CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP046314	Gemella morbillorum strain FDAARGOS_741 chromosome, complete genome	1 crisprs	cas3,csa3,DEDDh,WYL,cas9	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046314_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046314_1

122036-122144

Unclear

Consensus_repeat	Method
CTAAAGCACCAGAATTACTTGCAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046314_1

>merge|NZ_CP046314|1|122036-122144|CRISPRCasFinder
CTAAAGCACCAGAATTACTTGCAGGTATGTCAACTGCTAAAACTGGAGCGGTTAGCCTTTCTACAGCACTTGCTCAAATGCAAGCTAAAGCACCAGAATTACTTGAGGG

>NZ_CP046314|1|1|122036-122144|CRISPRCasFinder
CTAAAGCACCAGAATTACTTGCAGG	TATGTCAACTGCTAAAACTGGAGCGGTTAGCCTTTCTACAGCACTTGCTCAAATGCAAG
CTAAAGCACCAGAATTACTTGAGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046314.1\|WP_004633485.1\|109869_112320_-\|copper-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783
NZ_CP046314.1\|WP_004633495.1\|115286_116291_-\|PTS-sorbitol-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|129905
NZ_CP046314.1\|WP_004633509.1\|127183_127627_-\|50S-ribosomal-protein-L9	unknown	unknown	gnl\|CDD\|234659
NZ_CP046314.1\|WP_004633507.1\|124775_125747_-\|signal-peptide-peptidase-SppA	unknown	unknown	gnl\|CDD\|132934
NZ_CP046314.1\|WP_004633483.1\|109658_109853_-\|heavy-metal-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|238219
NZ_CP046314.1\|WP_004633491.1\|114000_114798_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|180439
NZ_CP046314.1\|WP_004633498.1\|116874_117315_-\|glucitol-operon-activator	unknown	unknown	gnl\|CDD\|369138
NZ_CP046314.1\|WP_004633510.1\|127683_129639_-\|DHH-family-phosphoesterase	unknown	unknown	gnl\|CDD\|226404
NZ_CP046314.1\|WP_004633493.1\|114819_115176_-\|PTS-glucitol/sorbitol-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|367683
NZ_CP046314.1\|WP_004633508.1\|125799_127161_-\|replicative-DNA-helicase	unknown	unknown	gnl\|CDD\|273206
NZ_CP046314.1\|WP_004633511.1\|129640_130633_-\|DUF2232-domain-containing-protein	unknown	unknown	gnl\|CDD\|370773
NZ_CP046314.1\|WP_004633496.1\|116308_116854_-\|PTS-sorbitol-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|129901
NZ_CP046314.1\|WP_004633487.1\|112489_113164_-\|transaldolase	unknown	unknown	gnl\|CDD\|188643
NZ_CP046314.1\|WP_004633504.1\|123166_124003_+\|DegV-family-protein	unknown	unknown	gnl\|CDD\|273257
NZ_CP046314.1\|WP_004633513.1\|131639_132518_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226605
NZ_CP046314.1\|WP_004633512.1\|130842_131637_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224026
NZ_CP046314.1\|WP_004633514.1\|132532_133486_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380548
NZ_CP046314.1\|WP_004633506.1\|124057_124762_-\|RDD-family-protein	unknown	unknown	gnl\|CDD\|377640
NZ_CP046314.1\|WP_004633489.1\|113141_113819_-\|HAD-family-phosphatase	unknown	unknown	gnl\|CDD\|223710
NZ_CP046314.1\|WP_004633500.1\|117331_119242_-\|PRD-domain-containing-protein	unknown	unknown	gnl\|CDD\|226234

Protein	Function_ID	Function_description	E-value
NZ_CP046314.1\|WP_004633485.1\|109869_112320_-\|copper-translocating-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP046314.1\|WP_004633495.1\|115286_116291_-\|PTS-sorbitol-transporter-subunit-IIB	gnl\|CDD\|129905	TIGR00825, EIIBC-GUT, PTS system, glucitol/sorbitol-specific, IIBC component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Gut family consists only of glucitol-specific permeases, but these occur both in Gram-negative and Gram-positive bacteria.E. coli consists of IIA protein, a IIC protein and a IIBC protein. This family is specific for the IIBC component. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS].	9.85474e-169
NZ_CP046314.1\|WP_004633509.1\|127183_127627_-\|50S-ribosomal-protein-L9	gnl\|CDD\|234659	PRK00137, rplI, 50S ribosomal protein L9; Reviewed.	4.0573e-52
NZ_CP046314.1\|WP_004633507.1\|124775_125747_-\|signal-peptide-peptidase-SppA	gnl\|CDD\|132934	cd07023, S49_Sppa_N_C, Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad. Signal peptide peptidase A (SppA; Peptidase S49; Protease IV): SppA is found in all three domains of life and is involved in the cleavage of signal peptides after their removal from the precursor proteins by signal peptidases. This subfamily contains members with either a single domain (sometimes referred to as 36K type), such as sohB peptidase, protein C and archaeal signal peptide peptidase, or an amino-terminal domain in addition to the carboxyl-terminal protease domain that is conserved in all the S49 family members (sometimes referred to as 67K type), similar to E. coli and Arabidopsis thaliana SppA peptidases. Site-directed mutagenesis and sequence analysis have shown these SppAs to be serine proteases. The predicted active site serine for members in this family occurs in a transmembrane domain. Mutagenesis studies also suggest that the catalytic center comprises a Ser-Lys dyad and not the usual Ser-His-Asp catalytic triad found in the majority of serine proteases. Interestingly, the single membrane spanning E. coli SppA carries out catalysis using a Ser-Lys dyad with the serine located in the conserved carboxy-terminal protease domain and the lysine in the non-conserved amino-terminal domain.	1.18539e-71
NZ_CP046314.1\|WP_004633483.1\|109658_109853_-\|heavy-metal-associated-domain-containing-protein	gnl\|CDD\|238219	cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions.	4.17982e-08
NZ_CP046314.1\|WP_004633491.1\|114000_114798_-\|SDR-family-oxidoreductase	gnl\|CDD\|180439	PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional.	2.03441e-160
NZ_CP046314.1\|WP_004633498.1\|116874_117315_-\|glucitol-operon-activator	gnl\|CDD\|369138	pfam06923, GutM, Glucitol operon activator protein (GutM). This family consists of several glucitol operon activator (GutM) proteins. Expression of the glucitol (gut) operon in Escherichia coli is regulated by an unusual, complex system which consists of an activator (encoded by the gutM gene) and a repressor (encoded by the gutR gene) in addition to the cAMP-CRP complex (CRP, cAMP receptor protein). Synthesis of the mRNA, which initiates at the promoter specific to the gutR gene, occurs within the gutM gene. Expressional control of the gut operon appears to occur as a consequence of the antagonistic action of the products of the autogenously regulated gutM and gutR genes.	3.78329e-34
NZ_CP046314.1\|WP_004633510.1\|127683_129639_-\|DHH-family-phosphoesterase	gnl\|CDD\|226404	COG3887, COG3887, Predicted signaling protein consisting of a modified GGDEF domain and a DHH domain [Signal transduction mechanisms].	0
NZ_CP046314.1\|WP_004633493.1\|114819_115176_-\|PTS-glucitol/sorbitol-transporter-subunit-IIA	gnl\|CDD\|367683	pfam03829, PTSIIA_gutA, PTS system glucitol/sorbitol-specific IIA component.	7.22867e-40
NZ_CP046314.1\|WP_004633508.1\|125799_127161_-\|replicative-DNA-helicase	gnl\|CDD\|273206	TIGR00665, DnaB, replicative DNA helicase. This model describes the helicase DnaB, a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of > 400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. The seed alignment contains inteins so that the model built from the seed alignment will model a low cost at common intein insertion sites. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP046314.1\|WP_004633511.1\|129640_130633_-\|DUF2232-domain-containing-protein	gnl\|CDD\|370773	pfam09991, DUF2232, Predicted membrane protein (DUF2232). This family of bacterial proteins are multi-pass membrane proteins with up to 10 (2 x 4/5) transmembrane regions. The exact function of this potential pore molecule is not known, but in many instances it is associated with ABC-transporter-like domains, implying that it is part of a secretion system that uses energy.	6.42591e-08
NZ_CP046314.1\|WP_004633496.1\|116308_116854_-\|PTS-sorbitol-transporter-subunit-IIC	gnl\|CDD\|129901	TIGR00821, Glucitol/sorbitol_permease_IIC_component, PTS system, glucitol/sorbitol-specific, IIC component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Gut family consists only of glucitol-specific transporters, but these occur both in Gram-negative and Gram-positive bacteria.E. coli consists of IIA protein, a IIC protein and a IIBC protein. This family is specific for the IIC component. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS].	4.9661e-98
NZ_CP046314.1\|WP_004633487.1\|112489_113164_-\|transaldolase	gnl\|CDD\|188643	cd00956, Transaldolase_FSA, Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea. Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases. FSA catalyze an aldol cleavage of fructose 6-phosphate and do not utilize fructose, fructose 1-phosphate, fructose 1,6-phosphate, or dihydroxyacetone phosphate. The enzymes belong to the transaldolase family that serves in transfer reactions in the pentose phosphate cycle, and are more distantly related to fructose 1,6-bisphosphate aldolase.	5.17811e-67
NZ_CP046314.1\|WP_004633504.1\|123166_124003_+\|DegV-family-protein	gnl\|CDD\|273257	TIGR00762, DegV, EDD domain protein, DegV family. This family of proteins is related to DegV of Bacillus subtilis and includes paralogous sets in several species (B. subtilis, Deinococcus radiodurans, Mycoplasma pneumoniae) that are closer in percent identity to each than to most homologs from other species. This suggests both recent paralogy and diversity of function. DegV itself is encoded immediately downstream of DegU, a transcriptional regulator of degradation, but is itself uncharacterized. Crystallography suggested a lipid-binding site, while comparison of the crystal structure to dihydroxyacetone kinase and to a mannose transporter EIIA domain suggests a conserved domain, EDD, with phosphotransferase activity. [Unknown function, General].	2.7947e-75
NZ_CP046314.1\|WP_004633513.1\|131639_132518_-\|ABC-transporter-permease	gnl\|CDD\|226605	COG4120, COG4120, ABC-type uncharacterized transport system, permease component [General function prediction only].	1.55217e-89
NZ_CP046314.1\|WP_004633512.1\|130842_131637_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224026	COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only].	2.90477e-121
NZ_CP046314.1\|WP_004633514.1\|132532_133486_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380548	cd06325, PBP1_ABC_unchar_transporter, type 1 periplasmic ligand-binding domain of uncharacterized ABC-type transport systems predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This group includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP); its ligand specificity has not been determined experimentally.	1.5443e-99
NZ_CP046314.1\|WP_004633506.1\|124057_124762_-\|RDD-family-protein	gnl\|CDD\|377640	pfam06271, RDD, RDD family. This family of proteins contain three highly conserved amino acids: one arginine and two aspartates, hence the name of RDD family. This region contains two predicted transmembrane regions. The arginine occurs at the N-terminus of the first helix and the first aspartate occurs in the middle of this helix. The molecular function of this region is unknown. However this region may be involved in transport of an as yet unknown set of ligands (Bateman A pers. obs.).	2.35781e-23
NZ_CP046314.1\|WP_004633489.1\|113141_113819_-\|HAD-family-phosphatase	gnl\|CDD\|223710	COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only].	4.67209e-52
NZ_CP046314.1\|WP_004633500.1\|117331_119242_-\|PRD-domain-containing-protein	gnl\|CDD\|226234	COG3711, BglG, Transcriptional antiterminator [Transcription].	1.63569e-23

>NZ_CP046314.1|WP_004633500.1|117331_119242_-|PRD-domain-containing-protein
MEIFNYDNRSLRLLNILESNFLVQDKYLIDVLKVSSKTINNEIKSLNEIFGSCAYIESKNSNYSLYIIKLEEYLKKKRSIYEAGENFDSSKVRLVYIFKKLVSTSDGQLIDDLAFEMIVSRTTLNTDLKKLNEIINDYNLVIKGKPNIGIKIVGLEKDIRIFILENIYNYMYKEDIFDKEDNKFFDEMFVKYKIDEQAKGEFLKYLTVSIDRFANGFRLNLVENQYEELLDSYAKDFIKEVCEYTTLKYGITLNQDEMKFLAICFATMRVPTKINKIRENLKYTEEYKKLVQEILEIVVYEYGLKFDTSDIIEEFIYHIYFLMERLKYGVRYHNNMKEKIKKDFPVSYKIARTASEVITEKYQYSVSEDEISYLAIYFETFLKKIKIQPDNLKILLVTNAGPAYKKLMIKELENISQSSEITVVTTYENVKYDNFDIIISTVNKNFETTIPIIYQNEILDIVYLKKEINFLRYVNKMNNPAIRGMESIVLSSMSESTFFVCDNRKTYAENLETMIKGLEAKGFVDKEFLLRIREREQKSSMIFADSVAFPHTQNEKENSLLIALGVCKDGFKDNKELKLIFLACVPKDGDQGLLLAKTYDELISIIKDKKLIDDISKVEGYNSLVNYFIKHTNLYR
>NZ_CP046314.1|WP_004633498.1|116874_117315_-|glucitol-operon-activator
MNLLVLGILFITAFILQYALTFVQMSSFKKSYAELRRKGRVVIGRKKGAARAGAIVMFAIDNNDKVITGEAMQGVTVLARFKKFDYFDGIKVGTINRDDCKAIRLSSSLTSAVLDGVVNYKTISAGGEVEMEQSPFGKLAKKLKFN
>NZ_CP046314.1|WP_004633496.1|116308_116854_-|PTS-sorbitol-transporter-subunit-IIC
MDYIVKIASGFTGLFDEGAKVFVSWVGGIVPKVLLLLVFMNALVAFIGPHRVEKFAKVCSKNVILAYGILPFVSAFMLANPMALSMGKFLPERMKPSYYASASYHCHTNSGVFPHINVGEIFIYLGIANGITQLGLNVAPLAVRYLLVGLVMNFFAGWVTDFTTKMVMKQQKIELSNTLKA
>NZ_CP046314.1|WP_004633495.1|115286_116291_-|PTS-sorbitol-transporter-subunit-IIB
MTYGTIKIEKGSGGFGGPLVVTPKPGKDKILYITGGGAEPEIVEKIVKLTGATPVNGFKTSVPDEEIFLAIIDCGGTLRCGIYPQKRIPTVNIMPVGPSGPLSKFIKEDIYVSAVGLDQITVEEGSEVAEEVVAVEEPKREFKYSADKKVSQSLAENSKSSIIQKIGMGAGKVVHTLYQAARDAVQSMITTILPFMAFVAMLIGIIQGSGFGNWFAKLLTPLAGNIFGLVALGFVCSIPLLSALLGPGAVIAQIIGTLIGVEIGKGTIPPQLALPALFAINTQCACDFIPVGLGLAEAEPETVEVGVVSVLYSRFIIGVPRVIVAWLASFGMYS
>NZ_CP046314.1|WP_004633493.1|114819_115176_-|PTS-glucitol/sorbitol-transporter-subunit-IIA
MIIYENIVKAKGSLVGEFGDGMFILFGDNAPDMLKDYCYSIDVLPTNGKIEVGQTLTVDGERFEILGVGDVAEKNLVDLGHLTVHFSGDLESLLPGAIVVENKSCPPIDINTKITIEK
>NZ_CP046314.1|WP_004633491.1|114000_114798_-|SDR-family-oxidoreductase
MSWLNLEGKTVIVTGGASGIGAAVVDEFLNQGCNVVVSDLSEKETDNEKLLYVKCDVTKRSDVKNVVSKTLEKFGNIDILVNNAGINIPRLLVDKNNPESKYEFTDEVYDKIMDINVKGLFIFSQEVGRILVKNSKGVIVNMSSESGLEGSEGQSIYAASKNAVNSLTRSWAKELGKLGVRVVGVAPGILEATGLRTLAYEEALAYTRGVTVEQIRAGYTSTKTTPLGRDGKLSEVADLVVYVASDRASYVHGVTYNVAGGKTRG
>NZ_CP046314.1|WP_004633489.1|113141_113819_-|HAD-family-phosphatase
MKIEAVLFDMDGLMVDTESLSTKALISSAKKQDYEMTKEETLQVLGFTEAAIYKFWEDYFEDSHVDGKKLADDHYGYIEEVLFTTGPDKMPNVEELLVYLKENNYKIAVASSSNIDHIENNMEKTRLRKYIDKIASGQEVLNGKPAPDVFLLAAERLGVKPENCLVLEDSKSGIKAGRASGATVFMVPDMFKPDEECIEIANRILKNLGEVINILEEENDKDFNR
>NZ_CP046314.1|WP_004633487.1|112489_113164_-|transaldolase
MTKILIDSADIKKAREIEKYYTIAGITTNPTILSKIEGSLEDKLKELKEFTYGKYEVHVQTTESEVEKIVEEAKKLRDYFGESFYIKIPVTKAGLEAIKLCSKENIRVTATAILTAMQALAAAKNGANYVAPYVNRMENVGQDAKEAILEISNLLIDYPTEILAASFKNVKQVQDILRCGAEAATIAPEIIEASIWHPYTDKSVFDFEKDWENRFGDKKIVDGI
>NZ_CP046314.1|WP_004633485.1|109869_112320_-|copper-translocating-P-type-ATPase
MIKKEIYNIEGMSCASCASSIEKIVGKISGVRNVSVNLATEKMFIESEEEVSTEDIEQTIKNAGYFAKLVDNNVSTFSLEGMSCASCARNIENVVGKVSGVQSVSVNLATEKMTVIFDRSKVNIKDIEDAVERAGFKAIEDKVFKDSTQGQKVKKAKQINSLLHRFLWSAIFAIPLLYLSMADMIGLPTIINPMEQAKLFATIQIILVLPILYLGRSFYLVGVKSLFKGHPNMDSLVALGSGAAVIYSLYSTVLIYLGNEHSVMNLYYESAGVILTLITLGKYFEVVSKERTSGAIAALVSLAPKTANVMRNGEKVKLNVENIVIGDIIVVRPGEKIPLDGRITKGASSVDEAMLTGESLPVDKNIGDNVIGASINKTGTFEMIVTKVGEDTALAQIIKLVEEAQGSKAPISKLADKIASVFVPVVIFLAVLSGTLWYFVGHESWIFALTISISVLVIACPCALGLATPTSIMVGTGLGAEHGILIKSGEVIETAQSVNVVVFDKTGTLTEGKLKVTDVVSFDNYDENEVLRLAASIEHYSEHSLGEAIVNLAREKEFILSEVENFKANSGLGISGKVDGENILVGNKVFLENNSISIEEHLLIADKFSVEGKTPLFIVYGNKLIGIIAVADTIKTSSKEAVKKLKQMGIKIIMLTGDNKKTAEIIAKQIEIDEVISEVLPENKSKEIARLQQAGNRVAMVGDGINDAPALVQADVGIAMGAGTDVAIESADIVLMNNDMLSVTRTIKLSRVTIKNIKENLFWAFIYNIIGIPVAMGVLHIFGGPLLNPMIAGAAMSFSSVSVVLNALRLKRIGIK
>NZ_CP046314.1|WP_004633483.1|109658_109853_-|heavy-metal-associated-domain-containing-protein
MEKVYNIEGVKCGGCAAVVKEKLSDIEGVETVEVDIAKKKLIVVGTTDKEVLQKALSDTKFKID
>NZ_CP046314.1|WP_004633504.1|123166_124003_+|DegV-family-protein
MKTAFVCDSTLQVNEEFCKNYPLSIVPLEVRLDDELYEDNVTITPEEFYKKINSGMKPSTSQPSVGKILEVYENLKAQGFERIVAFTVTSKLSGTYSSFTQASELIEGIDIKIIDTLQVARIVGCAVEKIIKDFSNGNLAYENIEDECRKLLKQQNILVTIENMDFLYAGGRLTKTQFLLSNFLNILPIITIKDGILDVSGKHRGMSKVLTKICEEIKEKDPKSLIILYTTDDLLKKAQDVVAKTFGNIETEAIIISPVIGTHAGPRAVGIGYLEYEK
>NZ_CP046314.1|WP_004633506.1|124057_124762_-|RDD-family-protein
MTNNNFNSNDFSNGCEGLENGSEQTFDKMAESVDKANVEGISSSIEENRFDEQTKETTSKDNTNFSLPTTLKDYLIFSRNFYSGFWVRFIAYIIDLIVVAALAGLLNTYSFGLLNRELYFPILGEEGLSYVVVMFSYFILMTYYFSQTLGKMIMKVKVETNKGTKLKISDVLYREVIGRLLTIALFNIPYIVVAFTDKKKGLHDYIADTVVVKEDFSSIRRQMNERLENMKQEG
>NZ_CP046314.1|WP_004633507.1|124775_125747_-|signal-peptide-peptidase-SppA
MNFKNKRVISLVIVMVLVVFSLINGTLTKSTIQKQSTEDSYVQMFLRSQSVHKLTLVDGNSDETIQKISIEGEIGAEMTNTYSRASIINQIKEAKSNSNVKAILLSVNTPGGGVYETAELYNELKNSGKDVYVSMKKQATSGGYYVSMAAKKIFANTETTTGSLGVIMSFVSAQKYLNDHGIKQETIRSGEQKAIGGLLEDLPESTRKIYQEQNKEAYDRFVKAIAQGRNMSEDEVRKLADGRTYTGTQAVENKLIDKIGTEEDLINFIKEDKKLFNPKVIELRPDKAAESLLSRFVKATMKSIISELNSEATSNQVERSYLG
>NZ_CP046314.1|WP_004633508.1|125799_127161_-|replicative-DNA-helicase
MKYHIDSVLLAEQSLLGALMQEPEKLIEVKATVDPEDFYDEKNKDIYSAILRLDEAGILPDTTTIFEEINNSGAFKNVDASLYIVDVYDVTPSARNIMHYANLVKRYSIYREIRGALLSSTEEMNQGNADIDALTSTLFDQVERAMERAKTSHFKNMRDVTDEVFKEILARMSGEGKNIAIPTGFSSLDQVIGLGKGDLVILAARPSMGKTAFALNIALNVAGKNHRSEEEKRTVALFSLEMGADQLVSRMICSEGMLDSEKIKKGSLDNDDLMKLETAVHFLNQKNIFIEDSAFIKVNEVKAKCKLLKSEHGLDLVIIDYLQLLQGSKRTDNRQQEVSEISRSLKQMARELECPVIALSQLSRSVESRHDKRPMMSDLRESGSIEQDADIVSFLYRGDYYRSEDADENEVQEPSDVSTVEVIVAKNRNGQTGTAELAFMKRYNKFVSKTYGE
>NZ_CP046314.1|WP_004633509.1|127183_127627_-|50S-ribosomal-protein-L9
MKVIFIEDVKGKGKKGDVKEIADGYAKFLITNKKAIQATTANMATLKGQQKRVEKDKQEELVQAKLLAKQLEGLEVKIKVKAGEGGRLFGSVSSKQIVEELKKQHDLKVDKKKIDLPNGIQALGYTNVKIKIHNQVEGTIKVHVVEQ
>NZ_CP046314.1|WP_004633510.1|127683_129639_-|DHH-family-phosphoesterase
MNAKRKYEIVIFTLYTIGAIIIGLMNLISLAVYLVVGLSVFMLFYYYKKKVSEQTEKYISKLTNRIKDSTEKGINKFPIGIIVIDKDRNIEWANNFIYKNIKVEEIKGLNILELMPEIKDLFELETPVDNQFEIFGKHYKVNYQKDSGYIYFFDITESKVVMQRFRDTRPIIFNLSLDNYEDVYDSLDDEVASKFDSQVVTVLTEWAKKNSIYLKRIDEDRFIGLLNVKDLKKIEKNKFQILDSIRNLKEEFDAPITLSIGVGMGTDFLPELGELAKSSLDLALGRGGDQVAMKDIDGTIKFYGGKTNPQEKRTRIKARVVSNALADIISDSDKIIVMGHKHPDFDAIGGCIGIYTFAKLVGKECYIILNESDQDETIQKIMFEINDTDETLSNVFVDSDEAWELMTPQTTLIVVDTSDASRVIDAAILSKANKKVVIDHHRRGEDIITNPLLTYIEPYASSSSELIAELIEYQTKIEKITPLAATIMLGGIVVDTQNFSIRTGSRTFDAAAYLRSNGADPTKVKTILKEPIENFMSRVEIINNAIQKTPEIIIVKAPDDKRYTNVMLAQSADLLLTLKGIECSFALGYLDEDKVGISARSLGNMNVQLVMEELGGGGHLANAATQIEGVDLDEALVRLNDAIDRVLLQED
>NZ_CP046314.1|WP_004633511.1|129640_130633_-|DUF2232-domain-containing-protein
MDNNISETLKRELEKLLDSKFFYREPSNNKVIAYSISFLLLILLGSLLKVELLTAFLAIFPLTYVLGAKGLKFYIPLAAVGTAMLVFLSSPHMLFWFVMHMLLAYLIYQSIVKRYSKIYLLIIITTFLFIGLAFYVLLLIKYGVININQEEILKFINDYINAMLTANQSLDKSLVLSSFENIQRTFPVTLFISLFIYSLALLQYTLSMLSREYIIIPTFPKLSRIMISTKTGYIYITITLVYLIVESMMGANSYNFWYILLQNLTNILSLIFVLNGLFTAFFFIEQKGDSPVTKALAVFGMILFSSVFELVGFVDSLFRLRETYIIKKGE
>NZ_CP046314.1|WP_004633512.1|130842_131637_-|ABC-transporter-ATP-binding-protein
MSLVLKNIEKTFEKGTINENHVLRNLCLEIEDGGFVSIIGSNGAGKSTLMNVIAGVLFPDSGTVSLDGVDVTKDGVTKRSKDISRVFQDPKMGTATRMTVEQNMAIALKRGKSRSFSPGVKKEDRELYKTALEELGLGLENRLKSSVEFLSGGQRQALTLVMSTLVKPKLLLLDEHTAALDPKTSAMVMNLTDKIVKKNNLTTVMITHNMEHAIEYGDRLVMLHEGHVVVDIKGEEKKDLTVAKLLELFKKNSGSNIINDDMML
>NZ_CP046314.1|WP_004633513.1|131639_132518_-|ABC-transporter-permease
MDILLSSVSQGLLWSIMAIGVYITFRLLDIPDLTAEGSFPLGAAICAISLVNGMNPFLATFLGMLGGLVIGVVSGLLHTKMKIPALLTGIITLTGLYSINLKILGKANIALLKEKTLVTMLQGFGIPKVYAVILLGLVFSLVLIVLLTIFLKTEVGLAILSTGDNEDMSAANGIRIDNMKILGYMISNGFIALSGALLAQNNGFADLNMGVGTIVIGLASIIIAEVVIKNLSLGKRIASIIIGSIIYRLIISLVLEIPGMDTQLVKLFSAIILAIILFIPELEKKFPKGVRR
>NZ_CP046314.1|WP_004633514.1|132532_133486_-|ABC-transporter-substrate-binding-protein
MKFKKLKVLLGISLLVLGGCSNKGEVKTDNIKIGVLQYAEHNALTSAREGFVEALAEERYTSDKVTFNVQNAMGDQSNLQTIAEQLARKNDLNFVIATPAAQAMVNVDDRTPTIFTAVTDPVAASLLVKTDAPEGNVTGTVDLTPVDKQIEKLLKIVPKAKKVGIFYNSSEVNSEAQAKIAKETLKKSGIEVVEKTVTTTNDVQQVITSLASEVDAIYFPTDTTVASTISTIGTVLKEKKVPALGGDKAVLEGMLVTYGVDYKEIGRQAGRQAAQILKGKKISELPVEQPKKLAVDINDDMVRALGLNKEELLKVLG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

973932 : 980561

Bacillus_phage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003144688.1\|973932_974205_+	HU family DNA-binding protein	A0A1P8CWT5	Bacillus_phage	3.7e-24	66.7
WP_004634220.1\|974273_974834_+	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	7.4e-35	45.3
WP_004634222.1\|974867_975074_+	trp RNA-binding attenuation protein MtrB	NA	NA	NA	NA
WP_083800620.1\|975116_976271_-	NADH peroxidase	A0A2K5B2C5	Erysipelothrix_phage	7.9e-07	26.5
WP_040461953.1\|976355_976481_-	hypothetical protein	NA	NA	NA	NA
WP_004634227.1\|976855_977131_+	co-chaperone GroES	NA	NA	NA	NA
WP_004634228.1\|977139_978744_+	chaperonin GroEL	A0A240F779	uncultured_virus	1.2e-154	54.1
WP_004634230.1\|978826_979132_+	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	8.7e-22	46.1
WP_004634232.1\|979223_980561_-	type I glutamate--ammonia ligase	A0A2P1EM84	Moumouvirus	1.9e-12	25.4

DBSCAN-SWA_2

1303768 : 1315258

Prochlorococcus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004632134.1\|1303768_1305073_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	7.3e-17	29.7
WP_004632135.1\|1305118_1306354_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_004632138.1\|1306353_1307874_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.2e-71	49.4
WP_004632139.1\|1307870_1308437_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	7.7e-24	36.3
WP_004632142.1\|1308433_1309438_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.4e-65	43.6
WP_004632144.1\|1309430_1310888_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.0e-48	33.3
WP_004632146.1\|1310874_1311582_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	1.8e-41	39.4
WP_004632148.1\|1311583_1315258_-	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	1.3e-26	25.0

DBSCAN-SWA_3

1460690 : 1490489

Streptococcus_phage(75.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004632328.1\|1460690_1461641_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	3.6e-42	34.2
WP_004632329.1\|1461994_1463212_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	2.0e-109	54.8
WP_001825268.1\|1464054_1464174_+	hypothetical protein	NA	NA	NA	NA
WP_000420682.1\|1464196_1464511_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
WP_000985015.1\|1464526_1464913_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000813488.1\|1464941_1466327_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000879507.1\|1466329_1466482_+	hypothetical protein	NA	NA	NA	NA
WP_000398284.1\|1466504_1467710_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_001009056.1\|1467752_1467974_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000342539.1\|1468090_1468588_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_000506270.1\|1468562_1469069_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000331160.1\|1469052_1471500_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_000804748.1\|1471502_1473680_+	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_000769868.1\|1473676_1474678_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_001224320.1\|1474674_1475610_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	7.7e-170	99.0
WP_012386611.1\|1475884_1475971_+	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_004632336.1\|1475986_1477906_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A2K5B2A5	Erysipelothrix_phage	0.0e+00	99.5
WP_011058338.1\|1478006_1478192_+	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
WP_001814874.1\|1478804_1478888_+	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_001038790.1\|1479012_1479750_+	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	1.4e-134	99.6
WP_000085855.1\|1479754_1479886_+	hypothetical protein	E4ZFP9	Streptococcus_phage	8.2e-14	90.7
WP_000576156.1\|1480104_1480659_+	recombinase family protein	A0A0F7LA37	Escherichia_phage	2.3e-36	52.1
WP_001240982.1\|1480662_1483581_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.1e-169	36.1
WP_013670292.1\|1484080_1484152_+	hypothetical protein	NA	NA	NA	NA
WP_154021776.1\|1484231_1484390_-	hypothetical protein	NA	NA	NA	NA
WP_000804885.1\|1484380_1484803_+	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_000857133.1\|1484799_1485030_+	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_001845478.1\|1485255_1485507_-	hypothetical protein	NA	NA	NA	NA
WP_000814511.1\|1485490_1485694_+	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_001291561.1\|1485775_1486993_+\|transposase	transposase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
WP_004632341.1\|1487677_1489036_+	guanine deaminase	NA	NA	NA	NA
WP_004632343.1\|1489169_1490489_+	xanthine/uracil permease	Q9KX94	Enterobacteria_phage	5.6e-17	25.3

DBSCAN-SWA_4

1743086 : 1749423

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004632744.1\|1743086_1743851_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-18	28.5
WP_004632745.1\|1744670_1745009_-	Cd(II)/Zn(II)-sensing metalloregulatory transcriptional regulator CadX	E4ZFI8	Streptococcus_phage	6.5e-10	32.4
WP_004632746.1\|1745020_1745647_-	CadD family cadmium resistance transporter	NA	NA	NA	NA
WP_004632747.1\|1746458_1746764_+	rhodanese-like domain-containing protein	A0A2H4PQR9	Staphylococcus_phage	7.3e-13	46.2
WP_004632748.1\|1746858_1747155_+	rhodanese-like domain-containing protein	A0A2H4PQR9	Staphylococcus_phage	4.9e-14	40.7
WP_004632749.1\|1747283_1747541_-	metal-sensitive transcriptional regulator	NA	NA	NA	NA
WP_040461492.1\|1747684_1748713_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.8e-26	28.2
WP_004632751.1\|1748733_1749423_-	response regulator transcription factor	W8CYM9	Bacillus_phage	6.9e-35	39.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage