolB
MIRKVFFALVGCLLLGQSAQAALDIVITGGIDSARPIAVAPFKWEGNGQLPQDIAEVVSNDLMRSGKFKPLARGQMPQTPSSSSEINFAPWASQGVEAVVVGSISAVGDGTYKVNFELVDVLKGQLAKAQGGESNGYILDSRMATIPGAQMRQFAHRISDIVYERLTGERGAFLTRLAYVSVQQGTQFPYQLRISDYDGYNEKTLLRSREPLMSPAWSPDGSKLAYVSFENQKSEIYVQDIYTQQRSLITSFRGINGAPEWSPDGRRLAIVLSKDGSPNLYVVDVASKQLTRVTTSRVIDTEPSWMPDGQNLLFTSERGGKPQIYSVNLATGMTRRMTWEGESNQGASITPDGKIMVMVTRVQGQYRIARQDMENNALLVLTQSALDESPSVAPNGSMIIYATIYQGRKSLALVSTDGRFKAVLPTSSGEIRAPAWSPFLN
>NZ_CP040717.1|WP_013723471.1|3686554_3687688_+|cell-envelope-integrity-protein-TolA
MDVKRGISGYLIASFLLHLIIGIILFVGLDFSKPKRPESKGQIVNAVMLDENFLNEQAKQIQQQKSQPKPQKVEKEKDKEDTDLAKRELAQKQEQLRIAETKRKQAEEATRKAEAEKQKKVAEQKQAEEKAQKAEEARKLEEQKAKKAEAERKAAEAESKALALKKKKEQEKKEAEEKAKAAEAKAKKAEADKKAKAEAEKKAKAEAEKKAKAEAEKKAKEEAEKKAKADAEKKAKAEAEKQAKIAAERKRKAAEQAKLQKEMEEMMQQQLSAEANARSQAASAAAQGEVDKYAALIKATVERYMILDPTMRGKTCTIGVRLASSGFVISVDNGQGDPAVCRSGKAAVLKANQLPVPKDPAAFEMLKEFNLKLEPSI
>NZ_CP040717.1|WP_005335733.1|3686102_3686549_+|protein-TolR
MQTYQRIRRKKVAEINVVPYIDVMLVLLIIFMAVTPVITQGVKVDLPQAESEQLPEDAKPPFIVSVNTEGEYVIKAGEADDEPVPSGTPEAMQQYITEKAMGYLAINQNAPVVVAGDKAVRYEEVILLMVALKNAGVPQVGLMTDPVN
>NZ_CP040717.1|WP_005335735.1|3685413_3686103_+|protein-TolQ
MHAEISFIGLFWQASLLVKLVMMTLMSMSIVSWALIIQRSKAIKAANLASEQFEDRFWSGVDLNRLYQESSSRRDDIEGMEDIFYSGFKEYARLLKAGARGQDAVMDGTYRAMRVSLSRAVDDLESNLPVLATIGSISPYIGLFGTVWGIMNAFIALGQVQQATLQMVAPGIAEALIATAMGLFAAIPAVIFYNRFSNKVERLENAYANFMDEFTTILNRQIAQQQGDQ
>NZ_CP040717.1|WP_005335737.1|3685016_3685424_+|tol-pal-system-associated-acyl-CoA-thioesterase
MGEVFEFPVRVYYEDTDAGGIVYNANYLKFMERARTEFLRAKGVEQDVWLQEGYAFVVSRTEIDFRSAARFNELLNVLTQVIEVKRASLRFSQQILAADGRLITQAMVQIACVSHPQMKPVAIPEKIKGVLLSAR
>NZ_CP040717.1|WP_005335740.1|3684665_3684911_+|hypothetical-protein
MLLAAALLAVAILQAPNLIAANTSEHGLWLAPWLMWAVCCGVLNGLGFHLKSLPGRVLFNPWLAWPSLLYGLWLTHSYFLS
>NZ_CP040717.1|WP_005304933.1|3684496_3684613_+|cytochrome-bd-I-oxidase-subunit-CydX
MWYFTWILGLLLACAFGIINALWLEHTENMDRQIDENK
>NZ_CP040717.1|WP_005335741.1|3683345_3684482_+|cytochrome-d-ubiquinol-oxidase-subunit-II
MFDYETLRVIWWALVGVLLIGFAITDGFDMGVGALLPFVGKKDVERRVMLNTMGPHWEGNQVWLVTAGGALFAAWPMVYAATFSGFYIAMILTLMALFLRPVGFKYRSLRADAKWRSNWDWALFAGSAVPPIVFGVAFGNLLQGVPFEFNQFMMLTYHGNFFGLLNPFGILAGLVSLFMLLTQGATWLMMKTDGEVLARSRTAAMICSLLTLVLFAAAGWWVSGMEGYVIVKAAATDAVSNPMNKEVVLQAGAWMNNYTLYPWMVAAPVLGLAMSLLTALFARMNIGWLAFTSSSLAIAGVILTAGFSMFPFVMPSSLEPSLSLTMWDATASFNTLQVMTVAAAIFVPIVLGYTIWTYIKMFGRVTNKHIEDNQQSLY
>NZ_CP040717.1|WP_005335743.1|3681777_3683334_+|cytochrome-bd-oxidase-subunit-I
MIAEHVVDLSRFQFAATALYHFLFVPLTLGMAFLLAIMESVYVMTNNTIYRDMTKFWGKLFGINFALGVTTGLAMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFVGMFFFGWDRLSKHQHLAATWLMALGTNLSALWILVANGWMQNPVGAEFNFESMRMEMMSFADVVLNPVAQVKFVHTVAAGYTCGAMFVLGISSYYLLKNRDVAFARRSFAIAAAFGMASIVSVLILGDESGYETGEVQKVKLAAIEAEWETEPAPAAFTLFGIPNQEEMRTDYAIKIPYALGIIATRSLDGQVTGLKDLKSEHELRVRNGMTAYDLLTKLQSGDKSDETRARFDEVKQDLGYGLLLKRYTSNVTDATDEQIKAAVDDSIPQVLPLFFAFRIMVAVGMLMLVLIGMAFYDSARHQIGKRKWLLKGLLWGIPLPWIAIEAGWFVAEYGRQPWTIAEVLPTSLSASNLPAAEIWFSLIGICLFYTVLLVIEMYLMFKYARLGPSSLKTGKYHFEQIKA
>NZ_CP040717.1|WP_157161952.1|3692258_3693572_-|sodium-dependent-transporter
MSQVQWSSRLGHVLAAAGTAIGLGAIWKFPYVTATNGGGAFLLVFLLFSFTLGVAVQVGETLLGSHSQRGVLGAFRKLVGPNWRWMGYMGIACGFFIYSFYSVVGGWTVGYAALAMAGKLNLSEGSALTALFNGYVSNPWWPVLTHLVFAGLTWWFVQGGIQKGVERALRWMMPALFIMMLLLVGVGLSMPGSMAGVRQLLLPDFSMLTGQSVLDALGLAFFSLSIGLGVHTTYGAYLPNSEGVLRSGVWVVTLASLISVLAGLMIFPALASTGIDPTAGPGLTFMTMPAVFSHLPFGQGLGVVFFLLLLVAALSSSISMLEHLVRFTTEEWGWSRRGACRVLTLLIMASGIPVSLSFGPWSDLTLFGKTIFEQLDYLTSNLMMPLFGLVLTLLLGWRLGDAILPVGLSPALRLALLWCWRVVAPLLICGILIRGIM
>NZ_CP040717.1|WP_157161953.1|3694002_3694722_+|transporter-substrate-binding-domain-containing-protein
MRWMVLPWLLICLSVSAQPGLTLLSHDLPPFTEYRDGKLDGFAIRLIDEVQEELGTRYPVRIYPLKRALALARVEPGYGLFVVQRLPERESHFKWVGPLFINRVFIYQAPDSRHPLTSLAQLRDLPRVGVVLGNADDVRLTHEGYTNLVRYKTVGEAIERLMLGKIDALPMAELVMEATLDKMGLSRRSIVSSGVLLHQAGLYIVFSKGTDDAEITRWQHALEAVRAAQGRADEPTREE
>NZ_CP040717.1|WP_157161954.1|3694725_3696039_-|sodium-dependent-transporter
MKQSQWSSRLGYILAAAGSAVGIGAIWKFPYVTAVNGGGAFLLVFLLFSFTLGVAVLMGETLLGSMSRRGVVGAFSDLLGKQWRWVGVMGVISTLLIYCFYSVVGGWTLGYTGMAISGQLNHGDAAALTARFNDYVSGDVWPILTHLLFAALTWMVVQGGIQKGVERTLRWMMPALFLMILMLVAFGLTLPNAMAGVRHFLMPDFSKLGMSGVLDAMGLAFFSLSIGLGIHTTYGAYLPTSEGVGRSSLWVVLLASMVAVLAGLMIFPVLASTGIDPASGPGLTFMTMPAVFQLLPFGQVLEVIFFALLVFAALSSAISLLEHLQCFLCETWGWSRRTACSAITGFVMASGVPVSLSFGPLQHATLFGKTIFELLDFVTSNLMMPLFGLMLTLLLGWKLGRKALPQGIASHWHHLLMNCWRWIAPLLIGGILIRGLV
>NZ_CP040717.1|WP_157161955.1|3696249_3697089_-|isopenicillin-N-synthase-family-oxygenase
MKVLTVDYRSPDAAQRFTESLRTTGFGVLTNHPIPKELVQSIYDNWYRFFISEQKQDFLFNRETQDGYFPPSVSEVAKGHSQKDIKEYFHIYPWGQMPEELKEQAMEYYRLANGLAAELLGWVEQYTPADIAANYSCPLSSMIEESQKTLLRVLHYPPFDGTEEPGAIRAAAHEDINLLTILPAANEPGLQVKGSDGEWMDVPCDFGTLIINIGDMLQEASRGYYPSTTHRVINPTGGSAAKSRISLPLFLHPRPDVVLSERHTAHSYLMERLRELGVI
>NZ_CP040717.1|WP_005362971.1|3697296_3697860_+|DUF2799-domain-containing-protein
MSPKILLLTLPVLLAGCSALSEDECRTMSWYNLGYQDGSEGKTRQATRDYVSSCSEYGLKVDEAEWKRGYDKGLELYCIPELAYSKGKEGQAYLGVCPNDASFLKQYQRGYEEYKLAARLREISDELERTERDIDTLERSIRNETNTEQRDYYRAKRDRAIRHYESLRREYNRLRYPDRVIQFSFGG
>NZ_CP040717.1|WP_111900214.1|3697911_3698730_-|Cof-type-HAD-IIB-family-hydrolase
MSEYKAIALDMDGTLLTRDHKISSATRAALAQARAHGIKVLLVTGRHYMTARPFHHELALDTPLICSNGAYLYDPVQNRILSGDPLAAAPLTELLAAVEAQQMGALFHLSEGIGYIGCEEHVTRIRHWSANQPDHLKIALHPVEELAGWLDNPVWKLELFNQDPARLHTFMGEVVEQMPFTRDWAAPYAVELVQPGCSKGNRLAQWAASEGIAMEQVVAFGDNNNDISMFEQVGLAVAMGNAAPQIQSHAHRVTADHNEDGIALALQRWVLP
>NZ_CP040717.1|WP_157161956.1|3698840_3700070_-|MFS-transporter
MEKYGHKNPLWVLVMTVTLAVAGFSLPSPVLAPLLLDPAHGMLTPDASDWSRKVWLGVIMGLYPLFQLVGSPWLGRLSDRYGRKPLLLLSLAGVLAGYALMALGIAWCSLPLLLLSRVVEGLCNGNIAIVQAMAADLAGKEHKTRSFAWINIGMNLGWVVGPMIGGYAAVISGDYSLAAWLAVGMTLLNLLLVYWLIPYRPPVAVARQTATLSSRQLLLQPALLPYFALTLISYGAVQLYFTYFNIWLVERLAWDPAQLAQAAVLVSLPMMAGSWLGSRIARHWRGSSLGIVGHLMMASGMLLFILPVHWWGLALTFVPAGIGMSLGELATSVAISNRSHPEQQGQAMGLYRALAVGSEILAVLLGSLVLLAGTEWPFYLATLCSLASAAGFYLLRRRADRRQQLASCT
>NZ_CP040717.1|WP_157161957.1|3700176_3700800_+|MarR-family-transcriptional-regulator
MNASTDKILFLLKSHGPQSAAALGEQLQMTSMGARQHLLALEQEGWVTFSDEARGRGRPVRLWQLTEQAWQRFPDTHSDLTVQLIDNVRELFGEEGMERLILQREQQMLARYQEALGNKGLSGRLEALRELRSREGYMAEIRREEDGSWLLWESHCPICAAARTCLGFCRSELVLFRQLLAPATVEREQYLLEGAHRCLYRITPPAL
>NZ_CP040717.1|WP_005304871.1|3701111_3701588_+|Lrp/AsnC-family-transcriptional-regulator
MLKLDRIDRHILELMQENGRISNLELAELVGLSPSPCSRRVKALEDAGLIDTHVTLLNARQLGLTLTAYIHISMDRHTPERFENFDRAISELPEVLECDLITGNDADYQLKVVVRDMEHYQHFLLDKLTHIPGVTGVRSSFVLRRIKHKTALPLNHLG
>NZ_CP040717.1|WP_005343224.1|3701718_3702036_-|hypothetical-protein
MQTSIVGLSILWGLASFGVQGDFIESRDSVAPSWQAESRVEMEGYLIESLGEDRWLFDNGSESLLVSLPEGQWVPTGERLRVSGEPQQEQSGWLLQVEDISQVSV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP040717_1	1.3\|1668114\|19\|NZ_CP040717\|CRISPRCasFinder	1668114-1668132	19	NZ_CP040717.1	1668141-1668159	0	1.0
NZ_CP040717_1	1.3\|1668114\|19\|NZ_CP040717\|CRISPRCasFinder	1668114-1668132	19	NZ_CP040717.1	1668150-1668168	0	1.0
NZ_CP040717_1	1.3\|1668114\|19\|NZ_CP040717\|CRISPRCasFinder	1668114-1668132	19	NZ_CP040717.1	3345570-3345588	1	0.947

1. spacer 1.3|1668114|19|NZ_CP040717|CRISPRCasFinder matches to position: 1668141-1668159, mismatch: 0, identity: 1.0

ggcaggtgcggcaggtgcg	CRISPR spacer
ggcaggtgcggcaggtgcg	Protospacer
*******************

2. spacer 1.3|1668114|19|NZ_CP040717|CRISPRCasFinder matches to position: 1668150-1668168, mismatch: 0, identity: 1.0

ggcaggtgcggcaggtgcg	CRISPR spacer
ggcaggtgcggcaggtgcg	Protospacer
*******************

3. spacer 1.3|1668114|19|NZ_CP040717|CRISPRCasFinder matches to position: 3345570-3345588, mismatch: 1, identity: 0.947

ggcaggtgcggcaggtgcg	CRISPR spacer
ggcaggtgcggcaggggcg	Protospacer
*************** ***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP040717_1	1.3\|1668114\|19\|NZ_CP040717\|CRISPRCasFinder	1668114-1668132	19	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1541743-1541761	1.0
NZ_CP040717_1	1.3\|1668114\|19\|NZ_CP040717\|CRISPRCasFinder	1668114-1668132	19	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1541878-1541896	1.0
NZ_CP040717_1	1.3\|1668114\|19\|NZ_CP040717\|CRISPRCasFinder	1668114-1668132	19	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1037977-1037995	1.0
NZ_CP040717_1	1.3\|1668114\|19\|NZ_CP040717\|CRISPRCasFinder	1668114-1668132	19	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	804930-804948	1.0
NZ_CP040717_1	1.3\|1668114\|19\|NZ_CP040717\|CRISPRCasFinder	1668114-1668132	19	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1541436-1541454	1.0
NZ_CP040717_1	1.3\|1668114\|19\|NZ_CP040717\|CRISPRCasFinder	1668114-1668132	19	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1541380-1541398	1.0
NZ_CP040717_1	1.3\|1668114\|19\|NZ_CP040717\|CRISPRCasFinder	1668114-1668132	19	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1028990-1029008	1.0
NZ_CP040717_1	1.3\|1668114\|19\|NZ_CP040717\|CRISPRCasFinder	1668114-1668132	19	MN508622	UNVERIFIED: Enterobacter phage EC-W2, complete genome	166940-166958	1.0

1. spacer 1.3|1668114|19|NZ_CP040717|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ggcaggtgcggcaggtgcg	CRISPR spacer
ggcaggtgcggcaggtgcg	Protospacer
*******************

2. spacer 1.3|1668114|19|NZ_CP040717|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ggcaggtgcggcaggtgcg	CRISPR spacer
ggcaggtgcggcaggtgcg	Protospacer
*******************

3. spacer 1.3|1668114|19|NZ_CP040717|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ggcaggtgcggcaggtgcg	CRISPR spacer
ggcaggtgcggcaggtgcg	Protospacer
*******************

4. spacer 1.3|1668114|19|NZ_CP040717|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ggcaggtgcggcaggtgcg	CRISPR spacer
ggcaggtgcggcaggtgcg	Protospacer
*******************

5. spacer 1.3|1668114|19|NZ_CP040717|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

ggcaggtgcggcaggtgcg	CRISPR spacer
ggcaggtgcggcaggtgcg	Protospacer
*******************

6. spacer 1.3|1668114|19|NZ_CP040717|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ggcaggtgcggcaggtgcg	CRISPR spacer
ggcaggtgcggcaggtgcg	Protospacer
*******************

7. spacer 1.3|1668114|19|NZ_CP040717|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

ggcaggtgcggcaggtgcg	CRISPR spacer
ggcaggtgcggcaggtgcg	Protospacer
*******************

8. spacer 1.3|1668114|19|NZ_CP040717|CRISPRCasFinder matches to MN508622 (UNVERIFIED: Enterobacter phage EC-W2, complete genome) position: , mismatch: 0, identity: 1.0

ggcaggtgcggcaggtgcg	CRISPR spacer
ggcaggtgcggcaggtgcg	Protospacer
*******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

64416 : 114315

Escherichia_phage(42.86%)

integrase,protease,holin,transposase

attL 63918:63933|attR 108342:108357

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
63918:63933	attL	NA	NA	NA	NA
WP_005337529.1\|64416_64899_+\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA
WP_005350885.1\|65197_65569_+	DUF413 domain-containing protein	NA	NA	NA	NA
WP_157160498.1\|65568_66441_+	HTH-type transcriptional regulator HdfR	NA	NA	NA	NA
WP_157162317.1\|66678_67554_+	hypothetical protein	NA	NA	NA	NA
WP_005350888.1\|67699_68890_+	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_157160499.1\|68996_69500_-	DUF2062 domain-containing protein	NA	NA	NA	NA
WP_005350890.1\|69493_70012_-	DUF2062 domain-containing protein	NA	NA	NA	NA
WP_157160500.1\|69955_72241_+	DNA internalization-related competence protein ComEC/Rec2	NA	NA	NA	NA
WP_157160501.1\|72345_74109_+	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	1.7e-56	30.7
WP_157160502.1\|74108_75104_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_040067763.1\|75227_75416_+	Trm112 family protein	NA	NA	NA	NA
WP_021229372.1\|75412_76162_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_005337448.1\|76374_77019_+	UvrY/SirA/GacA family response regulator transcription factor	NA	NA	NA	NA
WP_157160503.1\|77146_79000_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_031227442.1\|79199_79754_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_157160504.1\|80508_81717_+\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	1.6e-90	46.0
WP_042056289.1\|81960_82170_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_157160505.1\|82180_82594_+	hypothetical protein	NA	NA	NA	NA
WP_157160506.1\|82608_83148_+	hypothetical protein	NA	NA	NA	NA
WP_157160507.1\|83299_83560_+	hypothetical protein	NA	NA	NA	NA
WP_157160508.1\|83683_85948_+	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	4.9e-69	33.6
WP_069526656.1\|86486_86816_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_069526655.1\|86858_87245_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_157160509.1\|87264_87966_-	hypothetical protein	NA	NA	NA	NA
WP_069526653.1\|87977_88598_-	phosphate propanoyltransferase	NA	NA	NA	NA
WP_069526652.1\|88594_89047_-	BMC domain-containing protein	NA	NA	NA	NA
WP_042080494.1\|89059_90046_-\|holin	choline TMA-lyase-activating enzyme	NA	NA	NA	NA
WP_157160510.1\|90120_93507_-\|holin	choline trimethylamine-lyase	NA	NA	NA	NA
WP_157160511.1\|93532_94687_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_042056263.1\|94702_94960_-	EutN/CcmL family microcompartment protein	NA	NA	NA	NA
WP_157160512.1\|94986_96573_-	acetaldehyde dehydrogenase (acetylating)	NA	NA	NA	NA
WP_002442217.1\|96626_96905_-	BMC domain-containing protein	NA	NA	NA	NA
WP_042080492.1\|96919_97204_-	BMC domain-containing protein	NA	NA	NA	NA
WP_010634659.1\|97220_97499_-	BMC domain-containing protein	NA	NA	NA	NA
WP_157160513.1\|98204_98720_-	hypothetical protein	NA	NA	NA	NA
WP_157160514.1\|98719_99529_-	winged helix family transcriptional regulator	NA	NA	NA	NA
WP_042056255.1\|99550_100123_-	TetR/AcrR family transcriptional regulator	A0A0R6PIB6	Moraxella_phage	1.9e-09	31.9
WP_042056253.1\|100803_101601_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.7e-61	50.8
WP_069526645.1\|101854_102763_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	1.4e-107	72.3
WP_099368881.1\|103856_104873_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.2e-186	99.4
WP_157160515.1\|105454_107233_+	L-fucose isomerase	NA	NA	NA	NA
WP_157160516.1\|107299_108748_+	L-fuculokinase	NA	NA	NA	NA
108342:108357	attR	NA	NA	NA	NA
WP_157160517.1\|108744_109587_+	class II aldolase/adducin family protein	NA	NA	NA	NA
WP_157160518.1\|109596_110025_+	L-fucose mutarotase	NA	NA	NA	NA
WP_157160519.1\|110133_111282_+	lactaldehyde reductase	NA	NA	NA	NA
WP_157162318.1\|111546_112386_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157160520.1\|112489_113023_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_076611586.1\|113226_114315_+\|transposase	IS3-like element ISAs22 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

285809 : 326930

Bacillus_phage(25.0%)

integrase,protease,tRNA,transposase

attL 285375:285405|attR 312359:312389

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
285375:285405	attL	NA	NA	NA	NA
WP_123174175.1\|285809_286760_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_157160599.1\|287044_288181_+\|integrase	tyrosine-type recombinase/integrase	I6PDJ1	Cronobacter_phage	2.3e-19	31.3
WP_099368881.1\|288683_289700_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.2e-186	99.4
WP_157160600.1\|289735_290356_+	hypothetical protein	NA	NA	NA	NA
WP_157160601.1\|290346_292056_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_157160602.1\|292211_293204_+	AAA family ATPase	A0A2P1CFH0	Microbacterium_phage	8.3e-05	23.8
WP_157160603.1\|294014_295139_+	hypothetical protein	NA	NA	NA	NA
WP_157162328.1\|296920_297397_+	hypothetical protein	NA	NA	NA	NA
WP_099368881.1\|297504_298521_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.2e-186	99.4
WP_157160604.1\|298562_303089_+	AAA family ATPase	NA	NA	NA	NA
WP_157160605.1\|303085_304507_+	hypothetical protein	NA	NA	NA	NA
WP_080630556.1\|304611_305055_+	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_157160606.1\|306185_307181_+	DUF4917 family protein	NA	NA	NA	NA
WP_157160607.1\|307322_308345_+	hypothetical protein	NA	NA	NA	NA
WP_011899269.1\|308960_309593_-	tetracycline resistance transcriptional repressor TetR(E)	NA	NA	NA	NA
WP_011899270.1\|309673_310891_+	tetracycline efflux MFS transporter Tet(E)	NA	NA	NA	NA
WP_012564931.1\|311278_312226_+\|transposase	IS30-like element ISAeca1 family transposase	Q9MBM9	Staphylococcus_prophage	1.0e-44	36.9
WP_157160608.1\|312680_313403_-	virulence factor	NA	NA	NA	NA
312359:312389	attR	NA	NA	NA	NA
WP_157160609.1\|313414_315964_-	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_005337116.1\|316117_316300_-	hypothetical protein	NA	NA	NA	NA
WP_157160610.1\|316354_317680_-	two-component system sensor histidine kinase RstB	W8CYF6	Bacillus_phage	3.0e-18	24.9
WP_157160611.1\|317701_318412_-	two-component system response regulator RstA	W8CYM9	Bacillus_phage	2.9e-28	31.4
WP_100646092.1\|319256_320111_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	4.6e-28	32.9
WP_005300025.1\|320227_320446_-	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.2e-17	63.2
WP_005337111.1\|320675_320993_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.4e-14	49.4
WP_005337110.1\|321052_323308_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	2.7e-168	43.0
WP_005300033.1\|323376_323595_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_088869181.1\|323663_324380_-	arginyltransferase	NA	NA	NA	NA
WP_019445527.1\|324376_325084_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_058059142.1\|325103_325574_+	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_157160612.1\|325682_326930_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.1e-14	32.2

DBSCAN-SWA_3

380393 : 439690

Klosneuvirus(23.08%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157160634.1\|380393_381422_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_157162329.1\|382892_383006_-	DUF4019 domain-containing protein	NA	NA	NA	NA
WP_157160635.1\|383021_383294_-	DUF4019 domain-containing protein	NA	NA	NA	NA
WP_157160636.1\|383410_383596_-	hypothetical protein	NA	NA	NA	NA
WP_157160637.1\|384284_384578_-	hypothetical protein	NA	NA	NA	NA
WP_012564931.1\|384993_385941_+\|transposase	IS30-like element ISAeca1 family transposase	Q9MBM9	Staphylococcus_prophage	1.0e-44	36.9
WP_157160638.1\|388423_389251_-	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	9.6e-15	42.6
WP_157160639.1\|389302_390067_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.9e-25	34.8
WP_157160640.1\|390388_391759_+	protein kinase	NA	NA	NA	NA
WP_157160641.1\|392042_392690_+	thiopurine S-methyltransferase	NA	NA	NA	NA
WP_157160642.1\|393022_395809_-	insulinase family protein	A0A1V0SJA4	Klosneuvirus	5.6e-91	26.9
WP_139444192.1\|395971_396439_+	phosphohistidine phosphatase SixA	NA	NA	NA	NA
WP_005336998.1\|396572_396779_+	DUF1107 domain-containing protein	NA	NA	NA	NA
WP_157160643.1\|396943_397861_+	EamA family transporter	NA	NA	NA	NA
WP_157160644.1\|397964_399581_-	oligopeptide ABC transporter substrate-binding protein OppA	NA	NA	NA	NA
WP_005336993.1\|399963_400998_+	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.6e-75	46.2
WP_157162330.1\|401239_404716_-	transcription-repair coupling factor	NA	NA	NA	NA
WP_005336991.1\|404762_405338_-	hypothetical protein	NA	NA	NA	NA
WP_005345085.1\|405414_406650_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_157160645.1\|406654_407446_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	9.4e-36	39.7
WP_005336986.1\|407445_408687_+	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
WP_088869144.1\|408775_409366_-	5'-deoxynucleotidase	NA	NA	NA	NA
WP_005336982.1\|409458_409893_-	YccF domain-containing protein	NA	NA	NA	NA
WP_005345092.1\|410334_411645_+	trigger factor	NA	NA	NA	NA
WP_085942156.1\|411752_412355_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	2.9e-61	60.9
WP_005336977.1\|412425_413700_+\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.5e-131	57.5
WP_005336976.1\|413841_416196_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	6.1e-224	53.5
WP_005315375.1\|416436_416709_+	DNA-binding protein HU-beta	A7KV42	Bacillus_phage	5.0e-21	61.8
WP_139442734.1\|416862_418773_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_005333398.1\|419397_420033_-	sugar transferase	NA	NA	NA	NA
WP_157160646.1\|420029_421223_-	glycosyltransferase	NA	NA	NA	NA
WP_157160647.1\|421254_422394_-	glycosyltransferase	NA	NA	NA	NA
WP_157160648.1\|422596_423680_+\|transposase	IS3-like element ISAs22 family transposase	NA	NA	NA	NA
WP_124929590.1\|423750_425166_+	chain-length determining protein	NA	NA	NA	NA
WP_157160649.1\|426914_428294_-	exodeoxyribonuclease VII large subunit	A0A1B3AYB4	Gordonia_phage	5.7e-28	31.7
WP_157160650.1\|428582_429134_+	cytochrome b	NA	NA	NA	NA
WP_005360033.1\|429577_431041_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	8.2e-94	40.0
WP_019445882.1\|431125_432715_+	glutamine-hydrolyzing GMP synthase	NA	NA	NA	NA
WP_042081150.1\|433094_433367_+	hypothetical protein	NA	NA	NA	NA
WP_157160651.1\|435633_436125_+	hypothetical protein	NA	NA	NA	NA
WP_157160652.1\|436140_437172_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_157160653.1\|438528_439690_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	2.8e-76	49.0

DBSCAN-SWA_4

1015823 : 1089225

Bacillus_virus(25.0%)

integrase,transposase

attL 1071409:1071439|attR 1091314:1091344

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157160932.1\|1015823_1017027_+\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	1.3e-113	70.1
WP_157162348.1\|1017637_1018012_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.0e-08	47.1
WP_019446121.1\|1017924_1018362_+	YcgN family cysteine cluster protein	NA	NA	NA	NA
WP_005333618.1\|1018871_1021154_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	1.8e-164	42.8
WP_005333620.1\|1021200_1022049_-	formate transporter FocA	NA	NA	NA	NA
WP_157160933.1\|1022430_1024191_-	30S ribosomal protein S12 methylthiotransferase accessory protein YcaO	NA	NA	NA	NA
WP_157160934.1\|1024384_1025818_-	family 1 glycosylhydrolase	A0A0B5JD41	Pandoravirus	2.7e-49	29.3
WP_157160935.1\|1025984_1026848_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_157160936.1\|1026884_1027634_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_157160937.1\|1027810_1030075_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_157160938.1\|1030352_1031261_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_157160939.1\|1031267_1032203_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_111900615.1\|1032395_1033133_+	isochorismatase family protein	NA	NA	NA	NA
WP_157160940.1\|1033192_1034092_+	pirin family protein	NA	NA	NA	NA
WP_157160941.1\|1034088_1035357_+	MFS transporter	NA	NA	NA	NA
WP_123172907.1\|1035457_1036360_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_157160942.1\|1036484_1037375_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_157160943.1\|1037476_1038115_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_157160944.1\|1038168_1038417_-	hypothetical protein	NA	NA	NA	NA
WP_157160945.1\|1038559_1039603_+	isopenicillin N synthase family oxygenase	NA	NA	NA	NA
WP_157160946.1\|1039736_1040900_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_157160947.1\|1041009_1042671_-	AMP-binding protein	A0A1V0SBX8	Catovirus	3.6e-45	28.3
WP_005333639.1\|1042769_1043048_-	YfcL family protein	NA	NA	NA	NA
WP_157160948.1\|1043147_1044263_-	ATP-NAD kinase	NA	NA	NA	NA
WP_005333641.1\|1044383_1045121_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	8.5e-47	52.5
WP_005333642.1\|1045215_1045704_-	OmpA family protein	NA	NA	NA	NA
WP_157160949.1\|1045739_1046969_-	diguanylate cyclase	G3MA91	Bacillus_virus	8.4e-15	32.3
WP_005333646.1\|1046965_1047523_-	YfiR family protein	NA	NA	NA	NA
WP_005333656.1\|1047712_1049260_-	transcriptional regulator TyrR	NA	NA	NA	NA
WP_005352635.1\|1049558_1049897_-	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_157160950.1\|1049960_1050755_-	phenylalanine 4-monooxygenase	NA	NA	NA	NA
WP_157160951.1\|1050908_1052339_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_157160952.1\|1052368_1053196_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_005346227.1\|1053231_1054200_-	ABC transporter permease	NA	NA	NA	NA
WP_157160953.1\|1054196_1055210_-	ATP-binding cassette domain-containing protein	Q6GZ03	Mycoplasma_phage	6.0e-27	38.5
WP_115521822.1\|1055353_1056499_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005346246.1\|1056696_1057620_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_157160954.1\|1057810_1058842_-	TIGR01620 family protein	NA	NA	NA	NA
WP_157160955.1\|1058893_1060315_-	YcjX family protein	NA	NA	NA	NA
WP_157160956.1\|1060474_1060894_-	envelope stress response membrane protein PspC	NA	NA	NA	NA
WP_042022412.1\|1060875_1061112_-	envelope stress response membrane protein PspB	NA	NA	NA	NA
WP_042022411.1\|1061115_1061802_-	phage shock protein PspA	NA	NA	NA	NA
WP_157160957.1\|1061998_1063027_+	phage shock protein operon transcriptional activator	NA	NA	NA	NA
WP_085942140.1\|1063165_1064731_+	peptide ABC transporter substrate-binding protein SapA	NA	NA	NA	NA
WP_005333676.1\|1064733_1065693_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_005333677.1\|1065728_1066622_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_005333679.1\|1066621_1067620_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.3e-09	27.7
WP_005333681.1\|1067654_1068440_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.8e-16	28.8
WP_058058711.1\|1068545_1070459_-	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.3e-115	36.2
WP_005352677.1\|1070624_1071227_-	recombination protein RecR	NA	NA	NA	NA
1071409:1071439	attL	NA	NA	NA	NA
WP_157160958.1\|1073253_1075218_-	diguanylate cyclase	G3MA91	Bacillus_virus	8.1e-20	35.6
WP_026141181.1\|1077515_1078496_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	8.0e-186	99.1
WP_081250366.1\|1079933_1082090_+	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	6.8e-20	37.6
WP_157160959.1\|1082412_1083426_-	AAA family ATPase	A0A2P1CFH0	Microbacterium_phage	3.8e-05	22.5
WP_157160634.1\|1084423_1085452_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_157160960.1\|1086916_1087879_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_081250368.1\|1088016_1089225_-\|integrase	site-specific integrase	A0A2H4JGM5	uncultured_Caudovirales_phage	1.3e-36	32.4
1091314:1091344	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2544555 : 2555204

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019446511.1\|2544555_2545224_+	response regulator transcription factor	W8CYM9	Bacillus_phage	6.7e-27	33.3
WP_157161538.1\|2545220_2546450_+	sensor histidine kinase	NA	NA	NA	NA
WP_005340088.1\|2546602_2547499_-	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	7.9e-39	34.3
WP_157162404.1\|2547730_2551426_-	methionine synthase	A0A140XBC7	Dickeya_phage	9.5e-22	80.3
WP_021231596.1\|2551642_2552920_+	sodium:proton antiporter	A0A2H4J178	uncultured_Caudovirales_phage	7.1e-41	39.8
WP_005340085.1\|2553426_2553603_+	hypothetical protein	NA	NA	NA	NA
WP_042081371.1\|2553756_2554254_-	GNAT family N-acetyltransferase	G9BWD5	Planktothrix_phage	3.7e-06	27.7
WP_005357745.1\|2554382_2555204_-	HDOD domain-containing protein	A0A1C3NFB0	Phage_NCTB	4.6e-09	24.0

DBSCAN-SWA_6

3313428 : 3367512

Enterobacteria_phage(12.5%)

capsid,bacteriocin,integrase,protease,transposase

attL 3339571:3339586|attR 3356862:3356877

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157161803.1\|3313428_3314649_+\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	2.4e-91	45.5
WP_157161804.1\|3314874_3315084_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_157161805.1\|3315096_3315615_+	hypothetical protein	NA	NA	NA	NA
WP_157161806.1\|3316032_3316200_+	hypothetical protein	NA	NA	NA	NA
WP_157161807.1\|3316196_3316355_+	hypothetical protein	NA	NA	NA	NA
WP_088869463.1\|3316351_3316612_+	hypothetical protein	NA	NA	NA	NA
WP_157161808.1\|3316755_3317112_+	hypothetical protein	NA	NA	NA	NA
WP_157162423.1\|3317111_3319931_+	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	9.7e-67	35.0
WP_088869465.1\|3321375_3321615_+\|bacteriocin	bacteriocin	A0A1I9KFI4	Aeromonas_phage	7.2e-16	60.0
WP_157161809.1\|3322797_3323421_-	peptidase	NA	NA	NA	NA
WP_157161810.1\|3324086_3325124_-	acyltransferase family protein	NA	NA	NA	NA
WP_110303977.1\|3325347_3326259_-	D-alanyl-D-alanine endopeptidase	NA	NA	NA	NA
WP_042053465.1\|3326518_3327985_-	glutamate/gamma-aminobutyrate family transporter YjeM	NA	NA	NA	NA
WP_012564931.1\|3328386_3329334_+\|transposase	IS30-like element ISAeca1 family transposase	Q9MBM9	Staphylococcus_prophage	1.0e-44	36.9
WP_081394768.1\|3329511_3330390_-	EamA family transporter	NA	NA	NA	NA
WP_157161811.1\|3330423_3331344_-	hypothetical protein	NA	NA	NA	NA
WP_157161812.1\|3331464_3332520_-	porin	NA	NA	NA	NA
WP_005336386.1\|3332741_3333752_+	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_005336384.1\|3333886_3334138_+	hypothetical protein	NA	NA	NA	NA
WP_100646922.1\|3334208_3335372_-	heme biosynthesis protein HemY	NA	NA	NA	NA
WP_076495577.1\|3335382_3336432_-	heme biosynthesis operon protein HemX	NA	NA	NA	NA
WP_157161813.1\|3336428_3337163_-	uroporphyrinogen III synthase	NA	NA	NA	NA
WP_157162424.1\|3337159_3338089_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_157161814.1\|3338412_3340932_+	class I adenylate cyclase	NA	NA	NA	NA
3339571:3339586	attL	NA	NA	NA	NA
WP_157161815.1\|3340998_3341652_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_069554181.1\|3341648_3341963_-	iron donor protein CyaY	NA	NA	NA	NA
WP_019444858.1\|3342036_3342213_+	lipoprotein	NA	NA	NA	NA
WP_075115816.1\|3342245_3343496_+	diaminopimelate decarboxylase	NA	NA	NA	NA
WP_005336371.1\|3343660_3344491_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_085942101.1\|3344613_3345264_+	DUF484 family protein	NA	NA	NA	NA
WP_157161816.1\|3345256_3346234_+	tyrosine recombinase XerC	A0A142F2H8	Mycobacterium_phage	3.9e-15	33.3
WP_157161817.1\|3346266_3346977_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_157161818.1\|3347053_3347452_-	hypothetical protein	NA	NA	NA	NA
WP_157161819.1\|3347497_3349024_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_040069030.1\|3349169_3349553_+	hypothetical protein	NA	NA	NA	NA
WP_157161820.1\|3349565_3350348_-	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	NA	NA	NA	NA
WP_031227939.1\|3350744_3351290_-	ribosome-associated protein	NA	NA	NA	NA
WP_157161821.1\|3351498_3352794_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_157161822.1\|3353042_3353729_-	KilA-N domain-containing protein	NA	NA	NA	NA
WP_157161823.1\|3353933_3355697_-	hypothetical protein	NA	NA	NA	NA
WP_157161824.1\|3355809_3356280_-	ribonuclease HI	A0A2I7RL06	Vibrio_phage	2.7e-14	36.3
WP_157161825.1\|3356276_3356477_-	hypothetical protein	NA	NA	NA	NA
WP_157161826.1\|3356473_3356689_-	hypothetical protein	NA	NA	NA	NA
WP_157161827.1\|3356745_3357249_-	hypothetical protein	NA	NA	NA	NA
3356862:3356877	attR	NA	NA	NA	NA
WP_157161828.1\|3357365_3357950_-	hypothetical protein	NA	NA	NA	NA
WP_157161829.1\|3357949_3358168_-	hypothetical protein	NA	NA	NA	NA
WP_157161830.1\|3358373_3359459_-\|capsid	capsid protein	A0A076YM75	Mesorhizobium_phage	1.7e-27	30.8
WP_157161831.1\|3360046_3360283_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_114522673.1\|3362303_3362873_-	recombinase family protein	E5FFF9	Burkholderia_phage	2.7e-32	40.7
WP_024944628.1\|3362886_3363099_-	hypothetical protein	NA	NA	NA	NA
WP_157161832.1\|3363293_3363980_-	antirestriction protein ArdA	NA	NA	NA	NA
WP_005343746.1\|3364402_3365032_+	hypothetical protein	NA	NA	NA	NA
WP_157161833.1\|3365329_3365539_-	hypothetical protein	NA	NA	NA	NA
WP_157161834.1\|3365535_3366090_-	hypothetical protein	NA	NA	NA	NA
WP_058057516.1\|3366168_3367512_+\|protease	metalloprotease PmbA	NA	NA	NA	NA

DBSCAN-SWA_7

3578195 : 3584505

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157161904.1\|3578195_3580262_+	GNAT family N-acetyltransferase	Q56AQ2	Bacillus_thuringiensis_phage	2.3e-97	92.7
WP_157161905.1\|3580248_3580968_-	SDR family NAD(P)-dependent oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	7.1e-131	96.7
WP_157161906.1\|3581169_3582186_+	response regulator	Q56AR1	Bacillus_thuringiensis_phage	5.0e-191	99.4
WP_157161907.1\|3582361_3582841_+	hypothetical protein	Q56AR5	Bacillus_thuringiensis_phage	1.1e-36	97.4
WP_157161908.1\|3582858_3583473_+	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	8.7e-114	97.1
WP_157161909.1\|3583557_3584505_-	hypothetical protein	Q56AS0	Bacillus_thuringiensis_phage	2.8e-18	100.0

DBSCAN-SWA_8

3904118 : 3913337

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157162049.1\|3904118_3906944_+	TMAO reductase system sensor histidine kinase/response regulator TorS	A0A1V0SGX0	Hokovirus	4.7e-45	30.9
WP_100646668.1\|3906996_3907281_-	hypothetical protein	NA	NA	NA	NA
WP_005338884.1\|3907605_3908859_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	3.9e-100	53.2
WP_005338880.1\|3909009_3909459_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_157162050.1\|3909658_3910768_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	4.0e-48	34.7
WP_047438140.1\|3910823_3911477_+	riboflavin synthase	A0A1V0SE20	Indivirus	1.2e-20	37.8
WP_005358461.1\|3911626_3912736_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.7e-65	39.2
WP_005338866.1\|3912866_3913337_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.1e-29	47.3

DBSCAN-SWA_9

4359969 : 4408048

Escherichia_phage(15.38%)

integrase,transposase

attL 4353259:4353318|attR 4408029:4408375

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4353259:4353318	attL	NA	NA	NA	NA
WP_024941042.1\|4359969_4360941_+\|integrase	integron integrase	NA	NA	NA	NA
WP_024941043.1\|4361237_4362218_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	9.8e-184	97.5
WP_024941045.1\|4362926_4365986_-	DEAD/DEAH box helicase	S4W0U8	Pandoravirus	1.9e-07	37.2
WP_024941046.1\|4365986_4368047_-	hypothetical protein	NA	NA	NA	NA
WP_024941047.1\|4368043_4368811_-	OmpA family protein	NA	NA	NA	NA
WP_024941048.1\|4368810_4370871_-	anti-phage defense ZorAB system ZorA	NA	NA	NA	NA
WP_024941049.1\|4371044_4371758_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_024941050.1\|4371757_4374889_-	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	1.4e-53	28.1
WP_024941051.1\|4374963_4376028_-	macro domain-containing protein	A0A2I7QNM6	Vibrio_phage	2.2e-24	40.5
WP_157162233.1\|4376896_4378192_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	5.9e-43	31.9
WP_157162234.1\|4378191_4380639_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	5.8e-76	36.9
WP_043852095.1\|4380824_4381271_-	hypothetical protein	NA	NA	NA	NA
WP_024941055.1\|4381417_4381606_-	DUF3283 family protein	NA	NA	NA	NA
WP_024941056.1\|4381722_4382166_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	3.3e-30	49.6
WP_024941057.1\|4382146_4383406_+	translesion error-prone DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	1.6e-117	52.5
WP_041204583.1\|4384230_4385589_-\|integrase	site-specific integrase	B7SYF8	Stenotrophomonas_phage	2.5e-12	25.0
WP_157162235.1\|4385834_4387031_-	ROK family protein	NA	NA	NA	NA
WP_157162236.1\|4387150_4390429_+	DUF5107 domain-containing protein	NA	NA	NA	NA
WP_120415720.1\|4390510_4391962_+	sugar porter family MFS transporter	NA	NA	NA	NA
WP_157162237.1\|4391958_4392816_+	aldose 1-epimerase	NA	NA	NA	NA
WP_157162238.1\|4392911_4397078_-	formate dehydrogenase subunit alpha	NA	NA	NA	NA
WP_100653330.1\|4397609_4398821_-	EAL domain-containing response regulator	NA	NA	NA	NA
WP_012564931.1\|4403316_4404264_-\|transposase	IS30-like element ISAeca1 family transposase	Q9MBM9	Staphylococcus_prophage	1.0e-44	36.9
WP_099368881.1\|4404746_4405763_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.2e-186	99.4
WP_157162239.1\|4405767_4406544_-	hypothetical protein	A0A0H3UZD5	Geobacillus_virus	2.6e-14	30.0
WP_157162240.1\|4406676_4407033_-	hypothetical protein	NA	NA	NA	NA
WP_012564931.1\|4407100_4408048_+\|transposase	IS30-like element ISAeca1 family transposase	Q9MBM9	Staphylococcus_prophage	1.0e-44	36.9
4408029:4408375	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP040717.1|WP_005343746.1|3364402_3365032_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP040717.1|WP_005343746.1|3364402_3365032_+|hypothetical-protein

3364402_3365032_+

209 aa aa

HTH_Hin_like

Identity	Hit_domain_coverage
0.4523809523809524	0.9761904761904762

3313428-3367512

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP040717_1	Orphan	1.3\|1668114\|19\|NZ_CP040717\|CRISPRCasFinder	1668114-1668132	19	3345570-3345588	1

1. spacer 1.3|1668114|19|NZ_CP040717|CRISPRCasFinder matches to NZ_CP040717 position: 3345570-3345588, mismatch: 1

ggcaggtgcggcaggtgcg	CRISPR spacer
ggcaggtgcggcaggggcg	Protospacer
*************** ***

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP040717

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information