CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP046411	Vibrio parahaemolyticus strain 19-021-D1 chromosome 1, complete sequence	0 crisprs	DEDDh,DinG,cas3,csx1,csa3,WYL	5
NZ_CP046414	Vibrio parahaemolyticus strain 19-021-D1 plasmid pVp_Kor-D1-2, complete sequence	0 crisprs	NA	4
NZ_CP046412	Vibrio parahaemolyticus strain 19-021-D1 chromosome 2, complete sequence	3 crisprs	csa3,cas3,DEDDh,WYL	146
NZ_CP046413	Vibrio parahaemolyticus strain 19-021-D1 plasmid pVp_Kor-D1-1, complete sequence	0 crisprs	PD-DExK	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

239749 : 253276

uncultured_marine_virus(10.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_140127156.1\|239749_242281_-	hypothetical protein	A0A0F7L149	uncultured_marine_virus	7.0e-16	29.9
WP_024701827.1\|242293_242485_-	hypothetical protein	NA	NA	NA	NA
WP_024701828.1\|242618_242882_-	hypothetical protein	NA	NA	NA	NA
WP_140065493.1\|243293_243494_+	hypothetical protein	NA	NA	NA	NA
WP_024701829.1\|243597_243954_-	helix-turn-helix transcriptional regulator	A0A1B0VRI7	Pseudomonas_phage	1.2e-06	49.2
WP_024701830.1\|244062_244269_+	hypothetical protein	NA	NA	NA	NA
WP_024701831.1\|244255_244477_+	hypothetical protein	NA	NA	NA	NA
WP_140129063.1\|244554_245472_+	hypothetical protein	A0A1W6JNI1	Staphylococcus_phage	1.5e-21	29.7
WP_050451083.1\|245471_246122_+	hypothetical protein	A0A1I9KFB0	Aeromonas_phage	1.9e-13	31.2
WP_023623497.1\|246124_246490_+	hypothetical protein	NA	NA	NA	NA
WP_023623498.1\|246482_246701_+	hypothetical protein	NA	NA	NA	NA
WP_023623499.1\|246687_247338_+	DUF1367 family protein	A0A0M4QX23	Salmonella_phage	3.9e-19	33.3
WP_023623500.1\|247334_247517_+	hypothetical protein	NA	NA	NA	NA
WP_054395043.1\|247506_247908_+	hypothetical protein	A0A0M3LTG3	Mannheimia_phage	1.1e-24	50.9
WP_140127132.1\|247894_248383_+	hypothetical protein	NA	NA	NA	NA
WP_023623502.1\|248452_248884_+	hypothetical protein	NA	NA	NA	NA
WP_023623503.1\|248907_249231_+	hypothetical protein	NA	NA	NA	NA
WP_079741544.1\|249566_250391_+	hypothetical protein	D6QWP0	uncultured_phage	1.9e-31	51.3
WP_023623505.1\|250387_250546_+	hypothetical protein	NA	NA	NA	NA
WP_023623506.1\|250553_250739_+	hypothetical protein	NA	NA	NA	NA
WP_023623507.1\|250950_251631_+	nuclease	A0A2I7RQE2	Vibrio_phage	4.5e-26	46.9
WP_023623508.1\|251594_252767_+	phosphoadenosine phosphosulfate reductase family protein	A0A218KCP0	Bacillus_phage	1.1e-27	30.4
WP_024701842.1\|252763_253276_+	ParB-like nuclease domain-containing protein	A0A222ZJ88	Arthrobacter_phage	1.5e-21	35.9

DBSCAN-SWA_2

273757 : 284734

Vibrio_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023623542.1\|273757_274615_-	N-6 DNA methylase	A0A2I7RHV5	Vibrio_phage	9.0e-16	30.3
WP_024703773.1\|274832_275123_+	hypothetical protein	NA	NA	NA	NA
WP_023623544.1\|275127_275484_+	hypothetical protein	NA	NA	NA	NA
WP_024703772.1\|275716_276133_-	hypothetical protein	A0A2H5BPW3	Vibrio_phage	1.8e-38	60.8
WP_140065492.1\|276122_276668_-	hypothetical protein	NA	NA	NA	NA
WP_023623548.1\|276797_277103_-	hypothetical protein	G4WAD1	Salmonella_phage	1.3e-17	45.2
WP_023623549.1\|277099_277453_-	hypothetical protein	NA	NA	NA	NA
WP_140065463.1\|277449_277803_-	hypothetical protein	A0A0K1LMZ7	Caulobacter_phage	2.0e-06	55.8
WP_140065462.1\|277799_278087_-	hypothetical protein	A0A0A7S062	Clostridium_phage	2.1e-14	49.4
WP_023623551.1\|278083_278446_-	DUF2591 domain-containing protein	A0A0K0MDE9	Pseudoalteromonas_phage	3.2e-07	44.7
WP_140065461.1\|278442_278682_-	hypothetical protein	A0A2I7RMH3	Vibrio_phage	4.5e-18	61.4
WP_023623553.1\|278668_278833_-	hypothetical protein	NA	NA	NA	NA
WP_023623554.1\|278969_279836_-\|transposase	transposase	A0A1E1GE17	Vibrio_phage	1.1e-98	73.1
WP_023623556.1\|280155_280347_-	hypothetical protein	NA	NA	NA	NA
WP_024703765.1\|280346_280766_-	hypothetical protein	NA	NA	NA	NA
WP_017448948.1\|281027_282533_+	glucose-6-phosphate dehydrogenase	M4SIY3	Cyanophage	1.8e-88	38.5
WP_025793249.1\|282529_283246_+	6-phosphogluconolactonase	NA	NA	NA	NA
WP_025793248.1\|283285_284734_+	decarboxylating NADP(+)-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	3.1e-37	28.3

DBSCAN-SWA_3

305207 : 318440

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156216539.1\|305207_305429_+	transcriptional regulator	A0A2I7S995	Vibrio_phage	3.2e-18	60.9
WP_156216541.1\|305428_307495_+	hypothetical protein	A0A2I7S9A8	Vibrio_phage	6.4e-68	28.4
WP_156216543.1\|307513_308443_+	AAA family ATPase	M4M9P4	Vibrio_phage	7.4e-32	30.9
WP_156216545.1\|308449_308878_+	hypothetical protein	NA	NA	NA	NA
WP_025793206.1\|308868_309114_+	hypothetical protein	NA	NA	NA	NA
WP_156216547.1\|309103_309301_+	hypothetical protein	NA	NA	NA	NA
WP_156216548.1\|309301_309511_+	hypothetical protein	NA	NA	NA	NA
WP_156216550.1\|309518_309725_+	ANR family transcriptional regulator	NA	NA	NA	NA
WP_156216552.1\|309721_310417_+	DUF2786 domain-containing protein	A0A2P9JZH4	Alteromonadaceae_phage	3.7e-28	38.5
WP_023624025.1\|310426_311056_+	DUF3164 family protein	A0A0M3LQ92	Mannheimia_phage	5.6e-15	29.2
WP_025793200.1\|311065_311311_+	hypothetical protein	NA	NA	NA	NA
WP_025793199.1\|311431_312103_+	hypothetical protein	A0A2I7RMG9	Vibrio_phage	1.6e-12	26.7
WP_025793198.1\|312105_312810_+	hypothetical protein	NA	NA	NA	NA
WP_080277499.1\|312766_312991_+	hypothetical protein	NA	NA	NA	NA
WP_033904965.1\|312987_313200_+	hypothetical protein	M4MCS5	Vibrio_phage	4.9e-16	59.1
WP_080277500.1\|313452_314664_+	chromosome partitioning protein ParA	Q9MC01	Enterobacteria_phage	2.8e-71	64.6
WP_140341988.1\|314790_315069_+	hypothetical protein	NA	NA	NA	NA
WP_156216554.1\|315065_315491_+	DUF1018 domain-containing protein	NA	NA	NA	NA
WP_023624032.1\|315498_315777_+	hypothetical protein	NA	NA	NA	NA
WP_025793194.1\|316050_316353_-	hypothetical protein	NA	NA	NA	NA
WP_102589842.1\|316349_317249_-	hypothetical protein	D6QWP0	uncultured_phage	4.8e-36	55.0
WP_025793192.1\|317261_318440_-	hypothetical protein	A0A2K9V320	Faecalibacterium_phage	9.8e-21	28.1

DBSCAN-SWA_4

1422658 : 1429360

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005440184.1\|1422658_1423129_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	49.3
WP_005496254.1\|1423298_1424408_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.5e-63	39.6
WP_005483039.1\|1424577_1425231_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.6e-33	37.5
WP_025793337.1\|1425243_1426368_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.4e-48	36.3
WP_005482986.1\|1426375_1426825_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_023585984.1\|1426952_1428203_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.6e-98	47.7
WP_024703709.1\|1428220_1429360_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.0e-62	41.7

DBSCAN-SWA_5

2862049 : 2879232

uncultured_Mediterranean_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005455581.1\|2862049_2863690_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.2e-155	52.4
WP_005455579.1\|2863768_2865070_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.2e-134	59.2
WP_005455577.1\|2865483_2865765_+	cell division protein FtsB	NA	NA	NA	NA
WP_005478544.1\|2865766_2866471_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	5.9e-05	23.6
WP_005455572.1\|2866488_2866965_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_020835387.1\|2867011_2868055_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_025792825.1\|2868054_2868831_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	8.6e-66	52.4
WP_005455562.1\|2868830_2869457_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-35	52.1
WP_005455560.1\|2869471_2870395_+	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_025792829.1\|2871543_2874105_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	2.6e-34	23.5
WP_025554256.1\|2874189_2874672_+	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.7e-27	48.7
WP_005478550.1\|2874872_2875916_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	60.7
WP_005455548.1\|2876039_2876507_+	recombination regulator RecX	NA	NA	NA	NA
WP_025792834.1\|2876649_2879232_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.0e-78	37.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046412

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046412_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046412_1

598654-598756

Orphan

Consensus_repeat	Method
ACTGTATTTTTTGCAGTCATGATTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046412_1

>merge|NZ_CP046412|1|598654-598756|CRISPRCasFinder
ACTGTATTTTTTGCAGTCATGATTATTCTTGAATCGCTAGGTTAACTGTATTTTTTACACAAATTTGCGTTGGTTAACTGTATTTTTTGCAGTCATGATTATT

>NZ_CP046412|1|1|598654-598756|CRISPRCasFinder
ACTGTATTTTTTGCAGTCATGATTATT	CTTGAATCGCTAGGTTAACTGTATTTTTTACACAAATTTGCGTTGGTTA
ACTGTATTTTTTGCAGTCATGATTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046412.1\|WP_025790613.1\|602906_605081_+\|fusaric-acid-resistance-family-protein	unknown	unknown	gnl\|CDD\|377393
NZ_CP046412.1\|WP_140060563.1\|597588_597819_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_140065343.1\|600567_601416_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP046412.1\|WP_140060850.1\|599265_599514_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_156216728.1\|594954_595260_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_024702170.1\|601649_602519_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP046412.1\|WP_005462724.1\|606734_606938_+\|DUF1656-domain-containing-protein	unknown	unknown	gnl\|CDD\|377931
NZ_CP046412.1\|WP_140060559.1\|594202_594691_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_025790611.1\|605091_606735_+\|membrane-protein	unknown	unknown	gnl\|CDD\|273830
NZ_CP046412.1\|WP_156216729.1\|595370_595877_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_140065338.1\|597868_598486_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_156216733.1\|596441_597596_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|370236
NZ_CP046412.1\|WP_156216726.1\|592114_592666_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_156216731.1\|596081_596330_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_140060849.1\|599482_599884_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_140065340.1\|600038_600293_-\|AlpA-family-phage-regulatory-protein	unknown	unknown	gnl\|CDD\|225848
NZ_CP046412.1\|WP_031501779.1\|593914_594196_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_140060851.1\|598762_599215_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_156216735.1\|599883_600039_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_031501780.1\|592854_593667_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP046412.1\|WP_156216733.1\|596441_597596_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|370236	pfam09003, Arm-DNA-bind_1, Bacteriophage lambda integrase, Arm DNA-binding domain. The amino terminal domain of bacteriophage lambda integrase folds into a three-stranded, antiparallel beta-sheet that packs against a C-terminal alpha-helix, adopting a fold that is structurally related to the three-stranded beta-sheet family of DNA-binding domains (which includes the GCC-box DNA-binding domain and the N-terminal domain of Tn916 integrase). This domain is responsible for high-affinity binding to each of the five DNA arm-type sites and is also a context-sensitive modulator of DNA cleavage.	2.88095e-21
NZ_CP046412.1\|WP_140065340.1\|600038_600293_-\|AlpA-family-phage-regulatory-protein	gnl\|CDD\|225848	COG3311, AlpA, Predicted transcriptional regulator [Transcription].	1.65104e-06
NZ_CP046412.1\|WP_005462724.1\|606734_606938_+\|DUF1656-domain-containing-protein	gnl\|CDD\|377931	pfam07869, DUF1656, Protein of unknown function (DUF1656). This family contains bacterial proteins, many of which are hypothetical. Some proteins in this family are putative membrane proteins.	4.0711e-09
NZ_CP046412.1\|WP_140065343.1\|600567_601416_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	6.24422e-05
NZ_CP046412.1\|WP_025790613.1\|602906_605081_+\|fusaric-acid-resistance-family-protein	gnl\|CDD\|377393	pfam04632, FUSC, Fusaric acid resistance protein family. This family includes a conserved region found in two proteins associated with fusaric acid resistance, FusC from Burkholderia cepacia and fdt-2 from Klebsiella oxytoca. These proteins are likely to be membrane transporter proteins.	2.88502e-35
NZ_CP046412.1\|WP_024702170.1\|601649_602519_+\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.65845e-09
NZ_CP046412.1\|WP_025790611.1\|605091_606735_+\|membrane-protein	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	6.67235e-78

>NZ_CP046412.1|WP_140065338.1|597868_598486_-|hypothetical-protein
MTSKLAKYIKGVQLQIEDSFQHKPFDVENWELSLMFFEKALWREGVGNFCKFTISELSDFAGTKCEARKVIQTLSRALLIRNANFDGENVTFQVDVGAIQFHPSYKVVVRRSNMPPRSADPHVRGEYEVPVKVIQSQELSLEARGVYFTLLTEPDTKGSELAEWLSTQSPDCTPEQASEFINELISHDLLKRELDDWIVCNSLTK
>NZ_CP046412.1|WP_140060563.1|597588_597819_-|hypothetical-protein
MANQKMISVHKWGEQNLDPVPSRQSLNRYARTGQLGALAKKIGNYWYVPEDAVFVGISGIGIDETDETLTRIFANG
>NZ_CP046412.1|WP_156216733.1|596441_597596_-|tyrosine-type-recombinase/integrase
MARPRKDSIDVPNLYRKKDKRNGKVYYQYKNQVTGRFVSLGTDKNKAIESAVKANRVIEERGLMQILQEQKRQNDKVEREHGVLITEFCDKLLKRFEMYEFAKLSESTVKEKKRHLEILRNRFGTIRIKRISVLDINALLDEYVEDGKLSAAKTLRSYLSIFFKEAQYMGFVDSGFNPALSTRPIEAKVKRARITESDFSVFWENCQNGKSKHFIDSVKIAVTTGLRRSDIVNLKFSDVSDGYLHVSLGKSRGKTNLAFPLKMKNPLIGETLGEIISGCRRKVVSRFVVHHQNSAPRVKIGGQVNPSSLSQSFRAIWDKSGIKTVSGKTAPTFHELRSLCVRSYGSGAGDLQKLLGHADQNTTEVYLDERDKAKINYIDVPEVA
>NZ_CP046412.1|WP_156216731.1|596081_596330_-|hypothetical-protein
MEDKELDKLCESLAHIQLLANMTKTQLGRVTNDELRERLESINQRALTVHRELSALRHPEHMKVRSKQAKRIMDGRPNLKLV
>NZ_CP046412.1|WP_156216729.1|595370_595877_-|hypothetical-protein
MSKQLERLSFAGLKTTKLSATSGIRVTGEKLSQSDIAYALSGLGVEATAWASLAYVNSNDEKSLNMLVSRISQLLLRRYPKTPPKVLIGLVKVCFHEALINDRKLENGEKTERKGLTTAAKARAMGINRSSFYKNKDRYDEIINAVMYVINRWESQIEENVRSRLAKE
>NZ_CP046412.1|WP_156216728.1|594954_595260_-|hypothetical-protein
MARLREDTPHFVIDDLAQAVADGLSMLPKLPRRWLGKYGTLSTDMPKFAKSELAQKEVFNKLKSEYLELLEEASQVEIKITARDRYIGLPSHNVLASRLPD
>NZ_CP046412.1|WP_140060559.1|594202_594691_-|hypothetical-protein
MARPTKRTKKRDEAFFRAYEMTANKKLAAEQAGYSIASVHRYLKDEDFASRVREIDTSHIWALEGAALDFALHGDREIKTIKVYDKALGKEVSKVIEQRKHSAAMMQYILSRKDPNAWDKETIKHNRDLNEDIDDLPLDAICQDLGSMLKAFLEVPDDIREE
>NZ_CP046412.1|WP_031501779.1|593914_594196_-|hypothetical-protein
MSTKTGKYEINPDTIVLSPEAIQLFRKLLSREESETQRLFDVAAHWPKAERENLEDLADKASIKPLAELESFVRTQELMRMYKRKAEQESKPA
>NZ_CP046412.1|WP_031501780.1|592854_593667_-|hypothetical-protein
MNQQQLIALLLQAINGGNQQQNPLQQLLGGQQNRQQDILSLLTGGGNQNPLQSLLGGAQQPQLDANTLTLLVQQLQGGQQPQQQPQIDPQILTALQTALGGQNGNAGKGNDLLELLKGKTDNSQEEDLRDAIKFNLEFGKFIEDYQDCFPSWFEPNEAIEQVEKWAKNDAEKAQALAAATVKAFFKNEDAMELLEERDRNFVNEHILKEGVKESQIDRKLAWPMMQRALHNKNTLAERGAIPSVGKGEEAIRNYEAIFTRGQQANDAPAE
>NZ_CP046412.1|WP_156216726.1|592114_592666_+|hypothetical-protein
MQALSVSAALTLLTSVVSSIGTIATVAIAARALSSWKAQLKATDRRELSHSMFEVLVHFIQLNREFRLKCESWLYNEKMDNERAKIQTEIFDTMCQLERHLLKLYLLSDIDEAQFCKFQDDLRSLVNMADHIRFEIISFHYMDEEDKTVEARVGTMIKTCRPHIELLTSFQKEFTALLKINFQ
>NZ_CP046412.1|WP_140060851.1|598762_599215_-|hypothetical-protein
MGKNQSNERYGKRARFSQMPDYVENSISFIELNAPAKELLRRILQQYRGHNNGDLTAIWNNLKPVLSMKNERTFIKALNELIDNELLVFNGLGSTSRKGGRAPHLYALAWLDVNVIIEGGEKSTNHNRTPPRKHWEQHPAALDLVNKKIL
>NZ_CP046412.1|WP_140060850.1|599265_599514_-|hypothetical-protein
MDLKNLEQRLEKLNEMRKQAANDPEFQELAKEHESSIKNEVEKESVLSRERDKRPTRKHKPRKAKSTTMMLAGSGIDKAIID
>NZ_CP046412.1|WP_140060849.1|599482_599884_-|hypothetical-protein
MENSIFAKFEKTLNTAFVNIRSGNELLFIDVDLSKALFWNYQENMHDLMVECEKFGLTTSKIYTLAACQYDLALMISNVRGKAKVDVTQLTGEELEPHIISALAALECVEFKFMTLMKFVGDKYGFEKFRAET
>NZ_CP046412.1|WP_156216735.1|599883_600039_-|hypothetical-protein
MTYQQEAILKLHQAKAAELTENEKAFLLNAALGALPFNQADEVLMKIMEAK
>NZ_CP046412.1|WP_140065340.1|600038_600293_-|AlpA-family-phage-regulatory-protein
MELSKPTKLLATGKVLELLGVSRSSLDKLGQDGKFPKPLRVVKNRNSWPDSEVRMMILVFSSDASDDVIKSKVKEIEEARKGLI
>NZ_CP046412.1|WP_140065343.1|600567_601416_-|helix-turn-helix-domain-containing-protein
MGGIELATNETRAKPHMIREKTPDYILDEYDAQEFIYLLQLKTPQEKLLYARARIGVSQKDIANYMKVHQVTVSRIEKDPLANQELLYKYCEAVEVDKSWIESRSIGRPFDYSLENAPRMCAIIRIMEEFGEQDDLKVRDASLSFANGSEIAFLEKHFDIDKDQVKSRLIDVRSRIIGASTREMSHQLSVPLTAINATERWTKPHFGYIASLILKLGINPEWLIAGNGNVFDVKGMAYQEIKETVDHILFSVRNNLDLYSFSELDGMIKTIRNISLKEKTKQ
>NZ_CP046412.1|WP_024702170.1|601649_602519_+|DMT-family-transporter
MSTFLLTAITMLAFAANSLLCRLALAEGLIDAGSFTLVRLISGAITLIALLVVRGQWKTDRPTSRFRFFAGVALFGYAALFSFAYLQLATGTGALLLFGAVQLTLLAIYWWQGERFQFLEIIGIGLSIVGFVWLMLPSATRPDISSALLMLISGICWAAFTALGKQAPSPSSGITWGFIAASMIGIFLSPLMLSSIHLSLSGILLAITSGAIASGLGYTLWYQVMRKLSLLQAAVSQLSVPAIALLLGTVVLHESLSLHTLLTSGIILGGIALVFLSRSKKTSEQSASR
>NZ_CP046412.1|WP_025790613.1|602906_605081_+|fusaric-acid-resistance-family-protein
MNDKIKFAIKVSLSLTLAYLIPFAMGWPQASTAATTVMLIASTGSRRESLAKGTLRVFGTLVGAVVGLLLVGLFAQDRLLYMLSVSVVVSFIFYFRNAYQKDPTLLMLTGVMTLMMSNGGDAEGAFLYGVDRAYMTVFGVVVYTLVGTFLFPTKTEQNLRQLIEQLNQAQRALFTAILQNFEQKSARQLSTLEEGEENPEAEEPQPNVDSLIEQMFAAQNALEQRFATVSVECSDVSAYMKEWRLAVHLNKQVTQQLTVAAHSHFSHQQDRESISNFDQAVAEIDALFDTCQQVWDEKEPAFRAQEFKVEYNQALLEDAAHLEKGSALMLGHLLGLMHQNLSRLAESISCIDSVTNNVSFDVPLPKPKGKFLWWDAENFKTAVKTFVTYWVAGLIWIYFNPPGGYSFVIFSTMFMSLLSFVPVHPILLLVLFTFGFLFAVPSYVFILPQLDLGLELGLFIFIYTFIGFYLFNGPVTIFYMVGLFVLGLDNNMFYHFGILMTIMLLFYMVVFMIIFAHYFPFSSRPEHLFLTIKERYFRHTRDLFDSYQKQSSSIITPLKRALHLVTLNVSSKKLKVWGSKINHKHFDKTTPEAIGAFSKACDVLSNHINILMAAEKKLMTNPLITQLRQQHRDSIIPLMAGALASHQATQELDSVFDQYSQDYQTFEDKLEDFFSELDLSDYAYSEIAGFYILLNLKRNVFEAIKHCKQTYEDIDWVNLQQKRF
>NZ_CP046412.1|WP_025790611.1|605091_606735_+|membrane-protein
MMLPKLTKPSLAILSLLGLSACTTVGPDYVHPPQTPLPSDWSVQKAAKDTQQSEQQLQQWWQQFNDPTLNQLVELANEQNLDIEAAGLRIAQARSLLGISTGLQYPQVQTVSGNLARAYVNDQGVNNAALSFDAAWEMDIWGKYARGIESAEAGYYASIASYHDIMVTITAEVARNYINYRTFQERILLSRRNIEIQERVVHITQVQFDSGNVTELDVQQAKNQLYTTKAAQPSLEVAMKQSRTALALLLGVLPEEVEKLLQSDGLTQQIADYEAQFKSTGRKSALSGTDEHSIVPRPPLLDTQVDANLVMRRPDLQVSEMQARAQSAQIGVAETALYPSFSLFGSIGIDSTVPDGSSFSFSDSLTMVVGPTFSWNIFQYGRVKNNIRFEDARFQETLTNYNKKVLQAVNEVTNAIEAYDLYLQQKDLRLQSVNSSIRAFNISMTQYENGQISFERLLNSVEKMTRAEDSYAQIKGNVANQVIALYKALGGGWQAQTGKPFLEESIAKQMQDRTDWDGYLDEENRTLPPLPIETPTENGDKNKTEDL
>NZ_CP046412.1|WP_005462724.1|606734_606938_+|DUF1656-domain-containing-protein
MPHELSWGDIYFSPTLLVLFLAVTATWITVMILNKTRLSRFIAFPSLTFIAIMVGYVVAIDSFYIQF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP046412_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046412_2

874652-874749

Orphan

Consensus_repeat	Method
TATTTTTAAAATGCCTTTTCAAAAA	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP046412_2

>merge|NZ_CP046412|2|874652-874749|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAATTTGAAACCGCGCAATTAAAGAATCCAGAAAAACAAGATCGCAATCAATATTTTTAAAACGCCTTTTCAAAAA

>NZ_CP046412|2|2|874652-874749|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAA	TTTGAAACCGCGCAATTAAAGAATCCAGAAAAACAAGATCGCAATCAA
TATTTTTAAAACGCCTTTTCAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046412.1\|WP_025521120.1\|871145_871856_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236392
NZ_CP046412.1\|WP_005482884.1\|878245_879175_+\|sugar-kinase	unknown	unknown	gnl\|CDD\|238571
NZ_CP046412.1\|WP_005460834.1\|879186_879810_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	unknown	unknown	gnl\|CDD\|235577
NZ_CP046412.1\|WP_005467181.1\|876161_876482_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380366
NZ_CP046412.1\|WP_005482867.1\|871858_873727_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225457
NZ_CP046412.1\|WP_031858472.1\|864633_865038_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_025790395.1\|877235_878147_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP046412.1\|WP_005482916.1\|874849_875611_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	unknown	unknown	gnl\|CDD\|181605
NZ_CP046412.1\|WP_005460779.1\|876522_877158_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	unknown	unknown	gnl\|CDD\|181746
NZ_CP046412.1\|WP_005464972.1\|870275_871145_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176159
NZ_CP046412.1\|WP_005482833.1\|866138_866600_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|226429
NZ_CP046412.1\|WP_025790394.1\|879995_881735_-\|transporter	unknown	unknown	gnl\|CDD\|271371
NZ_CP046412.1\|WP_005464959.1\|865047_866139_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP046412.1\|WP_025501292.1\|869388_870195_+\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NZ_CP046412.1\|WP_025790400.1\|867045_867885_-\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|178061
NZ_CP046412.1\|WP_005482845.1\|881864_882542_+\|porin	unknown	unknown	gnl\|CDD\|368776
NZ_CP046412.1\|WP_005497702.1\|873810_874608_-\|DNA-binding-transcriptional-regulator-KdgR	unknown	unknown	gnl\|CDD\|185046
NZ_CP046412.1\|WP_005497706.1\|875629_876154_+\|YgjV-family-protein	unknown	unknown	gnl\|CDD\|378474
NZ_CP046412.1\|WP_025790392.1\|882557_884786_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_005464962.1\|867946_869095_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260

Protein	Function_ID	Function_description	E-value
NZ_CP046412.1\|WP_025521120.1\|871145_871856_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|236392	PRK09146, PRK09146, DNA polymerase III subunit epsilon; Validated.	7.6349e-39
NZ_CP046412.1\|WP_005482884.1\|878245_879175_+\|sugar-kinase	gnl\|CDD\|238571	cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.	1.15929e-102
NZ_CP046412.1\|WP_005460834.1\|879186_879810_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	gnl\|CDD\|235577	PRK05718, PRK05718, keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional.	4.28455e-121
NZ_CP046412.1\|WP_005467181.1\|876161_876482_+\|cupin-domain-containing-protein	gnl\|CDD\|380366	cd02238, cupin_KdgF, pectin degradation protein KdgF and related proteins, cupin domain. This family includes bacterial and archaeal pectin degradation protein KdgF that catalyzes the linearization of unsaturated uronates from both pectin and alginate, which are polysaccharides found in the cell walls of plants and brown algae, respectively, and represent an important source of carbon. These polysaccharides, mostly consisting of chains of uronates, can be metabolized by bacteria through a pathway of enzymatic steps to the key metabolite 2-keto-3-deoxygluconate (KDG). Pectin degradation is used by many plant-pathogenic bacteria during infection, and also, pectin and alginate can both represent abundant sources of carbohydrate for the production of biofuels. These proteins belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	1.13072e-54
NZ_CP046412.1\|WP_005482867.1\|871858_873727_-\|CBS-domain-containing-protein	gnl\|CDD\|225457	COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].	2.84814e-139
NZ_CP046412.1\|WP_025501292.1\|869388_870195_+\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	1.53608e-97
NZ_CP046412.1\|WP_025790395.1\|877235_878147_+\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	9.77625e-18
NZ_CP046412.1\|WP_005482916.1\|874849_875611_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	gnl\|CDD\|181605	PRK08993, PRK08993, 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD.	0
NZ_CP046412.1\|WP_005460779.1\|876522_877158_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	gnl\|CDD\|181746	PRK09273, PRK09273, hypothetical protein; Provisional.	2.15977e-144
NZ_CP046412.1\|WP_005464972.1\|870275_871145_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176159	cd08470, PBP2_CrgA_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.14139e-108
NZ_CP046412.1\|WP_005482833.1\|866138_866600_-\|oxidoreductase	gnl\|CDD\|226429	COG3915, COG3915, Uncharacterized protein conserved in bacteria [Function unknown].	3.9997e-40
NZ_CP046412.1\|WP_025790394.1\|879995_881735_-\|transporter	gnl\|CDD\|271371	cd11477, SLC5sbd_u1, Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain. SLC5 (also called the sodium/glucose cotransporter family or solute sodium symporter family) is a family of proteins that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. Prokaryotic members of this family include Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	6.75594e-109
NZ_CP046412.1\|WP_005464959.1\|865047_866139_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	5.06677e-44
NZ_CP046412.1\|WP_025790400.1\|867045_867885_-\|S-formylglutathione-hydrolase	gnl\|CDD\|178061	PLN02442, PLN02442, S-formylglutathione hydrolase.	6.2564e-142
NZ_CP046412.1\|WP_005482845.1\|881864_882542_+\|porin	gnl\|CDD\|368776	pfam06178, KdgM, Oligogalacturonate-specific porin protein (KdgM). This family consists of several bacterial proteins which are homologous to the oligogalacturonate-specific porin protein KdgM from Erwinia chrysanthemi. The phytopathogenic Gram-negative bacteria Erwinia chrysanthemi secretes pectinases, which are able to degrade the pectic polymers of plant cell walls, and uses the degradation products as a carbon source for growth. KdgM is a major outer membrane protein, whose synthesis is strongly induced in the presence of pectic derivatives. KdgM behaves like a voltage-dependent porin that is slightly selective for anions and that exhibits fast block in the presence of trigalacturonate. In contrast to most porins, KdgM seems to be monomeric.	3.08357e-24
NZ_CP046412.1\|WP_005497702.1\|873810_874608_-\|DNA-binding-transcriptional-regulator-KdgR	gnl\|CDD\|185046	PRK15090, PRK15090, DNA-binding transcriptional regulator KdgR; Provisional.	0
NZ_CP046412.1\|WP_005497706.1\|875629_876154_+\|YgjV-family-protein	gnl\|CDD\|378474	pfam10688, Imp-YgjV, Bacterial inner membrane protein. This is a family of inner membrane proteins. Many of the members are YgjV protein.	9.00507e-50
NZ_CP046412.1\|WP_005464962.1\|867946_869095_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0

>NZ_CP046412.1|WP_005497702.1|873810_874608_-|DNA-binding-transcriptional-regulator-KdgR
MKGATMEKSTQPEAVSSVLKVFHILQALGEQKAIGVSELSQRLMMSKATTYRFLQTMKSLGYVSQEGEADKYSLTLKLFELGAKSLEYVDLIELADKEMRHISEQTNEALHLGALDENAIIYIHKIDSGYNLRMQSRIGRRNPLYSTAIGKVLLSERDESFVRDVLSDVEFIKHTEKTLENTDQVLEELAKVRDFHYAEDNEEQEPGLRCIAAPIYDRFGQIIAGLSISFPTIRFDEERMEYYVGLLHQAGKNISEQLGYHDYPA
>NZ_CP046412.1|WP_005482867.1|871858_873727_-|CBS-domain-containing-protein
MGTSVTPNIFDFLIKIDPFDKLPEPVVESIANSVKVKYLVRGETIGFSALCDQRYLYIIRTGAIEQRTPNGELRARLGQDDQFGFTFLDPLENAEDGYQAEAIEDSLLYLIPHSELKLVSEEHPEFADYFAAQANVRLSSAVKYVCRKEEKGLFFRTVGEIASENIAIVDVNDSIRSVAQTMCGKQRSSCAVVMKEGEIIGLVTDRDMTKSVVAQDMDTNQPIADVMTPNPVLIEDDAKVIQAISLMLQYNIRCLPVVHGKQVKGLLTTTHLVHNHRTQSLFLIEKIKYASSLNALAALKEERQTIFQALVESGVSAEIQGRVMSMIMDAFTRRIIQLNEELLGPPPCDYAWLVAGSHARNEVHMLSDQDSAIVLSDDATEEHKLYFTHLAMRVCNGLAACGYPLCDGKYMAASPKWCQPIRRWKEYYQKWVASPEYNKLLSISVFLEVRAIHGNREFVDQIQQHLHDCIQKSPSFIPALVRDAIDTQPPLGIFNNLVLEKGGENSNTLNIKKYALNLIIDLARIFSLAAGGSLTGTEERFRYAAQHGTLSKDSVENIIGAYRFITQVRFRHQLNAILAGTTPDNHIAPDDFSSFERKHLKDAFKIISELQDVAKLKFVKGA
>NZ_CP046412.1|WP_025521120.1|871145_871856_-|DNA-polymerase-III-subunit-epsilon
MIKRWFKRWETPLSPEQKRQAIHVIDDWPMVLKDYLQRPLVDDSTTLRDLSFVALDFETTGVDAQGDKILSIGVVDLTLDGIDIASSKEWYICHGQFIKPETAKINGLTPQDLAKGLPLDEGMNRLLERITGKVVLAHGCCIEKAFIHAYFSSRYQVEDFPAYFIDTLQIEKQFSYAGKSGAHSSYQLDDLRRYYHLPGYLSHSAASDALACAELFLVQSKKLTALPDVTLRQLMR
>NZ_CP046412.1|WP_005464972.1|870275_871145_+|LysR-family-transcriptional-regulator
MANWEGVSEFVAVAETNSFTGAAAKLKTSVAQISRRVSALEERLAVKLLHRTTRKVSLSEAGQLYYQQCKHLVEGLELAELAVTQMQTEPRGLLRVTAPVTYGEMNLAPLLHQFLEKYPRVDLDLVLTNQKLDLIEQGVDVAIRLGRLQDSSMIAKRLSSRQTYVCASPMYLERFGEPHTLSELGRHQCLVGSVDYWHFKENKRDKSLRVSGRIKCNSGFALVDAAKRGLGLVQLPDYYVQEALDSGELVEVLTDYRDDREGIWALYPQSRNLSPKVRLLIDFLAQELA
>NZ_CP046412.1|WP_025501292.1|869388_870195_+|arylamine-N-acetyltransferase
MNKTDLNAYLTKLGLPSELPADLESLHKIHVAQHRCLPFENFDISLQRGISVEIEDIIQKTVYHSRGGYCFELNGLMLDVLKTLGFEARSLLGRVHVMGTPTGRSHQITLVTLDEQAWIVDVGFGSNTPRAPLPFILNQVIQTDLQTFRFVEDAQFGYFLQVLSTDGTDTWNNLYSFDLEFVFAGDIACGNFFTSTSPHSRFTSARVAAKATESGLVTLLNYTLKYTSEGEQTELELEPGQAYLDALKEYFGIELDAQYGDLRPLPDA
>NZ_CP046412.1|WP_005464962.1|867946_869095_-|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MTLEIKPGQTHIKSKAMVAWAAGEPLKMEEVDVQLPKAGEVLVRIVATGVCHTDAFTLSGDDPEGIFPSILGHEGGGIVEMVGEGVTSVEVGDHVIPLYTAECGECKFCKSGKTNLCQAVRETQGKGLMPDGTSRFSINGETIFHYMGCSTFSEYTVLPEISLAKVNKQAPLEEVCLLGCGVTTGMGAVLNTAKVEKGDTVAIFGLGGIGLSAIIGARMAGASRIIGIDINESKFDLAKQLGATDVINPQKFDKPIQEVIVEMTDGGVDYSFECIGNVNVMRQALECCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRSELPEIVNRYMAGEFGLQEFITHTMGLEDVNKAFDLMHEGKSIRTVIHMDK
>NZ_CP046412.1|WP_025790400.1|867045_867885_-|S-formylglutathione-hydrolase
MTIENVSQTKVFGGWHKQYTHDSKALNCTMRFAIFLPPNATKSNPVPSLYWLSGLTCTDENFMQKAGAFRMAAELGIAIIAPDTSPRGEGVADDASYDLGQGAGFYLNATQAPWSLHYHMYDYVTQELPAIIEANFPVSDVKSISGHSMGGHGALTIGLKNPTLYRSISAFSPISNPMQCPWGQKAFTAYLGTDIESWKQYDASELLKKEKSPLPILVEQGDADGFLSEQLKPEVLLAAAKQHGSELNLRMQSGYDHSYYFISSFIDNHLNFHAKYLFA
>NZ_CP046412.1|WP_005482833.1|866138_866600_-|oxidoreductase
MKKIVSLSLLLFAPFLSANSITFSSPQQPSVTLKLEELQSLPTTSYTTDLPWIQQSSEFLGVKLSTLLTHVYGSIPEQVDIGSLNNYHSTLSRKDIVRYQPILAYQQDHHYIKVRNKGPYWVIYPLSQYPELDHNEYHAQMVWQVNEMKIKQK
>NZ_CP046412.1|WP_005464959.1|865047_866139_-|GGDEF-domain-containing-protein
MKLSEAYPIKQKNYSTTSKMLLLVFATSLLLANVILLQQTRVLAQSFTDEQKQATWFLFQLSKELSELVSEARRLDENVLKIEGAELQYELAWSRFDLLINSKDVYTFFSRNHIQQYFLQLFNEFKELEPLLVEAKTGDSQAAAQFYRATQTLYLNLVEFVNQNFRLTSQVYETQKDESQRLMKAQYMLFATFVLSILSLTYFFYRESHFHRKLALSDPLTGLGNRNALFVTLRNNTRNRTAFSLCLLDLNGFKNVNDTYGHQAGDTVLCEIAKRLKDMNIDSFSTYRMGGDEFAVVIESSDVDAEEAKKHIHSVFDTPVLNANNVSSLSTSIGVAHYPSDSDNVDFLISIADKRMYKMKFQR
>NZ_CP046412.1|WP_031858472.1|864633_865038_-|hypothetical-protein
MMRKFMQVLLLLAVIAAGVLAWVFIPSHETIGQKTLEQALNDDYSLVGHRIYSTDPDAGNRFGYFVLATGQGIEEQEPFLVTSDQFIRMEQTGDNTLSVTVNGHIYQYHNDLWVPKSDGKLQHFLVSATTNYVR
>NZ_CP046412.1|WP_005482916.1|874849_875611_+|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD
MILDSFNLEGKVAIVTGCDTGLGQGMALGLAKAGCDIVGVNISEPTETIEKVEAEGRKFVDIRANLMKLDDIPTIVDRAVTELGRIDILVNNAGIIRRNDAIEFSEQDWDDVMNINVKSVFFMSQAVAKQFIAQGEGGKIINIASMLSFQGGIRVPSYTASKSGVMGVTRLMANEWASHGINVNAIAPGYMATNNTAALRADEQRNKEIVDRIPAARWGTPEDLAGPCVFLASKAADYINGYTIAVDGGWLAR
>NZ_CP046412.1|WP_005497706.1|875629_876154_+|YgjV-family-protein
MVDTTILAQALGFISFGLGFSVFYQKNDRHLKILMLIFNLNHLLHFLLLGSMVSALSALLSALRTTTAIFVSSKRVAAVFIVISLVSGFWVAEQWRDLWPIIGTVIGTYSVFCLSGIRMRIGFLLGASCWLTNNILVGSIGGTLLEMTVIVMNLLTIYRLHRQQSESMINQSSY
>NZ_CP046412.1|WP_005467181.1|876161_876482_+|cupin-domain-containing-protein
MFVFNQDIPMEDLGEGISRKVLAHSDNMMSVEVHFEEGAIGAMHSHPHEQLTYVLSGEFEFTIGDEKKIVKTGDTMYKEPNIEHGCVCLKAGVLIDTFTPMRKDFV
>NZ_CP046412.1|WP_005460779.1|876522_877158_+|RpiB/LacA/LacB-family-sugar-phosphate-isomerase
MKIALMMENSQAAKNAMVAGELNSVAGGLGHDVFNVGMTDENDHHLTYIHLGIMASILLNSKAVDFVVTGCGTGQGALMSCNLHPGVVCGYCLEPSDAFLFNQINNGNAISLAFAKGFGWAGELNVRYIFEKAFTGKRGEGYPIERAAPQQANAAILNNVKSAVAKDVVEGLRAIDQELVKTAVGSTQFQECFFAHCQVPEIAEYVKSLLD
>NZ_CP046412.1|WP_025790395.1|877235_878147_+|alpha/beta-hydrolase
MHVAPITSLQTWFPEHLVLPLWSEPQIPSHLVQSYQERNPNELLPDRAVFEITHPEIVVFEPEQSNGIGILLMPGGGYQRVSVDKEGADSTRVLNQAGFTVFVMTYRMPNEGHEFGAWTPLADAQRAMRLVRQLPLASHLSSIGVLGFSAGGHVAASLATSHALDIYPLQDEADRVSAKPDFCALMYPVISMNTDIAHMGSRAELLANLERESDLLRFSLEKQVTSDMPPCFLLHASDDTAVSVENSVVFWQALRQHEIAIEMHLFEQGKHGFGIRDAQGLPVAAWPQLLSAWLQNLAEKARR
>NZ_CP046412.1|WP_005482884.1|878245_879175_+|sugar-kinase
MNPISRVAIIGECMVELKKHDGVLQQGFGGDTLNTAVYLSRLTKQHGVETSYVTGLGHDPFSREMLTAWREEGINTDMVYLSEDKLPGIYAIETAEDGERSFFYWRNDAAAKYWLRERALLSLVKDLCQHQMIYLSGISLAIISDDCRQMLIELLTMCRKEGVKIAFDNNFRPKLWPNIEQARDFYSKILSVTDMAFLTFDDEVMLWGDKHEDEAISRTKNFGVKEIIVKRGADDCFVVTQDQQHTVAALKVDAVVDTTAAGDSFSAGYLAKRILGGDVAESALAGHKVAGTVIQHRGAIIPSQAMPTI
>NZ_CP046412.1|WP_005460834.1|879186_879810_+|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase
MKDLNQQLSEIKVVPVIAIKDAGKAVKLAQVLIENGLPCAEVTFRTEDAALAIKNMREAYPEMLIGAGTVLTSAQVDEAIDAGVDFIVSPGFNPTTVKYCQQRNVTIVPGVNNPSLVEQAMEMGLRTLKFFPAEPSGGVAMLKALSAVYPVKFMPTGGVSPSNVKDYLSISSVLACGGTWMVPGDLIDNEQWDELAKLVREVAGIIE
>NZ_CP046412.1|WP_025790394.1|879995_881735_-|transporter
MTLLDSMIVMIYLLFIGIAAWLFRRFSTSSNDFLQGGGTMMWWMAGATAFMTQFSAWTFTGAAAKAYEDGISVMFIFWGNALGFFVAAAFFARRYRRLRVETAMEVIRVRFGHTSEQLFTWLSFPLTLIACAIWMNGLASFFSAVFAIEMSTTILAMGVVVTLIAVSGGAWTVSVTNVIQLILLIAITLVIGYTALQRFDSPSEVFAHATPIYGEQIRMPSLFVMWAIAMLLQQTMSNNHTLSCYRFLTTANDKDATKAAFVAGVLFVFAPVLWFMPAWFVAAQNIDLLAIYPALEQSANNAAYLYYIQHYMPQGLLGLVMVALVAATIAPLSSAHNRNAGIVVKSLYQVWFNPNATSRQQLMVGKIATIVSGVLATVTALLLASVESYSLFDMMIVFGAFIQMPINIPSLLALVSLKTPNWSGWATVMVGCAVSLFMMFIFDAQWLSSLPLTPRESKDLSVVATLAVHLLVTGGFFLFTQVFYAKESPSIQQSRTALAIQLATPISDEELSPINHKQGLYVGSITALAGMLLILAGVVLAGSSQSIFVAIGCIVLLFSLFLLQPTQHSKRAWQKQKTK
>NZ_CP046412.1|WP_005482845.1|881864_882542_+|porin
MKVRYLTSALLLAMTSGLAAAASVDIRHEYVPDRDGDEHRDRIYVSHRFDNQIGFSVEAKWNYKDGHMGNAGHETGVSYRWKATDNFSLTPGINIDASPSGASVFKYNLTGAYKINDEWDVAARIRHGYKNTDDSRYNQLNLYANRKFEWGKLGVEAEYKDIHGGEGGWKDKGHDQLIDFKGEYTKLESGVIPFFAIAAITHKGDGSEFKDEYVPRFRVGLKYNF
>NZ_CP046412.1|WP_025790392.1|882557_884786_+|hypothetical-protein
MKKHTLALCLAAILAPAAHAAEIKVEDLTWKAITFGQSTDMNFGSTILPEKVGVNQVTFNGEAVAAGKLASTFTIESRGGKLANSHEGLTFYYTELPTDVNFTLSADVVLEQLGPETGATPNRQEGAGLMVRDILGAERLVPQPEGHEEFPSASNMVMNLMRSHTRTNDGMTNINASFREGVYQPWGTPGNRLSRVDYVEGVPYGTAETYRMTLTRTNDGFKVSYRNGEKFVEQAVKGANANIVEMQNSDSQYVGFFASRNAKMTVSNVDLQLAAADTVDAPKYAAKQGELVFQIASSPRSATKEYPVQARANYSGEFEVLHNGKVVAKQTVTAGELFSQWLTLDSGANQMEVRFTAIDGPNKETQAHLYSVDVVSLPDPMTLYVAPNGSDKGNGSQAQPLDLATAVELLPAGGTIILKDGDYQGMEIPLTASGSVDKLKHLRAEGDNVRFVSELRHEANYWHYQGIEVAGAQFIVHGSHNTFEKMVTHGAPDTGFVITSPENIGRALWASYNQVIESESYNNMDPSQINADGFAAKMRIGDGNTFIRCLSHHNIDDGWDLFNKVEDGANGAVTILDSISFSNGRTLDVANKGGTIGNGFKLGGEGIPVPHVVKNSLSFNNNMDGFTDNFNPGALVLSDNVSIDNKRFNYLFRKSPYSGEIEQGTFTNNRSYRFHVSSKYDDVINSAKSTGNALVENGTTYTSDGKAVDSKTLAPLKQASVIDTQQAIPGKQEAMQLKQLIH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP046412_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046412_3

1454416-1454549

Orphan

Consensus_repeat	Method
GGCGGTCGTCGTGAAGGTGGTTTCCGTGGTAACCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046412_3

>merge|NZ_CP046412|3|1454416-1454549|CRISPRCasFinder
GGTGGTCGCCGTGACGGTGGTCGTCGCGATGGCGGTCGTCGTGAAGGTGGTTTCCGTGGTAACCGCGAAGGTGGCAACCGTGGTGGTGAGCGTCGTGAAGGCGGTCGTCGTGAAGGTGGCTTCCGTGGTAACCG

>NZ_CP046412|3|3|1454416-1454549|CRISPRCasFinder
GGTGGTCGCCGTGACGGTGGTCGTCGCGATGGCGG	TCGTCGTGAAGGTGGTTTCCGTGGTAACCGCGAAGGTGGCAACCGTGGTGGTGAGCGTCGTGAA
GGCGGTCGTCGTGAAGGTGGCTTCCGTGGTAACCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046412.1\|WP_015313061.1\|1449486_1450290_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225117
NZ_CP046412.1\|WP_025791309.1\|1460627_1461179_+\|membrane-protein	unknown	unknown	gnl\|CDD\|227700
NZ_CP046412.1\|WP_020835089.1\|1462113_1462959_-\|gamma-carboxygeranoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|235664
NZ_CP046412.1\|WP_080277398.1\|1444537_1445800_-\|anaerobic-sulfatase-maturase	unknown	unknown	gnl\|CDD\|188457
NZ_CP046412.1\|WP_017448084.1\|1442160_1444530_-\|arylsulfatase	unknown	unknown	gnl\|CDD\|293749
NZ_CP046412.1\|WP_017448089.1\|1450361_1452368_-\|exoribonuclease-II	unknown	unknown	gnl\|CDD\|179920
NZ_CP046412.1\|WP_025791307.1\|1461214_1462117_-\|hydroxymethylglutaryl-CoA-lyase	unknown	unknown	gnl\|CDD\|180206
NZ_CP046412.1\|WP_005483382.1\|1456652_1457846_+\|acetate-kinase	unknown	unknown	gnl\|CDD\|183528
NZ_CP046412.1\|WP_140247776.1\|1441100_1441196_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_080277428.1\|1441203_1442130_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176155
NZ_CP046412.1\|WP_005498481.1\|1458124_1459438_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|206779
NZ_CP046412.1\|WP_005462121.1\|1448044_1448872_-\|phosphate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270371
NZ_CP046412.1\|WP_025791305.1\|1462996_1464601_-\|methylcrotonoyl-CoA-carboxylase	unknown	unknown	gnl\|CDD\|178415
NZ_CP046412.1\|WP_017448090.1\|1454753_1456355_-\|bifunctional-diguanylate-cyclase/phosphodiesterase	unknown	unknown	gnl\|CDD\|238923
NZ_CP046412.1\|WP_005483343.1\|1456494_1456620_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046412.1\|WP_005485953.1\|1459723_1460602_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP046412.1\|WP_025791316.1\|1447309_1447990_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239534
NZ_CP046412.1\|WP_025791303.1\|1464635_1465805_-\|isovaleryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173845
NZ_CP046412.1\|WP_017448087.1\|1449083_1449482_+\|DUF3024-domain-containing-protein	unknown	unknown	gnl\|CDD\|371425
NZ_CP046412.1\|WP_020835083.1\|1445911_1446865_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656

Protein	Function_ID	Function_description	E-value
NZ_CP046412.1\|WP_015313061.1\|1449486_1450290_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	5.04109e-25
NZ_CP046412.1\|WP_025791303.1\|1464635_1465805_-\|isovaleryl-CoA-dehydrogenase	gnl\|CDD\|173845	cd01156, IVD, Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA dehydrogenase (IVD) is an is an acyl-CoA dehydrogenase, which catalyzes the third step in leucine catabolism, the conversion of isovaleryl-CoA (3-methylbutyryl-CoA) into 3-methylcrotonyl-CoA. IVD is a homotetramer and has the greatest affinity for small branched chain substrates.	0
NZ_CP046412.1\|WP_080277398.1\|1444537_1445800_-\|anaerobic-sulfatase-maturase	gnl\|CDD\|188457	TIGR03942, sulfatase_rSAM, anaerobic sulfatase-maturating enzyme. Members of this protein family are radical SAM family enzymes, maturases that prepare the oxygen-sensitive radical required in the active site of anaerobic sulfatases. This maturase role has led to many misleading legacy annotations suggesting that this enzyme maturase is instead a sulfatase regulatory protein. All members of the seed alignment are radical SAM enzymes encoded next to or near an anaerobic sulfatase. Note that a single genome may encode more than one sulfatase/maturase pair. [Protein fate, Protein modification and repair].	0
NZ_CP046412.1\|WP_017448084.1\|1442160_1444530_-\|arylsulfatase	gnl\|CDD\|293749	cd16025, PAS_like, Bacterial Arylsulfatase of Pseudomonas aeruginosa and related proteins. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.	0
NZ_CP046412.1\|WP_017448089.1\|1450361_1452368_-\|exoribonuclease-II	gnl\|CDD\|179920	PRK05054, PRK05054, exoribonuclease II; Provisional.	0
NZ_CP046412.1\|WP_025791307.1\|1461214_1462117_-\|hydroxymethylglutaryl-CoA-lyase	gnl\|CDD\|180206	PRK05692, PRK05692, hydroxymethylglutaryl-CoA lyase; Provisional.	6.52207e-177
NZ_CP046412.1\|WP_005483382.1\|1456652_1457846_+\|acetate-kinase	gnl\|CDD\|183528	PRK12440, PRK12440, acetate/propionate family kinase.	0
NZ_CP046412.1\|WP_005485953.1\|1459723_1460602_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	5.12613e-12
NZ_CP046412.1\|WP_080277428.1\|1441203_1442130_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176155	cd08466, PBP2_LeuO, The C-terminal substrate binding domain of LysR-type transcriptional regulator LeuO, an activator of leucine synthesis operon, contains the type 2 periplasmic binding fold. LeuO, a LysR-type transcriptional regulator, was originally identified as an activator of the leucine synthesis operon (leuABCD). Subsequently, LeuO was found to be not a specific regulator of the leu gene but a global regulator of unrelated various genes. LeuO activates bglGFB (utilization of beta-D-glucoside) and represses cadCBA (lysine decarboxylation) and dsrA (encoding a regulatory small RNA for translational control of rpoS and hns). LeuO also regulates the yjjQ-bglJ operon which coding for a LuxR-type transcription factor. In Salmonella enterica serovar Typhi, LeuO is a positive regulator of ompS1 (encoding an outer membrane), ompS2 (encoding a pathogenicity determinant), and assT, while LeuO represses the expression of OmpX and Tpx. Both osmS1 and osmS2 influence virulence in the mouse model of Salmonella. In Vibrio cholerae, LeuO is involved in control of biofilm formation and in the stringent response. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.38891e-27
NZ_CP046412.1\|WP_025791309.1\|1460627_1461179_+\|membrane-protein	gnl\|CDD\|227700	COG5413, COG5413, Uncharacterized integral membrane protein [Function unknown].	7.02232e-24
NZ_CP046412.1\|WP_005462121.1\|1448044_1448872_-\|phosphate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270371	cd13653, PBP2_phosphate_like_1, Substrate binding domain of putative ABC-type phosphate transporter, a member of the type 2 periplasmic binding fold superfamily. This subfamily contains uncharacterized phosphate binding domains found in PstS proteins that serve as initial receptors in the ABC transport of phosphate in eubacteria and archaea. After binding the ligand, PstS interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The PstS proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.95335e-86
NZ_CP046412.1\|WP_025791305.1\|1462996_1464601_-\|methylcrotonoyl-CoA-carboxylase	gnl\|CDD\|178415	PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain.	0
NZ_CP046412.1\|WP_017448090.1\|1454753_1456355_-\|bifunctional-diguanylate-cyclase/phosphodiesterase	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	7.19213e-91
NZ_CP046412.1\|WP_005498481.1\|1458124_1459438_+\|PAS-domain-S-box-protein	gnl\|CDD\|206779	cd11386, MCP_signal, Methyl-accepting chemotaxis protein (MCP), signaling domain. Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.	3.78527e-45
NZ_CP046412.1\|WP_020835089.1\|1462113_1462959_-\|gamma-carboxygeranoyl-CoA-hydratase	gnl\|CDD\|235664	PRK05995, PRK05995, enoyl-CoA hydratase; Provisional.	8.49648e-98
NZ_CP046412.1\|WP_025791316.1\|1447309_1447990_+\|MaoC-family-dehydratase	gnl\|CDD\|239534	cd03450, NodN, NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit. Rhizobium and related species form nodules on the roots of their legume hosts, a symbiotic process that requires production of Nod factors, which are signal molecules involved in root hair deformation and meristematic cell division. The nodulation gene products, including NodN, are involved in producing the Nod factors, however the role played by NodN is unclear.	4.05192e-69
NZ_CP046412.1\|WP_017448087.1\|1449083_1449482_+\|DUF3024-domain-containing-protein	gnl\|CDD\|371425	pfam11225, DUF3024, Protein of unknown function (DUF3024). This family of proteins has no known function.	5.55354e-20
NZ_CP046412.1\|WP_020835083.1\|1445911_1446865_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	4.87129e-31

>NZ_CP046412.1|WP_017448089.1|1450361_1452368_-|exoribonuclease-II
MFQDNPLLAQLKQQIQENLPKKEGSIKATDKGFGFLEVDSKTSFFIPPAYMKKCIHGDKVVAIIRTENEREVAEPQELIEQSLTRFIGRVKMFKGKLNVVPDHPQLKKLSLKAKLKKGLKPDNFAEGDWVVAHLVRHPLKGDNTFFVEISEKITDADDKIAPWWVTLAQNDLPNSEPAGIENWELKDDADLERIDMTHVPFVTIDGESTKDMDDALYAKKTESGDFELTIAIADPTAYITPEDEMDKVARERGYTIYLPGRNIPMLPRDLADNLCSLIEGEIRPAICCTVTVSKDGVIGDDIKFFAANIKSHARLAYDHVSDWLENGNSDAWQPSEEIATIVRDLYEFSLARAEWREKNAVVFPDRPDYRFELSEDNDVIAIHADMRRSANRLVEESMITANICAGRTLREKFETGVFNTHAGLKPEKIEEVVQLVNPEGTLEFTAESIATLEGFAALRRWLAVQETSYLDNRIRKFQAYSEVGNQPLPHYAMGLDIYATWTSPIRKYGDMINHRMLKAVILDKEPVQKPDDQVGEELALHRKHHKIAERNVSDWLYARTLADEPSKQTCFTGEIFDINRAGARVRLLENGAAAFIPGALILDNKERIECNGDNGTISIDKEVVYKLGDTLEIVLADVNQENRSLVAKPTQVFADQPAAQTEQTVSEE
>NZ_CP046412.1|WP_015313061.1|1449486_1450290_-|helix-turn-helix-domain-containing-protein
MPNIEIIRFNHFTARKSERYTATHNGLYVVEEGALVVHQPNGEQFELQAGDFTLYNSSDLRSAEAIPGENGFKAVALVFDISLFCEFKKAHPGLHSEAEHRRFYPFSPESNSEITQLKNTLLVLASRNAPDYTQSHIAMALLSLMVEVQPDILSIIDDASSLTASQKAIKYIEKNIEKDITLEGLAAHMSMSIATLKRRLAAENLSFSQILKVKRINYAATQLRVSQKSITEIAFESGFKSAAHFSTAFKSIYNITPKDFRNQVVRG
>NZ_CP046412.1|WP_017448087.1|1449083_1449482_+|DUF3024-domain-containing-protein
MALGCILKTTYQENVMSVSQMATSRLYKLVQILCSARNANLPVEQGKCLYEPIENGVELHHAHFLLDSQHSEYTSPIAKILFDSQTQLWRFYVPASRSEEIRWIPYKKLPHSHTLEDLLAELESDPQACFWE
>NZ_CP046412.1|WP_005462121.1|1448044_1448872_-|phosphate-ABC-transporter-substrate-binding-protein
MLRFTVATLLAMAVSLPSAMAKEVNISGSTSVARVMDVLAEEYNKTHPDNYIAVQGIGSSAGITMVNKGVVKLGMSSRYLTESEKGEDLNVFPIAYDGLAVVVNRTNSVTNLSAQQLFDIYKGEIKNWKEVGGADQPIAVVTREASSGSRYSFESLLGLTKIINDRLVSDISPNNLVVNSNSMVKTIVNHNTRAIGFISVGSVDLSVKAIQFNGIEPTAANIANHKYKLARPFLVLYKVDSLDQAGKDFVAFLKSEAGQKTIADYGYIPVKNFNQ
>NZ_CP046412.1|WP_025791316.1|1447309_1447990_+|MaoC-family-dehydratase
MKVTNLFKDKVDAISAHQSEFMNWMSPTLRDYWSDFLGKAQNSFLFSNVRDHNQPAVNEEVAPQPTPIVLQPEAQKLYDELSGKIGEVIHTGDWVHVSQERINQFGAVTEDMQWIHTDPERASVESPFKTTIAHGFLTLALLPKLTDSVDADKPLFPTAKLVVNLGLNQVRFPYPVKAGNNVRAVSTLTKVTPIKKGLEIEREIKVEIEGVRRPGAVVVSVIQLHF
>NZ_CP046412.1|WP_020835083.1|1445911_1446865_+|LysR-family-transcriptional-regulator
MIFNYNLLKPLALLLETKSITATANQMSTSASAVSRTLRSLREIFQDELLTRKNGRMELTPKAISIRAKLNNIIHDIDELTEDMSFDPSTSDIKINIAMNSYIAYWLAPEIIQYFSENAPNIELTIEDWNELTPDRINNQLVHFGIHYFPLNLNKNLVQRKVGKDMSVMVCRKDHPINNESISLETIASYPLAIHLQKHWNERQDKLSRLLLSHGIDFKVKLKTTHINVIINAVETTDLLFPCSIYIAEQLGEKFSYITSSDEVFLPLQEKEFGFIYDKAYKNDPMIVWLHSTISKLMNDFLDVYNKKFDNRYEKSR
>NZ_CP046412.1|WP_080277398.1|1444537_1445800_-|anaerobic-sulfatase-maturase
MVGVEESLMAGLHTTVKVVGSKCNYDCQYCFYLEKDLLLKSKKSMNIETLETYIKNYISSQDTPIVEFAWHGGEPTLIGIDFYEKAVEFQKQYANGKLIKNTIQTNGSKLNSDWCRFFRENNFLVGLSLDGPEWLQEKYRTKQGKSAFKESFSALKLLQKMNVEYNVLACVTKEYCKHAEAIYSFFRKNKVKHIQFSPLVESSPLETEQTRGQHFGSNLIFSTDKHHTDPQKYEPIAWSVDAKEYGRFLTDVFHLWVSQDVGKVFISNFEQALTQYLGNPSQNCIHAKKCGSSYAVEANGDVYFCDHVAYPESKLGNVFETSLHEMSLNHELQFNKESRLSMRCKQCQFLSLCNGGCPKHRYLSDTGEHENVLCDGYFYFFSSVQKYLQAMTTLLAHGYPASYVMQALDGPLILTPSNKR
>NZ_CP046412.1|WP_017448084.1|1442160_1444530_-|arylsulfatase
MDILKTTVTITGALAPCLVAAGTVDRTKLPIPDIEPQTYTQLDVRDVQRPEPTRRIAAPKDAPNVLVILLDDVGFSQSSLFGGAVDMPTLDALAKQGLIYNQFHTTGVSSATRTALLTGRNHHQNNMGSIAETSTAFPGNTSVRPNYIAALPKILKYNGYSTAMFGKNHEIPAWETGPAGNQTLWPSEVGFDKFYGFFGGETDQFQPVLIDGNTRIKTPRKKNYHFTADMTDQTIEWLNLQHSYNADQPFFAYYAPGAAHAPHQAPREWIDKFKGKFSMGWDKLRQESFERQKKLGIIPQDTVLPPMPDFVPRWDSLSSDEKRVFERQMEVYAGFLAHTDHEIGRVIDTLKKNGEFDNTLIFYIVGDNGASAEGNRNGSFNSLAFYNLITEDPNRVLENIDKLGGPDSFPHYASGWAVAGDSPFTWTKGMSSDFGGTRNGMVVSWPAGIDNKGQPLRDQWSHVVDIAPTVLEAANLPVPKEVDGVEQIPMAGVSFTNTFKETKAQTRHKPQYFELGGNRAIYHEGWLARVTHWALTEGSTKFRDLQDDKWELYDTTKDFSLANDLAKSNPQKLEELKKLFDKEAEKNHVYPIDDRTMERVNAEIAGRPDALFGKKSLTLYEGARGIPENSFLNIKNKSFDIVADISTDNASKTNGVIIAQGGNFGGWTLYVKNGVPTFEYNWLTYEYTKVSGSKLKEGKNEIKVAFRYDENGQGGKGNAAGRGKGGNVYLYVNDKLVEKKLIPNTNSRLFSLDDGVGIGEDEGGAVSKDYQAPFEFNQKIEQVTTSIVQ
>NZ_CP046412.1|WP_080277428.1|1441203_1442130_-|LysR-family-transcriptional-regulator
MAQESLRTPVDFPNNSLLEFKMSKAIDLNLINTFIVVTECLSYTKAADKLGVTQPAISASIKRLERTTNTKLFTKRGRNIELTSTAQKWLPQLQQALSVIDSVITQPAPYNVYCSNIYPAQQSKLENVFFHESTLSENHLFSLLYSNEADLLLGDIESREASIIVEDVCREPCVVICRNGHPRIDDHISTEMLSDEKHCVLASKWSFDTEFEKHLGLIVKSNNIDSIASNYLGILTHVAQSDCIGVIPLSLAKKWGKTFNIKHFGSPFGACFIQYQIAYHQRKVNCKRHGAMRALIKSRVLEGQQRII
>NZ_CP046412.1|WP_140247776.1|1441100_1441196_-|hypothetical-protein
MPPYFSTDFIDKKAVVHQRLSVHFHCFNTTD
>NZ_CP046412.1|WP_017448090.1|1454753_1456355_-|bifunctional-diguanylate-cyclase/phosphodiesterase
MPTIAFLLVILGLILLCWGWQMTKNICSKTEVPGWTWLLMLISCFIFAYAAFLHAIMKKPVASLLETGVSLLLFGGSIFVVLVIKWSNDSILELHSVAEREKRNAVHDSLTGLPNRKYCFELIDDRIQSGDPFSVILFDVVNFKQVNDAMGHFCGDQLLIQIGQRLQDKLKGNDKIFRVGGDEFVILTSSACEKTGTELIESLDCALSARFHLDEFQVSSRVVFGISTYPYDAISNDLLIKHADIAMYHAKRNGNLFAFYHDDMNVGAKYQLEISSRIQCALEKEEFQLYYQPLIDANTNLAVGFEAVIRWHDENGKTISPNDFIPIAERSNQVHNITMWVLGQVEKDLKTFIEKGIKLPVHVNLSAKDLSSNLLFHRLEKLLENNPQFADLISLEITETMAIDRVVELNPLIHQIKGLGIKISLDDFGTGYSSLSLLRDLPVDQIKIDRSFLCTANRTEGSRSIVENTIALAHGLGYSVVAEGVQDMDTLYFLRSRGCDIIQGYLFCPALPLNEVINWVNEHDDKQSHTRRA
>NZ_CP046412.1|WP_005483343.1|1456494_1456620_-|hypothetical-protein
MRFRAAYFLFAPLLFNNFLIFQQSFSESDLIEQILLIYSKF
>NZ_CP046412.1|WP_005483382.1|1456652_1457846_+|acetate-kinase
MSNSFVLVINSGSSSLKFAVIDSVSGDAVLSGLGECFGLSDARMSWKFNGEKKEISIEGDDSHHKIAIGKLVGLTEELGLAQDIVAVGHRIVHGGEKFTKTVRITEEVTQEIEKLADLAPLHNPAGAIGIRAAVEAFPSLPQFAVFDTAFHQTMPQRAFTGAIAKELYTDFGIRRYGFHGTSHYFVSREAAKMINKPIEESSFISVHLGNGASVCAINNGESVDTSMGFTPLSGLMMGTRCGDLDPGIIEYLLKKGWSQEKVFNSLNKASGFLGVSGLTSDARGILEAMEEGHEGAALAFQVFTYRVSKYIASYLAALDSFDGIIFTGGIGENSMPIRREILKNLKLLGFVEDVKGNEDARFGNAGVIATSELLGAKALVIPTNEEWVIAQQSVELL
>NZ_CP046412.1|WP_005498481.1|1458124_1459438_+|PAS-domain-S-box-protein
MFFNKSLQQENQRLKQELYSLQQIQQSLDEEMLRLTLDAKGNVTSANQKFLQQLSLSDKDILAKHISDLVPSNVRNTDHFYRMKQSVQAKAFWNGAFQITKGDGEEAWLRVVIQPVRNTSDQVESFFVFASELTRTITTSREYEDMLNALSRSMAVIEFTLDGTVLKANDNFLSTMGYKHEQIVGKHHRIFCLPEEANSSAYHDFWKRLASGQFVTDRFKRVDQYGSVVWLEASYNPIHNDRGELYKVVKFATNITQQVLQEQSMAQAAQLANEVSQETGTQTVQGRQVIGSTLEKMQTLSEQMQQANAAIEDLKAHSSKISELVNSISGIADQTNLLALNAAIEAARAGDHGRGFAVVADEVRQLAMRTNTTTDEIVSMVTENLERTNNAVALISQCQKEALDTLELSEKAGNVMNDIQDGASRVVEAVAQFNRTL
>NZ_CP046412.1|WP_005485953.1|1459723_1460602_+|DMT-family-transporter
MFNSERKATVILVATTMIAALGWIFSKETIQGLPPFGFIGLRFTIASLCLLPLCYRPLKAARLKDVLAASGVGLLLGGAVMTWIYAISISDTLGEGAFIMSLSMLFVPIVAWVMFQQRPQRIFWISLPIAVIGLACLSLAGGWKQSASQLWFLGAALILALHFNVNSKYSQKLPVLLLTCVQLFSAGCLGLLVSFLMESRPEQVDSSIWWWFALSTLLATSLRYVMQTMGQKFVQAGNAALIMILEPVWTVVLSILWYGEVLTANKLVGCLLILFSLVIYRTGGRFRFPKRA
>NZ_CP046412.1|WP_025791309.1|1460627_1461179_+|membrane-protein
MANTEHQETLDFLDKLSVCLYRAGISVFAIALLGLAALESQWLDGMDGRYRAVFAVFAIAGAMSASNIHVYSKSVRTIISWSGWIGVILMVCDPELNRVWLALGFIFITFSGIALKESFCFKVLGLKLVPTLLVVTAFALWFEQSTIVAISALLAGLIMAYLSIAKWRMPLHFDIGIKANYEV
>NZ_CP046412.1|WP_025791307.1|1461214_1462117_-|hydroxymethylglutaryl-CoA-lyase
MTLPTNVNIVEVGPRDGLQNESPVSIRTKIRLIDLLSDTGLSHIEAGSFVSPKWVPQMADSKEVMQNITRRASVTYSALTPNLQGLEQALDAGANQVAIFTSASEGFCQHNINCSITESLKRFEPLMVQADKYHVPVRGYLSCVVDCPYDGATSPTQVANISQALIELGCFEVSLGDTIGTGTPNRVKEMLESVLARIPNQRLAVHFHDTWGQALANIYQALSMGITTVDSSVAGLGGCPYAHGASGNVATEDVLYLCQGLGIETGVDLELLAKAGWMISDELQRQPTSKVSQALRHRME
>NZ_CP046412.1|WP_020835089.1|1462113_1462959_-|gamma-carboxygeranoyl-CoA-hydratase
MQERQPSIVPNAQRHNDVLWQVDEFGVATLTLNRTKKHNAFDACMIDLIIHRLDYLALRTDVRCLVLRSNGKHFSSGADLAWMQSMANSTRKENLVDAQSLARLMETLDAFPQPTIAVVQGSAFGGALGLICCSDIAIASHSAQFCLSEVKLGLVPATIAPYVMRAMGNRQARRYILSGEVIPAVKAQQFGIVHEVKKDDELESCVSEVVASLLLNSPDAMRKAKALCEQCHQNPIDSQLIRYTSQLIADIRVSPQGQDGLQAFLEKRPPSWVHQPDAEEE
>NZ_CP046412.1|WP_025791305.1|1462996_1464601_-|methylcrotonoyl-CoA-carboxylase
MAIIKSKTKPTDELFLSNQAAMEMLVEKLQKDIATIKLGGGERAIAHQRQKGKLPVRERISHLLDDGSNFLEIGQFAAWQVYDEPIPCAGVVAGIGIIEGVQCMVIANDASVKGGTYYPLTVKKHLRAQEIAQRCQLPCVYLVDSGGANLPHQSDVFPDKDHFGRIFFNQARMSAKGIPQIAVVMGLCTAGGAYVPAMADVSIMVKEQGTIFLAGPPLVKAATGEVVTGEELGGADVHCRKSGVADYYAENEEHALGLAREAIANANRPKPPKSNSAILPPRYDAEEMYGIVNANLRLSFDVREIIARIVDDSDFDEFKALYGRTLVCGFARIHGQLIGIVANNGILFSDSSQKGAHFIELCAKRKTPLLFLQNITGFMVGKKVEEEGIAKHGAKLVMAVACADVPKFTVIIGGSYGAGNYGMCGRAYDPTMMWMWPNARISVMGGEQAAGVLTQVRKEINQRRGEEWSEQEEHTFKESIIDLYETQGHPYFASARLWDDGIIDPKETRNVLAQALMAALNAPIPDSEFGIFRM
>NZ_CP046412.1|WP_025791303.1|1464635_1465805_-|isovaleryl-CoA-dehydrogenase
MKTSYIPLNFGLGETIDMLRDHVNAFASEHIAPIAADIDHYNQFPSHLWPLLGEMGLLGVTVSEEYGGAEMGYLAHVVAMEEISRASASVALSYGAHSNLCVNQIFRNGTPTQREKYLPKLVDGSHIGALAMSEVNSGSDVVSMQLKAEDKGDHFLLNGTKMWITNGPDADVVVVYAKTDADAGSRGITAFIVERSFTGFSDAQKLDKLGMRGSNTSELVFNNCKVPKENILGALNCGVGVLMSGLDYERVVLAAGPLGIMQACMDIVVPYVHERKQFGKSIGEFQLVQGKLADMYSRMSAAKAYVYTVAAACDRGECTRKDAAGVILYSAELATQMALDAIQLLGGNGYINEYATGRLLRDAKLYEIGAGTSEIRRMLIGRELFEESR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 11153

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015313246.1\|140_1595_-	DUF3404 domain-containing protein	NA	NA	NA	NA
WP_005461042.1\|1750_3127_-	Re/Si-specific NAD(P)(+) transhydrogenase subunit beta	NA	NA	NA	NA
WP_005461001.1\|3136_4693_-	Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha	NA	NA	NA	NA
WP_005498884.1\|5126_5408_-	hypothetical protein	NA	NA	NA	NA
WP_005479403.1\|5461_5830_-	late competence development ComFB family protein	NA	NA	NA	NA
WP_011106381.1\|6086_7331_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.6e-13	29.0
WP_005498888.1\|7406_8396_-	Solitary outer membrane autotransporter beta-barrel domain	NA	NA	NA	NA
WP_005460932.1\|8392_9364_-	diguanylate cyclase	W8CYM9	Bacillus_phage	1.9e-09	32.2
WP_025791074.1\|9533_9971_+	DUF3069 domain-containing protein	NA	NA	NA	NA
WP_025521765.1\|10046_11153_-	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	3.7e-22	35.0

DBSCAN-SWA_2

20025 : 28329

Vibrio_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005394529.1\|20025_20496_-	anaerobic ribonucleoside-triphosphate reductase-activating protein	H6WXC9	Vibrio_phage	2.1e-51	62.9
WP_020842161.1\|20580_22701_-	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	1.5e-269	65.1
WP_080264405.1\|22995_23877_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_025791063.1\|23968_25024_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_025791062.1\|25020_28329_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.0e-38	21.4

DBSCAN-SWA_3

43689 : 44952

Archaeal_BJ1_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791051.1\|43689_44952_+	hydroxymethylglutaryl-CoA reductase	A2RQD2	Archaeal_BJ1_virus	3.6e-05	38.6

DBSCAN-SWA_4

49644 : 50079

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005486290.1\|49644_50079_+	thioredoxin TrxC	A0A1J0GW78	Streptomyces_phage	4.0e-12	40.7

DBSCAN-SWA_5

84717 : 86349

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005460995.1\|84717_86349_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.2e-26	33.3

DBSCAN-SWA_6

94190 : 96637

Aphanizomenon_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005480265.1\|94190_95852_-	DUF3763 domain-containing protein	A0A2H4PB07	Aphanizomenon_phage	3.2e-33	29.1
WP_074531328.1\|96067_96637_+	NUDIX hydrolase	Q5ULM8	Lactobacillus_virus	2.7e-08	30.7

DBSCAN-SWA_7

103073 : 104733

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025442817.1\|103073_103595_-	lipocalin	A0A1W6JNX6	Morganella_phage	9.2e-40	46.7
WP_025791013.1\|103650_104178_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_025442819.1\|104208_104733_-	adenylate kinase	A0A097BYE2	Leuconostoc_phage	6.7e-14	39.2

DBSCAN-SWA_8

108653 : 116176

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791010.1\|108653_109787_-	exonuclease SbcCD subunit D	A0A217ER54	Bacillus_phage	9.7e-10	27.2
WP_025791008.1\|109883_110726_-	hypothetical protein	NA	NA	NA	NA
WP_005499010.1\|110726_111017_-	type VI secretion protein	NA	NA	NA	NA
WP_025791005.1\|111030_112866_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	7.5e-28	24.6
WP_005375967.1\|112923_113403_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_025791003.1\|113608_116176_-	type VI secretion system ATPase TssH	A0A1C3S747	Escherichia_phage	1.8e-88	32.5

DBSCAN-SWA_9

134615 : 136760

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080277382.1\|134615_136760_+	serine/threonine protein kinase	A0A2I2L4T9	Orpheovirus	3.0e-12	31.9

DBSCAN-SWA_10

145918 : 146755

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005463767.1\|145918_146755_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.7e-30	37.6

DBSCAN-SWA_11

158702 : 163046

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020837968.1\|158702_160616_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.0e-24	37.4
WP_005463744.1\|160644_160986_+	hypothetical protein	NA	NA	NA	NA
WP_025790959.1\|161267_163046_+	S8 family serine peptidase	A0A2H4PQH1	Staphylococcus_phage	3.9e-05	26.7

DBSCAN-SWA_12

167334 : 178185

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790953.1\|167334_168003_-	response regulator transcription factor	W8CYM9	Bacillus_phage	8.8e-27	34.4
WP_025790950.1\|168093_169287_+	hypothetical protein	NA	NA	NA	NA
WP_025790948.1\|169445_169742_+	hypothetical protein	NA	NA	NA	NA
WP_033904851.1\|170058_170337_+	hypothetical protein	NA	NA	NA	NA
WP_025790946.1\|170464_171196_-	nucleoside phosphorylase	D0R0G0	Streptococcus_phage	4.2e-06	32.8
WP_025790944.1\|171207_171939_-	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	6.3e-26	35.2
WP_005499106.1\|172099_172318_-	hypothetical protein	NA	NA	NA	NA
WP_005463707.1\|172547_173555_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	7.3e-33	29.2
WP_017447445.1\|173589_174507_-	ribokinase	NA	NA	NA	NA
WP_005463703.1\|174735_175614_-	ribose ABC transporter substrate-binding protein RbsB	C6ZCU4	Enterobacteria_phage	1.9e-05	23.8
WP_005463702.1\|175699_176683_-	ribose ABC transporter permease	NA	NA	NA	NA
WP_025790940.1\|176679_178185_-	ribose ABC transporter ATP-binding protein RbsA	A0A2H4PQG7	Staphylococcus_phage	1.7e-17	27.2

DBSCAN-SWA_13

190313 : 192671

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790926.1\|190313_192671_-	response regulator	A0A1V0SGX0	Hokovirus	2.1e-59	37.7

DBSCAN-SWA_14

198564 : 212655

Tupanvirus(20.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005499153.1\|198564_199350_+	slipin family protein	A0A2K9L3L2	Tupanvirus	4.8e-24	28.8
WP_020841950.1\|199477_199906_-	globin	NA	NA	NA	NA
WP_079854798.1\|200142_200877_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_025790917.1\|200992_202177_-\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.5e-24	33.2
WP_005487988.1\|202179_203022_-\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_025790915.1\|203076_204015_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_025790914.1\|204063_205794_-\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	4.1e-44	28.0
WP_025790913.1\|205814_207275_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_025790912.1\|207293_207893_-	transcriptional regulator BetI	NA	NA	NA	NA
WP_025790911.1\|208486_210535_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.2e-20	43.8
WP_005477089.1\|210753_210876_+	hypothetical protein	NA	NA	NA	NA
WP_025790910.1\|210990_211749_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_025790909.1\|211758_212655_-	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	3.4e-26	29.8

DBSCAN-SWA_15

220528 : 228677

Pike_perch_iridovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790901.1\|220528_222136_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	9.6e-19	66.7
WP_080277377.1\|222221_223025_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_080277376.1\|222978_225078_+	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_080277375.1\|225031_225961_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	7.4e-48	40.2
WP_025790894.1\|226055_228677_-	response regulator	A0A1V0SGX0	Hokovirus	1.5e-42	27.0

DBSCAN-SWA_16

242716 : 243538

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020838028.1\|242716_243538_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	8.6e-16	28.5

DBSCAN-SWA_17

248820 : 249639

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072828613.1\|248820_249639_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-13	24.6

DBSCAN-SWA_18

253398 : 256531

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790862.1\|253398_255432_+	acetoacetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	9.6e-24	25.1
WP_025790860.1\|255484_256531_-	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	1.0e-98	54.5

DBSCAN-SWA_19

260395 : 261807

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025594089.1\|260395_261304_-	aldo/keto reductase family oxidoreductase	A0A1V0SDE7	Indivirus	4.3e-08	28.8
WP_025790854.1\|261399_261807_+	transcriptional regulator	A0A1C6ZDG7	Pseudomonas_phage	6.2e-07	41.4

DBSCAN-SWA_20

267222 : 270159

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005477356.1\|267222_267876_-	GTP cyclohydrolase I FolE	R9TJA5	Vibrio_phage	7.5e-55	54.3
WP_020838039.1\|268164_269400_+	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_025790845.1\|269409_270159_+	molybdopterin-synthase adenylyltransferase MoeB	S4VW33	Pandoravirus	9.3e-09	35.2

DBSCAN-SWA_21

274246 : 291377

Bacillus_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021447946.1\|274246_276538_+	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	1.1e-12	30.8
WP_020841901.1\|276579_277872_-	glycoside hydrolase family 18 protein	A0A1B1V5N4	Malacosoma_sp._alphabaculovirus	3.1e-68	36.1
WP_005463541.1\|278003_279005_-	sugar-binding transcriptional regulator	NA	NA	NA	NA
WP_005463539.1\|279075_279228_+	hypothetical protein	NA	NA	NA	NA
WP_005463537.1\|279471_280422_+	transaldolase	A0A127KNC6	Cyanophage	2.5e-11	31.7
WP_025790838.1\|280545_282537_+	transketolase	NA	NA	NA	NA
WP_017447380.1\|282662_284231_-	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	4.5e-29	46.9
WP_011106437.1\|284300_284396_+	hypothetical protein	NA	NA	NA	NA
WP_005499265.1\|284449_285628_-	MFS transporter	NA	NA	NA	NA
WP_025790834.1\|285776_286829_-	3-deoxy-7-phosphoheptulonate synthase AroG	S4W5F1	Pandoravirus	6.8e-82	50.5
WP_005463527.1\|287290_288280_+	OmpA family protein	NA	NA	NA	NA
WP_025790833.1\|288412_289015_-	beta-phosphoglucomutase family hydrolase	NA	NA	NA	NA
WP_005463517.1\|289091_289505_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_025790831.1\|289607_291377_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.4e-25	32.2

DBSCAN-SWA_22

294649 : 296646

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005485167.1\|294649_295777_-	multidrug efflux RND transporter periplasmic adaptor subunit VmeY	S5VL44	Leptospira_phage	3.7e-09	25.9
WP_005485131.1\|296181_296646_+	cell division protein DedD	A0A292GIT0	Xanthomonas_phage	2.6e-25	42.4

DBSCAN-SWA_23

310491 : 313840

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005477336.1\|310491_311232_-	SDR family oxidoreductase	A0A0K0KVL6	Prochlorococcus_phage	1.0e-07	27.7
WP_025500381.1\|311971_312592_+	LysE family translocator	NA	NA	NA	NA
WP_021449447.1\|312608_312875_+	hypothetical protein	NA	NA	NA	NA
WP_005463489.1\|312937_313840_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.7e-36	36.7

DBSCAN-SWA_24

318221 : 318845

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005463481.1\|318221_318845_-	class I SAM-dependent methyltransferase	A0A1B1IT46	uncultured_Mediterranean_phage	1.7e-08	27.1

DBSCAN-SWA_25

324005 : 328351

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_140137138.1\|324005_326582_-	response regulator	A0A1V0SGX0	Hokovirus	6.4e-49	33.3
WP_005463467.1\|326581_327679_-	autoinducer 2-binding periplasmic protein LuxP	NA	NA	NA	NA
WP_023623674.1\|328030_328351_-	hypothetical protein	W8W2G4	Invertebrate_iridovirus	1.8e-09	44.4

DBSCAN-SWA_26

332600 : 335249

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080277371.1\|332600_335249_-	response regulator	A0A1V0SGX0	Hokovirus	2.5e-48	27.3

DBSCAN-SWA_27

343859 : 345182

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790798.1\|343859_345182_+	AarF/ABC1/UbiB kinase family protein	M4R0M8	Ostreococcus_lucimarinus_virus	2.7e-19	26.9

DBSCAN-SWA_28

350730 : 355878

Golden_Marseillevirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790794.1\|350730_351369_+	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	1.0e-11	34.9
WP_005499344.1\|351369_352128_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011106452.1\|352168_352276_-	hypothetical protein	NA	NA	NA	NA
WP_025790791.1\|352274_354128_+	MFS transporter	NA	NA	NA	NA
WP_017447347.1\|354245_354863_+	cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase	A0A2I7SAF7	Vibrio_phage	7.6e-17	32.7
WP_005463409.1\|355221_355878_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	8.3e-38	38.4

DBSCAN-SWA_29

359213 : 362110

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025546537.1\|359213_359933_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	2.4e-06	29.2
WP_017447344.1\|360109_360823_+	response regulator	W8CYM9	Bacillus_phage	7.2e-35	35.4
WP_017447343.1\|360823_362110_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	4.8e-21	26.5

DBSCAN-SWA_30

373208 : 378037

Morganella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005463371.1\|373208_373421_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	6.2e-19	62.9
WP_021484467.1\|373662_373872_+	hypothetical protein	NA	NA	NA	NA
WP_005463370.1\|373922_374063_+	hypothetical protein	NA	NA	NA	NA
WP_101893770.1\|374221_374332_+	hypothetical protein	NA	NA	NA	NA
WP_025790768.1\|374549_375563_+	adenosine deaminase	NA	NA	NA	NA
WP_005477269.1\|375657_376131_+	peroxiredoxin	M1I839	Pelagibacter_phage	9.3e-23	43.1
WP_005499396.1\|376175_376580_-	cell division protein DamX	NA	NA	NA	NA
WP_011106461.1\|376506_376779_-	hypothetical protein	NA	NA	NA	NA
WP_025790765.1\|376867_378037_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	4.4e-82	45.6

DBSCAN-SWA_31

394840 : 395959

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005463102.1\|394840_395959_+	maltose/maltodextrin ABC transporter ATP-binding protein MalK	G3M9Y6	Bacillus_virus	5.3e-24	32.4

DBSCAN-SWA_32

411647 : 414091

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790733.1\|411647_413087_+	catalase	A0A2K9L0T1	Tupanvirus	3.6e-102	47.5
WP_025790731.1\|413212_414091_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	4.3e-29	32.4

DBSCAN-SWA_33

429311 : 436201

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025557708.1\|429311_430010_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.6e-24	30.4
WP_080277364.1\|430006_431053_-	DUF4118 domain-containing protein	Q8QNA2	Ectocarpus_siliculosus_virus	6.7e-05	29.3
WP_005490897.1\|431300_433127_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-30	26.6
WP_025790719.1\|433272_435363_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_005478119.1\|435415_436201_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-13	27.7

DBSCAN-SWA_34

458098 : 464671

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080277362.1\|458098_459829_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.2e-19	24.5
WP_025790703.1\|459878_460469_-	calcium-binding protein	NA	NA	NA	NA
WP_005462983.1\|460675_461332_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_025790701.1\|461558_462230_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_005462979.1\|462497_462698_-	chromosome segregation ATPase	NA	NA	NA	NA
WP_025790698.1\|462754_464671_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-18	63.4

DBSCAN-SWA_35

472611 : 480581

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080277361.1\|472611_474732_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.5e-11	33.0
WP_005462960.1\|475056_475806_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.3e-14	28.6
WP_025790689.1\|475866_476730_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_005462956.1\|476752_477685_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_005462954.1\|477784_478606_-	phosphate ABC transporter substrate-binding protein	M1U9L0	Synechococcus_phage	2.1e-06	27.6
WP_025605661.1\|478937_480581_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.4e-11	61.5

DBSCAN-SWA_36

487160 : 494834

Organic_Lake_phycodnavirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790680.1\|487160_489161_-	S9 family peptidase	F2Y2S5	Organic_Lake_phycodnavirus	1.0e-09	30.3
WP_005499754.1\|489484_490831_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.4e-41	28.8
WP_005462467.1\|491382_491637_+	hypothetical protein	NA	NA	NA	NA
WP_005462944.1\|491663_492590_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_025535245.1\|492596_494012_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	3.7e-59	30.7
WP_025790677.1\|494021_494834_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	1.4e-21	31.5

DBSCAN-SWA_37

500057 : 506029

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790671.1\|500057_501641_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.6e-16	39.5
WP_005478107.1\|501886_502267_+	DUF3302 domain-containing protein	NA	NA	NA	NA
WP_005478401.1\|502266_503397_+	HlyD family secretion protein	NA	NA	NA	NA
WP_005375133.1\|503734_504283_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_025790668.1\|504289_506029_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	35.1

DBSCAN-SWA_38

509186 : 509957

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015313573.1\|509186_509957_-	ferredoxin-type protein NapG	A0A077SLP0	Escherichia_phage	7.3e-09	28.1

DBSCAN-SWA_39

513160 : 514789

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017447262.1\|513160_514789_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-20	38.8

DBSCAN-SWA_40

518158 : 522060

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450580.1\|518158_519790_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-19	33.5
WP_025790657.1\|520026_522060_-	S9 family peptidase	A0A1V0SHT0	Klosneuvirus	2.6e-69	32.3

DBSCAN-SWA_41

534783 : 537174

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005478141.1\|534783_535815_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	6.5e-21	88.5
WP_005478319.1\|535980_537174_-	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	9.5e-40	28.8

DBSCAN-SWA_42

542655 : 545358

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005462859.1\|542655_543171_+	superoxide dismutase family protein	Q9MC02	Salmonella_phage	5.5e-45	59.6
WP_025790648.1\|543198_544572_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_079884214.1\|544596_545358_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.9e-27	30.5

DBSCAN-SWA_43

555129 : 556167

Emiliania_huxleyi_virus(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790636.1\|555129_556167_+\|protease	serine protease	G9E3T9	Emiliania_huxleyi_virus	6.0e-14	29.2

DBSCAN-SWA_44

580253 : 586549

Lactococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005499881.1\|580253_580631_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	1.0e-27	50.0
WP_023623752.1\|580743_580959_-	TIGR02450 family Trp-rich protein	NA	NA	NA	NA
WP_020841480.1\|581098_581572_-	HPP family protein	NA	NA	NA	NA
WP_025790624.1\|581670_582216_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_025790623.1\|582304_584728_-	formate C-acetyltransferase/glycerol dehydratase family glycyl radical enzyme	A0A1S6KUZ1	Providencia_phage	2.0e-07	49.1
WP_025622856.1\|584730_585660_-	glycyl-radical enzyme activating protein	A0A2P0VNQ0	Tetraselmis_virus	4.2e-11	26.6
WP_025499057.1\|585874_586549_+	fructose-6-phosphate aldolase	A0A0E3FNR2	Synechococcus_phage	1.1e-27	31.8

DBSCAN-SWA_45

590864 : 592115

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156216724.1\|590864_592115_+	DUF4102 domain-containing protein	A0A2H4JB45	uncultured_Caudovirales_phage	2.3e-84	41.9

DBSCAN-SWA_46

596441 : 597596

Phage_21(100.0%)

integrase

attL 589716:589728|attR 599076:599088

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
589716:589728	attL	NA	NA	NA	NA
WP_156216733.1\|596441_597596_-\|integrase	tyrosine-type recombinase/integrase	Q77Z04	Phage_21	1.0e-54	36.9
WP_156216733.1\|596441_597596_-\|integrase	tyrosine-type recombinase/integrase	Q77Z04	Phage_21	1.0e-54	36.9
599076:599088	attR	NA	NA	NA	NA

DBSCAN-SWA_47

619651 : 620809

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005484191.1\|619651_620809_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.9e-77	43.1

DBSCAN-SWA_48

624817 : 626281

Apis_mellifera_filamentous_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025628039.1\|624817_626281_+	N-acetylglucosamine-binding protein GbpA	A0A0K1Y848	Apis_mellifera_filamentous_virus	2.5e-13	31.2

DBSCAN-SWA_49

638320 : 638695

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005458336.1\|638320_638695_-	DUF1232 domain-containing protein	A0A2I7S9Z5	Vibrio_phage	2.1e-25	53.5

DBSCAN-SWA_50

650635 : 653089

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005480123.1\|650635_653089_-	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	2.3e-16	43.8

DBSCAN-SWA_51

659981 : 660278

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005480175.1\|659981_660278_+	PTS glucose transporter subunit IIB	A0A2I7SAJ6	Vibrio_phage	1.6e-09	54.1

DBSCAN-SWA_52

676262 : 677879

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790560.1\|676262_677879_-	endonuclease I	A0A2P0VMP9	Tetraselmis_virus	8.7e-12	31.2

DBSCAN-SWA_53

686277 : 697068

Salmonella_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790553.1\|686277_687486_+	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	6.7e-25	24.6
WP_020838274.1\|687567_689295_-	hypothetical protein	NA	NA	NA	NA
WP_005455166.1\|689768_690722_+	M23 family metallopeptidase	V5R8R0	Arthrobacter_phage	7.9e-13	41.2
WP_017447171.1\|690625_691078_+	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_025631193.1\|691135_693883_-	insulinase family protein	L7RBE7	Acanthamoeba_polyphaga_moumouvirus	1.4e-17	33.8
WP_015313668.1\|694298_696185_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-23	45.4
WP_025553438.1\|696303_697068_-	Fe(3+) dicitrate ABC transporter ATP-binding protein FecE	G9BWD6	Planktothrix_phage	1.7e-13	29.0

DBSCAN-SWA_54

710688 : 722427

Bovine_gammaherpesvirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790535.1\|710688_711891_+	type III PLP-dependent enzyme	A0A060D2X4	Bovine_gammaherpesvirus	2.9e-12	23.9
WP_025790533.1\|711965_713210_-	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_025790531.1\|713212_714643_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_005383484.1\|714632_715340_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-33	37.5
WP_011106551.1\|715442_715532_-	hypothetical protein	NA	NA	NA	NA
WP_025509293.1\|715605_717048_+	PTS glucose-specific subunit IIBC	A0A2I7SAJ6	Vibrio_phage	5.6e-10	42.4
WP_025509292.1\|717143_717590_-	DUF302 domain-containing protein	NA	NA	NA	NA
WP_025790528.1\|717817_719809_+	U32 family peptidase	Q6DW11	Phage_TP	2.0e-18	27.0
WP_005477508.1\|719902_720892_-	L-arabinose ABC transporter permease AraH	NA	NA	NA	NA
WP_078581191.1\|720906_722427_-	L-arabinose ABC transporter ATP-binding protein AraG	G3M9Y6	Bacillus_virus	8.8e-14	28.3

DBSCAN-SWA_55

733013 : 734582

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025515546.1\|733013_734582_+	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	5.6e-40	32.4

DBSCAN-SWA_56

737958 : 741650

Salmonella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790517.1\|737958_738444_+	sigma-70 family RNA polymerase sigma factor	G0X4Y0	Salmonella_phage	5.6e-07	27.3
WP_005477491.1\|738645_739341_+	hypothetical protein	NA	NA	NA	NA
WP_011106555.1\|739440_739599_-	hypothetical protein	NA	NA	NA	NA
WP_017447138.1\|739610_740696_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.1e-13	47.2
WP_025790516.1\|740717_741650_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.0e-12	24.7

DBSCAN-SWA_57

745893 : 747132

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790512.1\|745893_747132_-	DEAD/DEAH box helicase	A0A1B1IS59	uncultured_Mediterranean_phage	8.9e-49	31.7

DBSCAN-SWA_58

752740 : 754204

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790507.1\|752740_754204_+	fructuronate reductase	H8ZJP8	Ostreococcus_tauri_virus	4.7e-49	32.1

DBSCAN-SWA_59

761984 : 767335

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005477482.1\|761984_763835_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.3e-31	23.9
WP_025790490.1\|764430_765138_+	hypothetical protein	NA	NA	NA	NA
WP_005465952.1\|765218_765695_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005466428.1\|766017_766185_+	hypothetical protein	NA	NA	NA	NA
WP_011106558.1\|766192_766441_-	hypothetical protein	NA	NA	NA	NA
WP_023584433.1\|766801_767335_+	GNAT family N-acetyltransferase	G9BWD5	Planktothrix_phage	8.9e-06	30.8

DBSCAN-SWA_60

774740 : 777111

Bordetella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005468852.1\|774740_775553_-	AraC family transcriptional regulator	A0A291LAM3	Bordetella_phage	1.8e-05	35.4
WP_005484739.1\|775554_775674_-	hypothetical protein	NA	NA	NA	NA
WP_047122900.1\|776355_777111_+	helix-turn-helix transcriptional regulator	A2I306	Vibrio_virus	1.7e-34	41.1

DBSCAN-SWA_61

785646 : 787761

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005464845.1\|785646_787761_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	3.1e-33	26.7

DBSCAN-SWA_62

797632 : 805800

Burkholderia_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790466.1\|797632_798544_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.6e-10	25.9
WP_025790462.1\|798632_799292_+	CatB-related O-acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	1.4e-21	40.1
WP_005464872.1\|799348_801028_-	DUF342 domain-containing protein	NA	NA	NA	NA
WP_075109953.1\|801454_803506_-\|tRNA	tRNA(Met) cytidine acetyltransferase	Q56AQ2	Bacillus_thuringiensis_phage	1.7e-12	29.9
WP_005464865.1\|803600_804575_-	ParB/RepB/Spo0J family partition protein	O64340	Escherichia_phage	5.1e-23	40.0
WP_005500197.1\|804582_805800_-	ParA family protein	Q1MVJ3	Enterobacteria_phage	3.8e-36	29.2

DBSCAN-SWA_63

809778 : 816257

Planktothrix_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790449.1\|809778_810711_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-14	33.2
WP_024699219.1\|810707_811562_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.6e-17	31.2
WP_005477395.1\|811924_812125_+	hypothetical protein	NA	NA	NA	NA
WP_005477438.1\|812369_813431_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	6.5e-40	44.5
WP_011106202.1\|813399_813495_+	hypothetical protein	NA	NA	NA	NA
WP_020838341.1\|813534_814290_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_025790446.1\|814358_816257_+	response regulator	A0A1V0SGX0	Hokovirus	1.5e-58	35.2

DBSCAN-SWA_64

819712 : 820411

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790442.1\|819712_820411_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-41	42.5

DBSCAN-SWA_65

823815 : 828730

Enterobacteria_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025442401.1\|823815_824847_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	1.6e-22	33.3
WP_025522576.1\|824848_825640_+	response regulator transcription factor	A0A2R2ZGH8	Clostridioides_phage	4.6e-06	19.7
WP_025790433.1\|825717_826353_+	hypothetical protein	NA	NA	NA	NA
WP_005481711.1\|826455_826950_-	peptidyl-prolyl cis-trans isomerase	A0A076FI46	Aureococcus_anophage	1.0e-11	31.4
WP_017447085.1\|827068_828730_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.8e-16	34.2

DBSCAN-SWA_66

833721 : 834579

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790424.1\|833721_834579_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.6e-18	29.6

DBSCAN-SWA_67

844145 : 844628

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005464913.1\|844145_844628_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	8.9e-29	47.7

DBSCAN-SWA_68

851663 : 857321

Orgyia_leucostigma_nucleopolyhedrovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025500999.1\|851663_854210_-	chitinase	B0FDP2	Orgyia_leucostigma_nucleopolyhedrovirus	3.8e-147	47.9
WP_020841634.1\|854579_855083_-	DUF2850 domain-containing protein	NA	NA	NA	NA
WP_005464991.1\|855407_855692_+	pyrimidine/purine nucleoside phosphorylase	NA	NA	NA	NA
WP_005464981.1\|855862_856144_+	hypothetical protein	NA	NA	NA	NA
WP_025790412.1\|856163_857321_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.1e-11	27.4

DBSCAN-SWA_69

861745 : 875611

Diadromus_pulchellus_ascovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025612132.1\|861745_862612_-	MBL fold metallo-hydrolase	F2NZ47	Diadromus_pulchellus_ascovirus	2.7e-20	27.6
WP_156216739.1\|862738_863626_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025790403.1\|863721_864525_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_031858472.1\|864633_865038_-	hypothetical protein	NA	NA	NA	NA
WP_005464959.1\|865047_866139_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	6.5e-11	30.6
WP_005482833.1\|866138_866600_-	oxidoreductase	NA	NA	NA	NA
WP_025790400.1\|867045_867885_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_005464962.1\|867946_869095_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	4.0e-35	29.2
WP_025501292.1\|869388_870195_+	arylamine N-acetyltransferase	NA	NA	NA	NA
WP_005464972.1\|870275_871145_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025521120.1\|871145_871856_-	DNA polymerase III subunit epsilon	A0A1P8VVD4	Rathayibacter_phage	7.0e-06	25.9
WP_005482867.1\|871858_873727_-	CBS domain-containing protein	NA	NA	NA	NA
WP_005497702.1\|873810_874608_-	DNA-binding transcriptional regulator KdgR	NA	NA	NA	NA
WP_005482916.1\|874849_875611_+	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	A0A0N9R355	Chrysochromulina_ericina_virus	1.4e-12	25.5

DBSCAN-SWA_70

890475 : 891654

Agrotis_ipsilon_multiple_nucleopolyhedrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021484189.1\|890475_891654_+	chitin-binding domain protein	B6D5U4	Agrotis_ipsilon_multiple_nucleopolyhedrovirus	8.8e-30	36.9

DBSCAN-SWA_71

903114 : 910007

Infectious_spleen_and_kidney_necrosis_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005482857.1\|903114_903627_-	macro domain-containing protein	A0A140G0J9	Infectious_spleen_and_kidney_necrosis_virus	1.4e-27	52.5
WP_017447038.1\|903686_904112_-	lactoylglutathione lyase	NA	NA	NA	NA
WP_025588937.1\|904266_905109_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025790379.1\|905260_906568_-	DUF1254 domain-containing protein	M1H738	Paramecium_bursaria_Chlorella_virus	1.2e-30	27.3
WP_005482820.1\|906682_907624_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005391929.1\|907696_908182_-	VOC family protein	NA	NA	NA	NA
WP_005460842.1\|908320_908638_-	hypothetical protein	NA	NA	NA	NA
WP_025627838.1\|908734_909445_-	HAD family hydrolase	NA	NA	NA	NA
WP_025790374.1\|909470_910007_-	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	3.1e-22	36.0

DBSCAN-SWA_72

915681 : 918372

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790368.1\|915681_916818_+	glycerate kinase	W6LM47	Streptococcus_phage	3.1e-40	37.3
WP_080277353.1\|916914_918372_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.5e-23	26.9

DBSCAN-SWA_73

922125 : 927217

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790358.1\|922125_922857_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	1.6e-26	32.1
WP_025790356.1\|922866_923382_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_005459939.1\|923652_924747_+	cytochrome c	NA	NA	NA	NA
WP_025790354.1\|924769_927217_+	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	8.7e-80	30.9

DBSCAN-SWA_74

932128 : 932887

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025790345.1\|932128_932887_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.5e-25	37.6

DBSCAN-SWA_75

945313 : 951169

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791715.1\|945313_946309_-	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	1.1e-68	42.4
WP_080258325.1\|946523_947021_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_025791706.1\|947051_947762_-	glycerophosphodiester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	4.8e-15	26.1
WP_025791705.1\|948018_948972_+	malate dehydrogenase	NA	NA	NA	NA
WP_021452332.1\|949130_949796_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.4e-26	34.4
WP_011106224.1\|949792_951169_+	sensor histidine kinase	W8CYF6	Bacillus_phage	1.6e-14	25.0

DBSCAN-SWA_76

962513 : 971532

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025574906.1\|962513_963248_+	metal ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.3e-11	23.4
WP_005479618.1\|963247_964123_+	metal ABC transporter permease	NA	NA	NA	NA
WP_021484238.1\|964158_965028_+	periplasmic solute-binding family protein	NA	NA	NA	NA
WP_025791692.1\|965243_966293_+	porin	Q1MVN1	Enterobacteria_phage	3.5e-06	23.0
WP_025791689.1\|966501_968667_-	oligopeptidase B	F2Y2Z7	Organic_Lake_phycodnavirus	1.7e-34	27.2
WP_025791687.1\|968993_970199_-	multidrug efflux MFS transporter EmrD	NA	NA	NA	NA
WP_005393578.1\|970611_971532_-	agmatinase	A0A0N9R043	Chrysochromulina_ericina_virus	3.1e-06	27.8

DBSCAN-SWA_77

976417 : 977308

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791683.1\|976417_977308_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	1.0e-06	38.4

DBSCAN-SWA_78

1002070 : 1014024

Pacmanvirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791666.1\|1002070_1002676_-	alpha-ketoglutarate-dependent dioxygenase AlkB	A0A1X6WG33	Pacmanvirus	2.1e-19	34.6
WP_025791664.1\|1002813_1004169_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	2.1e-14	34.8
WP_025791663.1\|1004258_1006256_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-17	22.5
WP_005479975.1\|1006653_1008210_-	DUF3612 domain-containing protein	NA	NA	NA	NA
WP_005459283.1\|1008378_1008963_+	malate synthase	NA	NA	NA	NA
WP_005479978.1\|1009101_1010115_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.6e-16	35.9
WP_025791659.1\|1010434_1011772_+	DASH family cryptochrome	F2Y1V1	Organic_Lake_phycodnavirus	1.5e-25	36.4
WP_025791657.1\|1011772_1013317_+	cryptochrome/photolyase family protein	E3T4R9	Cafeteria_roenbergensis_virus	3.5e-50	32.2
WP_025791655.1\|1013316_1014024_+	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	1.1e-32	37.7

DBSCAN-SWA_79

1023424 : 1024111

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005497912.1\|1023424_1024111_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	2.1e-15	31.2

DBSCAN-SWA_80

1030993 : 1034135

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791646.1\|1030993_1032169_+	efflux RND transporter periplasmic adaptor subunit	A0A140XAI1	Dickeya_phage	1.3e-17	44.7
WP_025791643.1\|1032170_1034135_+	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	4.6e-39	40.9

DBSCAN-SWA_81

1037378 : 1039412

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015312848.1\|1037378_1039412_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	6.4e-28	30.9

DBSCAN-SWA_82

1049547 : 1064840

Vibrio_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153645139.1\|1049547_1050243_-	hypothetical protein	A0A1B0T6H5	Thiobacimonas_phage	1.1e-06	26.1
WP_122016144.1\|1050531_1050768_+	transcriptional regulator	A0A2I7S995	Vibrio_phage	1.4e-11	57.4
WP_156216742.1\|1050769_1052833_+	hypothetical protein	A0A2I7RCD3	Vibrio_phage	2.9e-68	28.4
WP_054824892.1\|1052836_1053760_+	AAA family ATPase	A0A2P9JZG8	Alteromonadaceae_phage	5.5e-35	31.0
WP_025818280.1\|1053761_1054199_+	hypothetical protein	NA	NA	NA	NA
WP_031427044.1\|1054189_1054435_+	hypothetical protein	NA	NA	NA	NA
WP_024700519.1\|1054462_1054663_+	ANR family transcriptional regulator	NA	NA	NA	NA
WP_025818934.1\|1054659_1055274_+	DUF3164 family protein	A0A2D1GNM4	Pseudomonas_phage	4.7e-51	47.3
WP_080285867.1\|1055286_1056327_+	hypothetical protein	A0A1V0E8C0	Vibrio_phage	1.7e-53	35.6
WP_024700522.1\|1056323_1056572_+	hypothetical protein	NA	NA	NA	NA
WP_140093440.1\|1056692_1057061_+	hypothetical protein	A0A2I7RZB2	Vibrio_phage	7.7e-41	69.3
WP_024701736.1\|1057063_1057570_+	hypothetical protein	A0A2H5BFX4	Vibrio_phage	2.2e-62	70.7
WP_031426751.1\|1058863_1059076_+	hypothetical protein	M4MCS5	Vibrio_phage	1.2e-14	56.1
WP_024700527.1\|1059264_1060341_+	restriction endonuclease or methylase	A0A1S5SAB0	Streptococcus_phage	4.8e-67	40.4
WP_140219346.1\|1060267_1060900_+	DUF1018 domain-containing protein	A0A0C4UQU3	Shigella_phage	4.0e-05	25.9
WP_024700529.1\|1060892_1061162_+	hypothetical protein	NA	NA	NA	NA
WP_153645269.1\|1061151_1061310_+	hypothetical protein	NA	NA	NA	NA
WP_153189281.1\|1061355_1061532_-	hypothetical protein	NA	NA	NA	NA
WP_025818927.1\|1061534_1061738_-	hypothetical protein	NA	NA	NA	NA
WP_025818928.1\|1061734_1062631_-	hypothetical protein	D6QWP0	uncultured_phage	3.3e-37	58.7
WP_031426745.1\|1062642_1063821_-	hypothetical protein	A0A2K9V320	Faecalibacterium_phage	1.1e-24	28.7
WP_025818909.1\|1063817_1064840_-	hypothetical protein	A0A0C5AJ59	Bacteriophage	3.0e-10	24.6

DBSCAN-SWA_83

1070603 : 1072445

Escherichia_phage(100.0%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156216746.1\|1070603_1072445_+\|tail	phage tail protein	A0A1W6JT53	Escherichia_phage	9.2e-26	30.2

DBSCAN-SWA_84

1076700 : 1082240

EBPR_siphovirus(33.33%)

head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_140272544.1\|1076700_1077792_+	DUF935 family protein	F8TVC4	EBPR_siphovirus	2.1e-09	25.7
WP_140272545.1\|1077779_1079105_+\|head	phage head morphogenesis protein	Q6QIB9	Burkholderia_phage	3.2e-12	27.3
WP_140134121.1\|1079104_1079497_+	hypothetical protein	NA	NA	NA	NA
WP_060466681.1\|1079515_1079707_-	hypothetical protein	NA	NA	NA	NA
WP_025788411.1\|1079770_1080079_-	hypothetical protein	NA	NA	NA	NA
WP_140134115.1\|1080745_1081018_+	hypothetical protein	NA	NA	NA	NA
WP_031822498.1\|1081175_1082240_+	site-specific DNA-methyltransferase	K7RG04	Vibrio_phage	6.4e-112	62.1

DBSCAN-SWA_85

1086510 : 1087902

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024700560.1\|1086510_1087902_+	hypothetical protein	A0A0A7RTP0	Clostridium_phage	1.4e-13	32.9

DBSCAN-SWA_86

1097159 : 1098137

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015312861.1\|1097159_1098137_+	OmpA family protein	G3M9Z0	Bacillus_virus	8.7e-07	26.0

DBSCAN-SWA_87

1107276 : 1109042

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005464022.1\|1107276_1107795_+	NUDIX domain-containing protein	A0A2H4J8B3	uncultured_Caudovirales_phage	3.5e-31	46.2
WP_005481481.1\|1108295_1109042_-	lytic transglycosylase domain-containing protein	I1VXB7	Halocynthia_phage	1.8e-12	36.8

DBSCAN-SWA_88

1128271 : 1136256

Hokovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791592.1\|1128271_1129951_+	LruC domain-containing protein	A0A1V0SGG5	Hokovirus	1.6e-13	25.8
WP_021484191.1\|1129961_1130426_+	hypothetical protein	NA	NA	NA	NA
WP_025791590.1\|1130581_1130932_-	rhodanese-like domain-containing protein	G9E686	Micromonas_pusilla_virus	4.1e-07	30.8
WP_005373989.1\|1131191_1131482_+	co-chaperone GroES	A0A221S386	uncultured_virus	2.0e-12	38.1
WP_005463958.1\|1131515_1133114_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	9.7e-181	66.2
WP_080277410.1\|1133219_1133429_+	hypothetical protein	NA	NA	NA	NA
WP_025791588.1\|1133583_1134555_+	hemolysin	NA	NA	NA	NA
WP_025629351.1\|1134644_1135256_-	LysE family transporter	NA	NA	NA	NA
WP_025791584.1\|1135365_1136256_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.8e-12	25.6

DBSCAN-SWA_89

1157891 : 1163142

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079855133.1\|1157891_1159433_+	catalase	A0A2K9L0T1	Tupanvirus	1.0e-102	48.1
WP_025791563.1\|1159534_1160002_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_025534376.1\|1160120_1160774_-	nicotinamidase	NA	NA	NA	NA
WP_005463941.1\|1160806_1161532_-	NUDIX hydrolase	NA	NA	NA	NA
WP_005479835.1\|1161831_1163142_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	1.6e-40	30.9

DBSCAN-SWA_90

1166588 : 1167473

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005464181.1\|1166588_1167473_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	5.6e-13	35.8

DBSCAN-SWA_91

1174316 : 1176341

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791547.1\|1174316_1176341_-	elongation factor G	A0A1S5SF82	Streptococcus_phage	3.2e-35	23.1

DBSCAN-SWA_92

1187850 : 1191009

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025505147.1\|1187850_1191009_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.9e-48	20.7

DBSCAN-SWA_93

1195324 : 1196344

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791528.1\|1195324_1196344_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.0e-34	37.5

DBSCAN-SWA_94

1200972 : 1202592

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017447951.1\|1200972_1202592_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	7.4e-11	23.8

DBSCAN-SWA_95

1206855 : 1207872

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791517.1\|1206855_1207872_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	1.9e-17	29.2

DBSCAN-SWA_96

1217073 : 1226683

Yersinia_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025499929.1\|1217073_1218333_-\|tRNA	tyrosine--tRNA ligase	A0A2C9CYK4	Yersinia_phage	1.7e-87	44.1
WP_005498115.1\|1218415_1219222_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_025537361.1\|1219446_1220226_-	hypothetical protein	NA	NA	NA	NA
WP_011106262.1\|1220182_1220293_+	hypothetical protein	NA	NA	NA	NA
WP_080277406.1\|1220445_1222833_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	5.5e-172	38.0
WP_025791505.1\|1223031_1223868_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_005479812.1\|1223949_1225014_-	L-asparaginase 2	NA	NA	NA	NA
WP_005464135.1\|1225426_1226683_-	adenylosuccinate synthase	A0A2R8FF47	Brazilian_cedratvirus	4.5e-48	31.7

DBSCAN-SWA_97

1231967 : 1233026

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791493.1\|1231967_1233026_+	zinc-binding dehydrogenase	E3SJ82	Synechococcus_phage	1.3e-11	25.4

DBSCAN-SWA_98

1240078 : 1241647

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791484.1\|1240078_1241647_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.2e-52	35.7

DBSCAN-SWA_99

1260627 : 1261458

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005480808.1\|1260627_1261458_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	8.3e-59	48.2

DBSCAN-SWA_100

1267440 : 1268223

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025533375.1\|1267440_1268223_-	heme ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	9.1e-15	30.1

DBSCAN-SWA_101

1275494 : 1276409

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005457535.1\|1275494_1276409_-	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	2.1e-23	25.4

DBSCAN-SWA_102

1283689 : 1285594

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791447.1\|1283689_1285594_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	4.1e-45	31.5

DBSCAN-SWA_103

1290863 : 1291334

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005457571.1\|1290863_1291334_-	DNA starvation/stationary phase protection protein	A0A2H4N7L5	Lake_Baikal_phage	1.7e-21	37.4

DBSCAN-SWA_104

1304705 : 1308643

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791430.1\|1304705_1306277_+	ABC-F family ATP-binding cassette domain-containing protein	Q6DMX7	Streptococcus_phage	3.4e-29	31.5
WP_025791428.1\|1306483_1308643_+	S9 family peptidase	A0A1V0SHT0	Klosneuvirus	1.1e-67	34.3

DBSCAN-SWA_105

1317813 : 1320035

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025606326.1\|1317813_1318881_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.0e-17	30.7
WP_005459715.1\|1319183_1320035_-	carbenicillin-hydrolyzing class A beta-lactamase CARB-18	A0A077SL40	Escherichia_phage	8.3e-54	44.4

DBSCAN-SWA_106

1336690 : 1340494

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005487744.1\|1336690_1337617_-	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	6.9e-22	33.6
WP_005462020.1\|1337621_1338569_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_015312995.1\|1338862_1340494_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-35	53.8

DBSCAN-SWA_107

1358126 : 1359998

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791387.1\|1358126_1359998_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	9.1e-13	39.6

DBSCAN-SWA_108

1364417 : 1367575

Arthrobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011106286.1\|1364417_1365701_+	peptidoglycan DD-metalloendopeptidase family protein	V5R8R0	Arthrobacter_phage	2.3e-15	48.9
WP_005461969.1\|1365754_1367575_-	phosphodiesterase	A0A127AWB9	Bacillus_phage	4.7e-06	28.2

DBSCAN-SWA_109

1370922 : 1371537

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025507078.1\|1370922_1371537_-	glutaredoxin	A0A0K1YA09	Cronobacter_phage	1.7e-08	42.3

DBSCAN-SWA_110

1379724 : 1384547

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791371.1\|1379724_1381419_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	2.0e-91	36.5
WP_025791369.1\|1381749_1382913_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_025791367.1\|1382909_1384547_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	3.4e-11	36.4

DBSCAN-SWA_111

1393377 : 1397538

Lactococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375625.1\|1393377_1393587_-	cold-shock protein	Q9AZD3	Lactococcus_phage	1.7e-16	66.1
WP_005482651.1\|1393954_1394248_+	alternative ribosome-rescue factor A	NA	NA	NA	NA
WP_025791359.1\|1394276_1395620_-	PAS domain S-box protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-13	52.6
WP_077672456.1\|1395724_1395943_+	hypothetical protein	NA	NA	NA	NA
WP_024701407.1\|1396095_1397538_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.7e-14	31.4

DBSCAN-SWA_112

1400895 : 1405660

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021487108.1\|1400895_1401609_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-38	45.2
WP_025791349.1\|1401601_1402819_+	hypothetical protein	NA	NA	NA	NA
WP_080277399.1\|1402921_1404964_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.7e-15	28.1
WP_020835062.1\|1405180_1405660_+	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	1.1e-18	34.8

DBSCAN-SWA_113

1416133 : 1424199

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025577996.1\|1416133_1418104_-	acetoacetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	4.9e-17	25.5
WP_005461911.1\|1418325_1419120_+	phenylalanine 4-monooxygenase	NA	NA	NA	NA
WP_025791338.1\|1419109_1419448_+	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_080277429.1\|1419614_1421354_-	alkaline phosphatase	E3SII1	Synechococcus_phage	1.2e-06	34.4
WP_100550153.1\|1421331_1421427_+	hypothetical protein	NA	NA	NA	NA
WP_078231463.1\|1421571_1421940_+	HopJ type III effector protein	NA	NA	NA	NA
WP_017448075.1\|1421981_1422290_-	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_005375557.1\|1422463_1422679_+	hypothetical protein	NA	NA	NA	NA
WP_015313050.1\|1422948_1424199_+	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	1.1e-46	31.2

DBSCAN-SWA_114

1429503 : 1430796

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005482719.1\|1429503_1430796_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.5e-49	30.8

DBSCAN-SWA_115

1437602 : 1440860

Amsacta_moorei_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450758.1\|1437602_1439057_-	molybdate ABC transporter ATP-binding protein ModF	Q9EMR9	Amsacta_moorei_entomopoxvirus	8.1e-09	24.4
WP_074530807.1\|1439303_1440860_+	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	3.0e-33	44.6

DBSCAN-SWA_116

1450361 : 1464601

Lactococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017448089.1\|1450361_1452368_-	exoribonuclease II	Q0GXV6	Lactococcus_phage	1.5e-32	24.7
WP_005483383.1\|1452747_1454679_+	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	1.4e-53	30.6
WP_017448090.1\|1454753_1456355_-	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	3.5e-13	32.0
WP_005483343.1\|1456494_1456620_-	hypothetical protein	NA	NA	NA	NA
WP_005483382.1\|1456652_1457846_+	acetate kinase	NA	NA	NA	NA
WP_005498481.1\|1458124_1459438_+	PAS domain S-box protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-18	39.9
WP_005485953.1\|1459723_1460602_+	DMT family transporter	NA	NA	NA	NA
WP_025791309.1\|1460627_1461179_+	membrane protein	NA	NA	NA	NA
WP_025791307.1\|1461214_1462117_-	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	9.7e-45	36.6
WP_020835089.1\|1462113_1462959_-	gamma-carboxygeranoyl-CoA hydratase	NA	NA	NA	NA
WP_025791305.1\|1462996_1464601_-	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	1.2e-18	66.7

DBSCAN-SWA_117

1472439 : 1474176

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015313074.1\|1472439_1473342_+	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	1.6e-23	28.3
WP_024703243.1\|1473417_1474176_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.0e-06	27.0

DBSCAN-SWA_118

1482640 : 1484026

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791281.1\|1482640_1484026_+	FAD-binding oxidoreductase	A0A0B5JBT9	Pandoravirus	5.7e-36	26.5

DBSCAN-SWA_119

1488530 : 1489259

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005483352.1\|1488530_1489259_+	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	6.9e-25	34.8

DBSCAN-SWA_120

1506973 : 1509610

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005482134.1\|1506973_1507909_+	ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	6.9e-70	43.5
WP_005482136.1\|1507901_1508852_+	iron(III) ABC transporter permease	NA	NA	NA	NA
WP_015313103.1\|1508854_1509610_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.7e-13	26.2

DBSCAN-SWA_121

1513767 : 1514019

Salicola_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454365.1\|1513767_1514019_-	membrane protein	A0A248SJ16	Salicola_phage	2.7e-05	38.9

DBSCAN-SWA_122

1536698 : 1543425

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454354.1\|1536698_1538768_+	DNA helicase IV	A7KV33	Bacillus_phage	3.8e-20	25.6
WP_005454351.1\|1538846_1539302_-	methylglyoxal synthase	NA	NA	NA	NA
WP_025524227.1\|1539365_1540370_-	TMAO reductase system periplasmic protein TorT	NA	NA	NA	NA
WP_025791245.1\|1540458_1543425_+	TMAO reductase system sensor histidine kinase/response regulator TorS	A0A1V0SGX0	Hokovirus	2.4e-52	33.6

DBSCAN-SWA_123

1546792 : 1550196

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454070.1\|1546792_1548340_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	4.1e-136	50.8
WP_025791236.1\|1548648_1550196_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	3.8e-166	58.1

DBSCAN-SWA_124

1553656 : 1557668

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025787714.1\|1553656_1555183_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	2.4e-136	53.3
WP_011106325.1\|1555297_1556599_+	anaerobic sulfatase maturase	NA	NA	NA	NA
WP_025791233.1\|1556684_1557668_+	MoxR family ATPase	W0UTA7	Sulfolobus_monocaudavirus	3.9e-07	24.6

DBSCAN-SWA_125

1563370 : 1565784

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454234.1\|1563370_1563796_+	riboflavin-specific deaminase	A0A1V0SE20	Indivirus	4.4e-24	50.4
WP_011106326.1\|1563945_1564875_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025791226.1\|1564884_1565784_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	1.1e-11	23.8

DBSCAN-SWA_126

1576776 : 1584334

Lactococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020841994.1\|1576776_1577379_-	LemA family protein	A0A1X9IGG1	Lactococcus_phage	2.3e-18	35.8
WP_005454288.1\|1577596_1578964_-	anaerobic C4-dicarboxylate transporter DcuC	NA	NA	NA	NA
WP_025604515.1\|1579317_1580442_-	acyl-CoA desaturase	F2NZ38	Diadromus_pulchellus_ascovirus	1.1e-32	33.1
WP_005481267.1\|1580713_1581262_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_005498603.1\|1581348_1581966_-	HAD family phosphatase	NA	NA	NA	NA
WP_021450907.1\|1582285_1584334_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	6.1e-10	33.9

DBSCAN-SWA_127

1595281 : 1596190

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454057.1\|1595281_1596190_+	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.4e-06	36.8

DBSCAN-SWA_128

1604240 : 1605161

Vibrio_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010446562.1\|1604240_1605161_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	4.6e-175	98.7

DBSCAN-SWA_129

1614119 : 1620904

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791201.1\|1614119_1617785_+	transporter substrate-binding domain-containing protein	A0A1V0SGX0	Hokovirus	1.5e-30	35.8
WP_025791199.1\|1617768_1618935_+	EAL domain-containing protein	NA	NA	NA	NA
WP_005481323.1\|1618927_1619524_+	response regulator transcription factor	NA	NA	NA	NA
WP_005486479.1\|1619533_1620904_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	3.4e-09	29.1

DBSCAN-SWA_130

1625410 : 1626385

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005481272.1\|1625410_1626385_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	4.6e-133	75.4

DBSCAN-SWA_131

1649003 : 1650854

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791187.1\|1649003_1650854_-	acyltransferase	B5WZU0	Pseudomonas_phage	6.4e-67	31.7

DBSCAN-SWA_132

1656719 : 1660692

Ochrobactrum_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080277391.1\|1656719_1657331_+	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	7.6e-09	37.2
WP_080277390.1\|1657435_1658890_+	N-acylglucosamine 2-epimerase	NA	NA	NA	NA
WP_005395194.1\|1658990_1659242_+	DUF2999 family protein	NA	NA	NA	NA
WP_080277424.1\|1659512_1659965_+	hypothetical protein	NA	NA	NA	NA
WP_020842054.1\|1660185_1660692_+	peptide deformylase	E3SLL2	Synechococcus_phage	9.0e-16	41.8

DBSCAN-SWA_133

1665626 : 1668887

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033904873.1\|1665626_1667357_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	1.8e-63	31.7
WP_025606889.1\|1667495_1668023_-	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
WP_025791174.1\|1668272_1668887_-	3'-5' exonuclease	A0A0A7RWA3	Clostridium_phage	1.7e-21	38.0

DBSCAN-SWA_134

1676438 : 1681159

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021454517.1\|1676438_1679303_-	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.3e-273	52.5
WP_005454126.1\|1679431_1679812_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_005478453.1\|1679863_1681159_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	5.0e-103	52.3

DBSCAN-SWA_135

1686631 : 1689691

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025545773.1\|1686631_1689691_+	multidrug efflux RND transporter permease subunit VmeV	S5VTK5	Leptospira_phage	1.5e-52	22.0

DBSCAN-SWA_136

1701262 : 1701997

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791161.1\|1701262_1701997_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.7e-28	35.8

DBSCAN-SWA_137

1713944 : 1718432

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791156.1\|1713944_1717109_+	chitinase	A0A2K9L3D4	Tupanvirus	2.7e-25	25.5
WP_005498778.1\|1717217_1718432_-	glucose-1-phosphate adenylyltransferase	A0A1D7XFC1	Escherichia_phage	1.4e-09	26.1

DBSCAN-SWA_138

1722210 : 1722684

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454218.1\|1722210_1722684_-	hypothetical protein	A0A2I7SAK3	Vibrio_phage	1.1e-23	40.4

DBSCAN-SWA_139

1726690 : 1730627

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025532591.1\|1726690_1728121_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.8e-08	67.3
WP_005498789.1\|1728509_1728614_+	hypothetical protein	NA	NA	NA	NA
WP_005454393.1\|1728698_1729295_+	DUF479 domain-containing protein	NA	NA	NA	NA
WP_080277386.1\|1729361_1730627_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.3e-52	33.6

DBSCAN-SWA_140

1741869 : 1742889

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023622961.1\|1741869_1742889_+	TerC/Alx family metal homeostasis membrane protein	A0A291LBC5	Escherichia_phage	1.1e-39	40.2

DBSCAN-SWA_141

1754453 : 1755293

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005455357.1\|1754453_1755293_+	isopenicillin N synthase family oxygenase	S4VNP9	Pandoravirus	8.5e-11	38.8

DBSCAN-SWA_142

1761884 : 1762577

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025442747.1\|1761884_1762577_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.6e-21	31.2

DBSCAN-SWA_143

1769521 : 1772551

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791131.1\|1769521_1771480_+	diguanylate cyclase	G3MA91	Bacillus_virus	1.2e-26	39.5
WP_005498859.1\|1771534_1772551_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	8.0e-80	45.9

DBSCAN-SWA_144

1782339 : 1794513

Vibrio_phage(100.0%)

coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156216752.1\|1782339_1783476_-	assembly protein	O88128	Vibrio_phage	5.8e-180	81.3
WP_025791124.1\|1783472_1783787_-	DUF2523 domain-containing protein	A0A1W6UG81	Vibrio_phage	1.2e-39	81.7
WP_025791121.1\|1785504_1785738_-\|coat	major coat protein	O88142	Vibrio_phage	3.4e-18	72.7
WP_025625076.1\|1785745_1785991_-	single-stranded DNA-binding protein	A0A1W6UH23	Vibrio_phage	8.5e-28	76.5
WP_025625078.1\|1786002_1786338_-	hypothetical protein	R9TNS3	Vibrio_phage	1.6e-53	88.3
WP_025791119.1\|1786339_1787419_-	hypothetical protein	R9TRC1	Vibrio_phage	2.6e-193	89.7
WP_025791117.1\|1787548_1787899_+	helix-turn-helix transcriptional regulator	A0A0F6WBJ9	Vibrio_phage	6.9e-31	61.3
WP_033904865.1\|1788082_1788346_+	hypothetical protein	NA	NA	NA	NA
WP_156216752.1\|1788953_1790090_-	assembly protein	O88128	Vibrio_phage	5.8e-180	81.3
WP_025791124.1\|1790086_1790401_-	DUF2523 domain-containing protein	A0A1W6UG81	Vibrio_phage	1.2e-39	81.7
WP_025791121.1\|1792118_1792352_-\|coat	major coat protein	O88142	Vibrio_phage	3.4e-18	72.7
WP_025625076.1\|1792359_1792605_-	single-stranded DNA-binding protein	A0A1W6UH23	Vibrio_phage	8.5e-28	76.5
WP_025625078.1\|1792616_1792952_-	hypothetical protein	R9TNS3	Vibrio_phage	1.6e-53	88.3
WP_025791119.1\|1792953_1794033_-	hypothetical protein	R9TRC1	Vibrio_phage	2.6e-193	89.7
WP_025791117.1\|1794162_1794513_+	helix-turn-helix transcriptional regulator	A0A0F6WBJ9	Vibrio_phage	6.9e-31	61.3

DBSCAN-SWA_145

1797829 : 1798300

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791096.1\|1797829_1798300_-	hypothetical protein	A0A2I7RXE2	Vibrio_phage	3.3e-20	45.0

DBSCAN-SWA_146

1804959 : 1808107

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025791085.1\|1804959_1806816_-	hypothetical protein	A0A2I7RNF8	Vibrio_phage	2.6e-113	43.0
WP_025791083.1\|1806812_1807001_-	hypothetical protein	NA	NA	NA	NA
WP_025791081.1\|1807003_1807381_-	hypothetical protein	NA	NA	NA	NA
WP_021450890.1\|1807377_1807569_-	hypothetical protein	NA	NA	NA	NA
WP_021450889.1\|1807713_1807977_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_148299758.1\|1807996_1808107_-	hypothetical protein	Q9MCC3	Vibrio_phage	1.2e-05	64.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP046414

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 4469

Caulobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_129148034.1\|971_1226_-	hypothetical protein	NA	NA	NA	NA
WP_023623349.1\|1249_1648_-	hypothetical protein	NA	NA	NA	NA
WP_023623348.1\|1767_2184_-	hypothetical protein	NA	NA	NA	NA
WP_025789709.1\|2271_2685_-	hypothetical protein	NA	NA	NA	NA
WP_025818808.1\|2844_3183_-	hypothetical protein	NA	NA	NA	NA
WP_023623345.1\|3280_4174_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	3.8e-49	35.8
WP_025789710.1\|4283_4469_-	hypothetical protein	A0A1Z1LX74	Escherichia_phage	8.7e-09	58.5

DBSCAN-SWA_2

10748 : 13641

Clostridioides_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042770367.1\|10748_12698_-	hypothetical protein	A0A2R2ZGH5	Clostridioides_phage	5.1e-06	22.8
WP_010446562.1\|12720_13641_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	4.6e-175	98.7

DBSCAN-SWA_3

17226 : 18147

Vibrio_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010446562.1\|17226_18147_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	4.6e-175	98.7

DBSCAN-SWA_4

28247 : 30162

Escherichia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031419872.1\|28247_28913_-	AAA family ATPase	A0A222YXS3	Escherichia_phage	3.9e-35	39.9
WP_023624634.1\|29217_30162_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	1.7e-71	52.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046411

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046412

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP046414

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection