CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP046162	Vibrio sp. THAF191c chromosome, complete genome	0 crisprs	DEDDh,csa3,DinG,csx1,cas3	0	3
NZ_CP046165	Vibrio sp. THAF191c plasmid pTHAF191c_d, complete sequence	0 crisprs	NA	0	2
NZ_CP046164	Vibrio sp. THAF191c plasmid pTHAF191c_c, complete sequence	1 crisprs	WYL,csa3	1	1
NZ_CP046163	Vibrio sp. THAF191c plasmid pTHAF191c_b, complete sequence	0 crisprs	csa3,WYL,DEDDh,cas3	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

646824 : 656142

Faustovirus(14.29%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006959830.1\|646824_648039_+	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	6.3e-31	29.9
WP_004412993.1\|648090_648474_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	1.2e-52	78.2
WP_006959829.1\|648541_648865_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	1.2e-24	50.5
WP_043006939.1\|648920_649436_+	co-chaperone HscB	NA	NA	NA	NA
WP_006959827.1\|649455_651309_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.0e-109	40.3
WP_006959826.1\|651322_651661_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_006959825.1\|651684_651879_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_006959824.1\|652041_653340_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	1.2e-35	34.4
WP_006959823.1\|653398_653827_+	nucleoside-diphosphate kinase	L7Y4C4	Megavirus	5.5e-22	42.9
WP_006959822.1\|654054_656142_+	elongation factor G	E4ZFJ7	Streptococcus_phage	2.0e-61	27.6

DBSCAN-SWA_2

1258354 : 1326991

Vibrio_phage(29.63%)

integrase,head,transposase,plate,terminase,tail,capsid,portal

attL 1248409:1248424|attR 1299764:1299779

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1248409:1248424	attL	NA	NA	NA	NA
WP_039951144.1\|1258354_1258801_+\|transposase	IS200/IS605 family transposase	Q331U4	Clostridium_botulinum_C_phage	1.3e-21	35.6
WP_006959068.1\|1258894_1259212_-	hypothetical protein	NA	NA	NA	NA
WP_006959067.1\|1259338_1259887_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_006959066.1\|1259946_1260720_-	peptidoglycan binding protein CsiV	NA	NA	NA	NA
WP_006959065.1\|1260774_1264236_-	transcription-repair coupling factor	NA	NA	NA	NA
WP_006959064.1\|1264243_1264813_-	hypothetical protein	NA	NA	NA	NA
WP_006959063.1\|1264978_1266184_+	lipoprotein-releasing ABC transporter permease subunit LolC	NA	NA	NA	NA
WP_152472092.1\|1266176_1266863_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	6.7e-38	40.0
WP_006959061.1\|1266864_1268109_+	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
WP_006959060.1\|1268217_1268748_-	DUF2062 domain-containing protein	NA	NA	NA	NA
WP_006959059.1\|1268756_1270994_+	DNA internalization-related competence protein ComEC/Rec2	Q0H255	Geobacillus_phage	2.1e-11	27.1
WP_006959058.1\|1271025_1272774_+	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	1.4e-60	30.9
WP_006959057.1\|1272777_1273785_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_006075338.1\|1273765_1273945_+	Trm112 family protein	NA	NA	NA	NA
WP_006959056.1\|1273944_1274697_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_006959055.1\|1274727_1276266_-	SpoVR family protein	NA	NA	NA	NA
WP_006959054.1\|1276276_1277548_-	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	9.9e-11	38.1
WP_006959053.1\|1277684_1279619_-	PrkA family serine protein kinase	NA	NA	NA	NA
WP_006959052.1\|1279957_1280725_+	MipA/OmpV family protein	NA	NA	NA	NA
WP_006959051.1\|1280789_1281290_-	YfbU family protein	NA	NA	NA	NA
WP_039951644.1\|1281415_1282081_-	energy-coupling factor ABC transporter permease	NA	NA	NA	NA
WP_029236135.1\|1282150_1282891_-	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	8.8e-28	32.4
WP_006959048.1\|1283117_1284998_+	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_039951642.1\|1284994_1285996_-	lipid A deacylase LpxR family protein	NA	NA	NA	NA
WP_006959046.1\|1286166_1288443_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	3.5e-160	42.1
WP_006959045.1\|1288742_1290290_-	DUF3360 family protein	NA	NA	NA	NA
WP_006959044.1\|1290965_1291736_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-14	27.1
WP_006959043.1\|1291805_1292576_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006959042.1\|1292700_1293441_+	ABC transporter permease	NA	NA	NA	NA
WP_006959041.1\|1293444_1294122_+	ABC transporter permease	NA	NA	NA	NA
WP_006959040.1\|1294181_1295864_-	aspartate:alanine antiporter	NA	NA	NA	NA
WP_006959039.1\|1296053_1296320_-	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	4.3e-25	70.5
WP_152472093.1\|1296850_1297879_-\|integrase	tyrosine-type recombinase/integrase	A0A160DJR8	Vibrio_phage	8.9e-95	51.1
WP_152472094.1\|1298078_1298321_-	DUF4177 domain-containing protein	A0A0A7NPW2	Enterobacteria_phage	2.7e-18	57.5
WP_152472095.1\|1298611_1299607_-	hypothetical protein	NA	NA	NA	NA
WP_152472096.1\|1299606_1301037_-	ATP-binding protein	NA	NA	NA	NA
1299764:1299779	attR	NA	NA	NA	NA
WP_152472097.1\|1301095_1302250_-	DNA (cytosine-5-)-methyltransferase	M1PSQ0	Streptococcus_phage	4.0e-35	29.4
WP_152472098.1\|1302472_1303099_-	helix-turn-helix domain-containing protein	A0A1D9C9M6	Salinivibrio_phage	2.2e-32	37.1
WP_019275486.1\|1303190_1303403_+	hypothetical protein	U3PFJ1	Vibrio_phage	8.7e-13	51.4
WP_021455699.1\|1303514_1304054_+	phage regulatory CII family protein	A0A2I7RNI1	Vibrio_phage	5.8e-53	59.2
WP_152472099.1\|1304082_1304295_+	hypothetical protein	A0A2I7RNH0	Vibrio_phage	1.2e-14	60.3
WP_152472100.1\|1304282_1304510_+	hypothetical protein	U3PIK2	Vibrio_phage	1.8e-16	52.8
WP_019275356.1\|1304506_1304740_+	hypothetical protein	NA	NA	NA	NA
WP_152472101.1\|1305064_1307176_+	hypothetical protein	A0A2I7RNF8	Vibrio_phage	2.9e-164	45.7
WP_152472102.1\|1307272_1307467_-	hypothetical protein	NA	NA	NA	NA
WP_031342464.1\|1307715_1307934_+	hypothetical protein	Q8HA64	Vibrio_phage	1.7e-16	63.9
WP_045985106.1\|1307959_1308202_+	ogr/Delta-like zinc finger family protein	F1BUT0	Erwinia_phage	4.5e-05	41.5
WP_095560569.1\|1308236_1308680_-	hypothetical protein	NA	NA	NA	NA
WP_152472103.1\|1309389_1310580_+	DNA circularization N-terminal domain-containing protein	NA	NA	NA	NA
WP_152472104.1\|1310576_1311515_+\|tail	phage tail protein	NA	NA	NA	NA
WP_152472105.1\|1311507_1312113_+\|plate	phage baseplate assembly protein	NA	NA	NA	NA
WP_152472106.1\|1312109_1312511_+	phage GP46 family protein	NA	NA	NA	NA
WP_152472107.1\|1312507_1313551_+\|plate	baseplate J/gp47 family protein	A0A192Y6E4	Salmonella_phage	8.6e-21	28.1
WP_152472108.1\|1313532_1314063_+	hypothetical protein	NA	NA	NA	NA
WP_152472109.1\|1315151_1315712_+	hypothetical protein	NA	NA	NA	NA
WP_152472110.1\|1315862_1316105_+	hypothetical protein	NA	NA	NA	NA
WP_152472111.1\|1316101_1316647_+	glycoside hydrolase family protein	E5G6N1	Salmonella_phage	6.5e-28	42.5
WP_152472112.1\|1316649_1317156_+	hypothetical protein	NA	NA	NA	NA
WP_152472113.1\|1317251_1317797_+	hypothetical protein	NA	NA	NA	NA
WP_152472114.1\|1317906_1318875_-\|portal	phage portal protein	A0A0M3LS06	Mannheimia_phage	8.2e-58	40.4
WP_152472115.1\|1318896_1320657_-\|terminase	terminase	E5E3X0	Burkholderia_phage	1.5e-110	41.5
WP_021455676.1\|1320791_1321607_+\|capsid	GPO family capsid scaffolding protein	Q94MZ5	Haemophilus_virus	1.0e-21	42.2
WP_043010143.1\|1321639_1322677_+\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	6.3e-64	40.5
WP_152472116.1\|1322785_1323235_+\|head	head completion/stabilization protein	NA	NA	NA	NA
WP_152472117.1\|1323234_1323699_+\|tail	phage tail protein	NA	NA	NA	NA
WP_152472118.1\|1323695_1324205_+	phage virion morphogenesis protein	NA	NA	NA	NA
WP_152472119.1\|1324204_1324387_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_152472120.1\|1324383_1325517_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A0C4UQS0	Shigella_phage	5.6e-50	40.1
WP_019274354.1\|1325520_1325886_+\|tail	phage tail tube protein	NA	NA	NA	NA
WP_152472121.1\|1325896_1326577_+	hypothetical protein	NA	NA	NA	NA
WP_152472122.1\|1326560_1326848_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_100207327.1\|1326886_1326991_+\|tail	GpE family phage tail protein	NA	NA	NA	NA

DBSCAN-SWA_3

2769058 : 2775743

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006957919.1\|2769058_2769529_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	4.9e-32	48.0
WP_006957920.1\|2769706_2770816_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.1e-65	39.6
WP_006957921.1\|2770896_2771547_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	7.7e-36	37.7
WP_006957922.1\|2771549_2772656_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	7.2e-42	32.6
WP_006957923.1\|2772663_2773113_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_006957924.1\|2773344_2774595_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	5.6e-99	47.9
WP_006957925.1\|2774609_2775743_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	9.9e-63	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046165

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 4655

Escherichia_phage(100.0%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152473019.1\|379_832_-	hypothetical protein	NA	NA	NA	NA
WP_152473017.1\|1560_1749_+	hypothetical protein	NA	NA	NA	NA
WP_152473015.1\|1998_2877_+	hypothetical protein	NA	NA	NA	NA
WP_152473013.1\|3158_4655_-\|terminase	terminase	Q71T61	Escherichia_phage	3.4e-151	54.2

DBSCAN-SWA_2

7722 : 87968

Escherichia_phage(53.33%)

portal,tail,head,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152473006.1\|7722_8181_-	hypothetical protein	A0A1Q2U315	Vibrio_phage	1.0e-13	35.0
WP_152473004.1\|8361_8583_-	hypothetical protein	NA	NA	NA	NA
WP_152473002.1\|8593_8914_-	hypothetical protein	NA	NA	NA	NA
WP_152473000.1\|9110_9455_-	hypothetical protein	A0A2I7R675	Vibrio_phage	9.5e-17	56.8
WP_152472998.1\|9454_9901_-	hypothetical protein	NA	NA	NA	NA
WP_152472996.1\|9911_10541_-	hypothetical protein	NA	NA	NA	NA
WP_172974105.1\|10824_11466_-	hypothetical protein	A0A2I7RNS2	Vibrio_phage	2.7e-49	48.5
WP_152472992.1\|11443_11701_-	hypothetical protein	NA	NA	NA	NA
WP_172974104.1\|11690_11984_-	HU family DNA-binding protein	NA	NA	NA	NA
WP_152472988.1\|11973_12321_-	HU family DNA-binding protein	NA	NA	NA	NA
WP_152472986.1\|12287_12569_-	hypothetical protein	NA	NA	NA	NA
WP_152472984.1\|12670_13357_-	hypothetical protein	NA	NA	NA	NA
WP_172974103.1\|13401_14088_-	VRR-NUC domain-containing protein	Q71T85	Escherichia_phage	1.8e-19	42.9
WP_152472980.1\|14125_14710_-	hypothetical protein	NA	NA	NA	NA
WP_152472978.1\|14721_16092_-	hypothetical protein	NA	NA	NA	NA
WP_152472976.1\|16131_16437_-	hypothetical protein	NA	NA	NA	NA
WP_152472974.1\|16440_16962_-	single-stranded DNA-binding protein	R9TR60	Vibrio_phage	1.7e-57	66.9
WP_152472973.1\|16961_17588_-	3'-5' exoribonuclease	R9TPV7	Vibrio_phage	1.1e-39	46.4
WP_152472971.1\|17577_17883_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152472969.1\|17848_18277_-	hypothetical protein	NA	NA	NA	NA
WP_152472967.1\|18420_18657_+	hypothetical protein	NA	NA	NA	NA
WP_152472966.1\|18777_19023_-	hypothetical protein	NA	NA	NA	NA
WP_154351845.1\|19019_19172_-	hypothetical protein	A0A2I7QU96	Vibrio_phage	5.1e-07	54.2
WP_152472964.1\|19239_19533_-	hypothetical protein	NA	NA	NA	NA
WP_152472962.1\|19532_20678_-	hypothetical protein	NA	NA	NA	NA
WP_152472960.1\|21219_21570_+	hypothetical protein	NA	NA	NA	NA
WP_152472957.1\|21644_22613_-\|head	head processing protein	A0A077SK31	Escherichia_phage	3.9e-52	39.3
WP_152472955.1\|22615_24295_-\|portal	phage portal protein	Q71TR7	Escherichia_phage	1.1e-105	38.9
WP_152472954.1\|24703_31438_+	Eco57I restriction-modification methylase domain-containing protein	A0A222YYH3	Escherichia_phage	1.3e-290	36.2
WP_152472952.1\|31498_31933_+	hypothetical protein	NA	NA	NA	NA
WP_152472950.1\|32048_32276_+	hypothetical protein	NA	NA	NA	NA
WP_152472948.1\|32443_33697_+	AAA family ATPase	NA	NA	NA	NA
WP_152472946.1\|33699_34710_+	hypothetical protein	NA	NA	NA	NA
WP_152472944.1\|35016_35349_-	hypothetical protein	NA	NA	NA	NA
WP_172974102.1\|35411_37292_-	hypothetical protein	A0A222YY44	Escherichia_phage	8.9e-133	55.9
WP_152472942.1\|37291_37522_-	hypothetical protein	NA	NA	NA	NA
WP_152473093.1\|37518_38661_-	hypothetical protein	NA	NA	NA	NA
WP_152473092.1\|38917_39787_-	hypothetical protein	NA	NA	NA	NA
WP_152473091.1\|39835_45253_-	hypothetical protein	Q1MVM7	Enterobacteria_phage	2.8e-22	35.8
WP_152473090.1\|45249_45873_-	hypothetical protein	NA	NA	NA	NA
WP_152473089.1\|45939_46353_-	hypothetical protein	A0A077SK09	Escherichia_phage	1.3e-07	32.8
WP_152473088.1\|46349_46673_-	hypothetical protein	Q37876	Escherichia_phage	4.1e-06	36.0
WP_173020394.1\|46828_47797_-	radical SAM protein	NA	NA	NA	NA
WP_152473086.1\|47866_48619_-	hypothetical protein	NA	NA	NA	NA
WP_152473085.1\|48590_49247_-	hypothetical protein	NA	NA	NA	NA
WP_152473084.1\|49218_50082_-	hypothetical protein	NA	NA	NA	NA
WP_152473083.1\|50084_50411_-	hypothetical protein	NA	NA	NA	NA
WP_154351844.1\|50496_50652_-	hypothetical protein	NA	NA	NA	NA
WP_152473082.1\|50669_51809_-	hypothetical protein	I6X2L6	Vibriophage	1.2e-15	60.6
WP_152473081.1\|51811_52381_-	hypothetical protein	NA	NA	NA	NA
WP_152473080.1\|52380_54159_-\|tail	tail fiber protein	R9TIZ5	Vibrio_phage	3.6e-19	47.7
WP_152473079.1\|54160_54652_-	hypothetical protein	NA	NA	NA	NA
WP_152473078.1\|54700_55996_-	hypothetical protein	A0A077SLH5	Escherichia_phage	2.5e-33	36.5
WP_172974109.1\|55992_56451_-\|tail	tail fiber domain-containing protein	M4QML2	Micromonas_pusilla_virus	3.2e-12	45.2
WP_152473076.1\|59475_60873_-	hypothetical protein	A0A1B0VAD6	Salmonella_phage	2.1e-70	34.7
WP_152473075.1\|60869_61217_-	hypothetical protein	NA	NA	NA	NA
WP_152473074.1\|61221_64083_-	hypothetical protein	A0A222YXR4	Escherichia_phage	2.2e-05	25.0
WP_152473073.1\|64211_65024_-	hypothetical protein	A0A222YZ63	Escherichia_phage	2.3e-45	34.8
WP_152473072.1\|65023_65539_-	hypothetical protein	A0A222YY05	Escherichia_phage	7.0e-32	42.4
WP_152473095.1\|65539_65782_-	hypothetical protein	A0A222YWE3	Escherichia_phage	2.3e-09	46.4
WP_152473071.1\|66294_66579_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A222YWE2	Escherichia_phage	6.0e-25	55.4
WP_152473070.1\|66651_66987_+	HigA family addiction module antidote protein	A0A222YWD7	Escherichia_phage	2.7e-16	44.0
WP_152473069.1\|67054_67555_-\|plate	baseplate protein	NA	NA	NA	NA
WP_152473068.1\|67571_68192_-	hypothetical protein	A0A222YY02	Escherichia_phage	5.9e-25	36.5
WP_152473067.1\|68201_68882_-	hypothetical protein	A0A222YXT7	Escherichia_phage	4.6e-07	30.3
WP_152473066.1\|68902_70483_-	hypothetical protein	Q71TB2	Escherichia_phage	8.9e-110	42.1
WP_152473065.1\|70469_70898_-	hypothetical protein	NA	NA	NA	NA
WP_152473064.1\|70948_72631_-	hypothetical protein	A0A222YWC7	Escherichia_phage	4.7e-61	29.0
WP_152473063.1\|72914_73238_-	hypothetical protein	NA	NA	NA	NA
WP_172974107.1\|73240_73780_-	N-acetylmuramoyl-L-alanine amidase	A0A2I7RXW8	Vibrio_phage	3.9e-25	38.2
WP_152473061.1\|73992_74346_-	hypothetical protein	NA	NA	NA	NA
WP_152473060.1\|74408_74606_-	hypothetical protein	A0A2I7RNJ8	Vibrio_phage	1.2e-11	62.5
WP_152473059.1\|74605_75418_-	hypothetical protein	R9TNN7	Vibrio_phage	2.3e-13	44.1
WP_152473058.1\|75384_76356_-	hypothetical protein	A0A222YXZ0	Escherichia_phage	8.6e-31	26.3
WP_152473057.1\|76348_77116_-	hypothetical protein	NA	NA	NA	NA
WP_152473056.1\|77118_77664_-	hypothetical protein	A0A1C9LW11	Vibrio_phage	4.0e-09	32.3
WP_152473055.1\|77712_78042_-	DUF4406 domain-containing protein	A0A222YYT7	Escherichia_phage	2.4e-25	62.9
WP_152473054.1\|78038_78656_-	hypothetical protein	A0A222YXU3	Escherichia_phage	5.3e-34	45.5
WP_152473053.1\|78652_79804_-\|tail	phage tail protein	A0A222YXT1	Escherichia_phage	2.8e-73	49.1
WP_152473052.1\|79806_80127_-\|plate	baseplate wedge protein 53	Q1MVH3	Enterobacteria_phage	6.1e-18	45.4
WP_152473051.1\|80123_80756_-	hypothetical protein	A0A222YZ79	Escherichia_phage	1.1e-15	28.1
WP_152473094.1\|80827_81316_-	hypothetical protein	A0A222YXV2	Escherichia_phage	8.7e-32	53.9
WP_152473050.1\|81635_81863_-	hypothetical protein	NA	NA	NA	NA
WP_152473049.1\|81850_82348_-	helix-turn-helix transcriptional regulator	A0A2I7RSZ7	Vibrio_phage	2.6e-07	39.1
WP_152473048.1\|82364_82826_-	hypothetical protein	M4M9K3	Vibrio_phage	9.9e-54	68.6
WP_152473047.1\|83279_83705_+	hypothetical protein	NA	NA	NA	NA
WP_152473046.1\|83708_83906_+	hypothetical protein	NA	NA	NA	NA
WP_152473045.1\|83918_84404_+	DUF4262 domain-containing protein	NA	NA	NA	NA
WP_152473044.1\|84419_84851_+	hypothetical protein	NA	NA	NA	NA
WP_152473043.1\|84847_85573_+	hypothetical protein	A0A076G7C3	Sinorhizobium_phage	7.3e-27	36.6
WP_152473042.1\|85575_86220_+	hypothetical protein	NA	NA	NA	NA
WP_152473041.1\|86220_86505_+	hypothetical protein	NA	NA	NA	NA
WP_152473040.1\|86712_87183_+	hypothetical protein	A0A088FAL7	Vibrio_phage	8.6e-29	45.1
WP_152473039.1\|87242_87968_+	hypothetical protein	A0A1B0V7N5	Roseobacter_phage	9.6e-11	44.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP046164

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046164_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046164_1

334564-334642

Orphan

Consensus_repeat	Method
TTTTTTAGTCCATTTGGTCTATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046164_1

>merge|NZ_CP046164|1|334564-334642|CRISPRCasFinder
TTTTTTAGTCCATTTGGTCTATATAAGGTTAACCGCTCAAATTTTGTCTTGTCAATTTTTTTAGTCCATGTGGTCTATA

>NZ_CP046164|1|1|334564-334642|CRISPRCasFinder
TTTTTTAGTCCATTTGGTCTATA	TAAGGTTAACCGCTCAAATTTTGTCTTGTCAAT
TTTTTTAGTCCATGTGGTCTATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046164.1\|WP_154741313.1\|340975_341290_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046164.1\|WP_152472780.1\|324516_325719_-\|3-oxoadipyl-CoA-thiolase	unknown	unknown	gnl\|CDD\|181624
NZ_CP046164.1\|WP_040122413.1\|334722_335271_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP046164.1\|WP_052126644.1\|326414_327278_-\|3-keto-5-aminohexanoate-cleavage-protein	unknown	unknown	gnl\|CDD\|377562
NZ_CP046164.1\|WP_080568975.1\|341427_341835_-\|GFA-family-protein	unknown	unknown	gnl\|CDD\|226314
NZ_CP046164.1\|WP_019274892.1\|338455_339208_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235816
NZ_CP046164.1\|WP_152472772.1\|340238_340961_+\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|379199
NZ_CP046164.1\|WP_152472933.1\|323415_324360_-\|porphobilinogen-synthase	unknown	unknown	gnl\|CDD\|172020
NZ_CP046164.1\|WP_152472779.1\|329583_330558_-\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|223677
NZ_CP046164.1\|WP_043011670.1\|325711_326389_-\|dienelactone-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223477
NZ_CP046164.1\|WP_040122414.1\|335527_335842_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP046164.1\|WP_052126668.1\|327665_328154_-\|MepB-family-protein	unknown	unknown	gnl\|CDD\|378077
NZ_CP046164.1\|WP_040122415.1\|335843_336182_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|227028
NZ_CP046164.1\|WP_039951375.1\|336919_337153_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|226863
NZ_CP046164.1\|WP_152472773.1\|339244_340144_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP046164.1\|WP_152472775.1\|333900_334518_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046164.1\|WP_040122417.1\|337436_338348_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP046164.1\|WP_152472931.1\|333001_333874_-\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187554
NZ_CP046164.1\|WP_006958523.1\|328392_329328_-\|bile-acid:sodium-symporter-family-protein	unknown	unknown	gnl\|CDD\|223462
NZ_CP046164.1\|WP_152472777.1\|331022_332369_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|367293

Protein	Function_ID	Function_description	E-value
NZ_CP046164.1\|WP_152472780.1\|324516_325719_-\|3-oxoadipyl-CoA-thiolase	gnl\|CDD\|181624	PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; Validated.	0
NZ_CP046164.1\|WP_040122413.1\|334722_335271_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.38666e-15
NZ_CP046164.1\|WP_052126644.1\|326414_327278_-\|3-keto-5-aminohexanoate-cleavage-protein	gnl\|CDD\|377562	pfam05853, BKACE, beta-keto acid cleavage enzyme. BKACE, beta-keto acid cleavage enzyme plays, a role in lysine degradation. In certain instances it catalyzes the conversion of 3-keto-5-aminohexanoate and acetyl-CoA into acetoacetate and 3-aminobutyryl-CoA. The family is found to have at least 14 slightly different potential new enzymatic activities, all of which can therefore be designated as beta-keto acid cleavage enzymes.	1.47357e-118
NZ_CP046164.1\|WP_080568975.1\|341427_341835_-\|GFA-family-protein	gnl\|CDD\|226314	COG3791, COG3791, Uncharacterized conserved protein [Function unknown].	4.58294e-27
NZ_CP046164.1\|WP_019274892.1\|338455_339208_+\|SDR-family-oxidoreductase	gnl\|CDD\|235816	PRK06500, PRK06500, SDR family oxidoreductase.	5.08754e-60
NZ_CP046164.1\|WP_152472772.1\|340238_340961_+\|NAD(P)H-binding-protein	gnl\|CDD\|379199	pfam13460, NAD_binding_10, NAD(P)H-binding.	2.63106e-21
NZ_CP046164.1\|WP_152472933.1\|323415_324360_-\|porphobilinogen-synthase	gnl\|CDD\|172020	PRK13384, PRK13384, porphobilinogen synthase.	0
NZ_CP046164.1\|WP_152472779.1\|329583_330558_-\|zinc-binding-dehydrogenase	gnl\|CDD\|223677	COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only].	4.27395e-75
NZ_CP046164.1\|WP_043011670.1\|325711_326389_-\|dienelactone-hydrolase-family-protein	gnl\|CDD\|223477	COG0400, COG0400, Predicted esterase [General function prediction only].	1.39909e-15
NZ_CP046164.1\|WP_040122414.1\|335527_335842_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	3.56514e-10
NZ_CP046164.1\|WP_052126668.1\|327665_328154_-\|MepB-family-protein	gnl\|CDD\|378077	pfam08877, MepB, MepB protein. MepB is a functionally uncharacterized protein in the mepRAB gene cluster of Staphylococcus aureus.	8.84089e-38
NZ_CP046164.1\|WP_040122415.1\|335843_336182_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|227028	COG4683, COG4683, Uncharacterized protein conserved in bacteria [Function unknown].	2.18624e-39
NZ_CP046164.1\|WP_039951375.1\|336919_337153_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|226863	COG4456, VagC, Virulence-associated protein and related proteins [Function unknown].	5.86062e-13
NZ_CP046164.1\|WP_152472773.1\|339244_340144_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	2.18613e-40
NZ_CP046164.1\|WP_040122417.1\|337436_338348_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.48204e-59
NZ_CP046164.1\|WP_152472931.1\|333001_333874_-\|NAD(P)H-binding-protein	gnl\|CDD\|187554	cd05243, SDR_a5, atypical (a) SDRs, subgroup 5. This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.94364e-49
NZ_CP046164.1\|WP_006958523.1\|328392_329328_-\|bile-acid:sodium-symporter-family-protein	gnl\|CDD\|223462	COG0385, COG0385, Predicted Na+-dependent transporter [General function prediction only].	5.34342e-78
NZ_CP046164.1\|WP_152472777.1\|331022_332369_-\|AAA-family-ATPase	gnl\|CDD\|367293	pfam03008, DUF234, Archaea bacterial proteins of unknown function.	5.93382e-15

>NZ_CP046164.1|WP_152472775.1|333900_334518_-|hypothetical-protein
MTNDQITLKEAPINWQCKGKFRFSTGYGATKAESAIANYAAFIAPVLLYVLVWKELDWSGSQIVVAAILTLDMIGGVLTNSLGSMKRYLHANQNLDVNWLGRLVGSKFLFPAIHFQLFLVPLCFDIVWSYAFFWYGMMMVSIVIVHFTPLYLQRPVALLIVMLSIIVAQIIPSPVGLEWLAPIFMIKLVLSHGVREEPYRPTLTE
>NZ_CP046164.1|WP_152472931.1|333001_333874_-|NAD(P)H-binding-protein
MTTSNKVLVVGATGYLGLYIVKQLQERGQDFVALARNKQKLLANGVHDSQIFEAQVTDPQQLEGICDGVDVVISCLGITRQQDGLKYMDIDYQANLNILLEAEKSGVEKFIYISAFNAPTYSNVRLLRAKERFASRLLDSEQLQPCVIRPNGFFSDLEAIYHMATKGRVYQFGASAMKLNPIHGEDLATFCLEAIPSNQKELDVGGPEILTTTEIAQLAFEAQCKNVRIVRLPDCLRRAILRLMNHLPEKWGGPAEFFLTVMGKDSIAPVYGEHKIRDHYVALFTAVNKP
>NZ_CP046164.1|WP_152472777.1|331022_332369_-|AAA-family-ATPase
MKKLYNRQRELNALQTVSEQIVDTKGQLSVMVGRRRVGKTRLLNEAFHQDNTPFLYLFISRKSESALVAEFAEIIHSELGVKFFQPQTLRDIIEFLLDYTKQKPMTIILDEFQDIDIVNPALFSDIQNLWDANKRDSMMHLVCCGSLYSMMTKIFKGKDEPLFNRDDRFFNIQPLQPSYLAEVMKDHDQFDAENMLRWWCLSGGIPKYLEWLTRFSAESDDRFEAVISEFSPLIKEGTHRLVEDFGSEHRIYFDILGAISKGNTSRARIENFLDMSVGVHLEKLDEVFDVITKLRPISSKENSRDIRYAISDPFLNFWFRFIHANKSAVEMENYEYIRRYIERDFTVYSGLELASLFKAILVESKQFGKIGGYWDAKGHNEIDIVAINDLDKTILIAEVKRQQKRYSEAKLIEKSHHLLKKLNLKGYDIEYRGFSLDNLVETMNEYQA
>NZ_CP046164.1|WP_152472779.1|329583_330558_-|zinc-binding-dehydrogenase
MKTLQVTKFGNPDVLAVNHIEKPRISNNQLLIKVIYSGVNLADTYIRKGAFPALPTPPFTLGMEGSGIIEEIGSNVSGYEQGQLVAFSASQSYAEYVVVDTTSSLEWEIAVPVALPPLTASSIGMSARTAMLLTQRLSNTSCRVLVHAAAGSVGSVLVQLLSAQNHDVIALVGSARKEEYVRSLGAAQVINYKQDDVQEVIKNAYPDGLDAIFNATGGHSIARDINLLAKNGHLIWYGFAESDHAPDIETALQNAFMKSIKLELFNGGIHSQAENISAIKSVERLIIDGKVDIPIHKVYSLEEGIKAHQDLESGDTIGKLILKL
>NZ_CP046164.1|WP_006958523.1|328392_329328_-|bile-acid:sodium-symporter-family-protein
MLRVIINAFPLWVVLGSVVAYLQPAIFTPLKPQIVPLLMLIMLSMGLTLTLDDFKRVTSSVKAVTAGLILQFSVMPLSALFVAHVFDMDMALTIGMVLVGSVAGGTASNVICYLAKGNVALSITMTAFSTLIGVVMTPFLVDALLGVNVDVPVGPMVLNLVKIVIIPITIGIALNHFFRRPVTAIAPVLPLVSMLSIVMAIAIIVALNHDKIAIVGLGVALAVILHNAMGLVLGYWVCRALKFDYVTCKTIAIEVGLQNSGLATALALKFFSPISALPAALFSIWHNLSGSILAHYWSRDKRKRSRDLSVS
>NZ_CP046164.1|WP_052126668.1|327665_328154_-|MepB-family-protein
MALDPYPQNSQYEALAFSIDGQQILYRKGHVTPDRPGHFLTIWKRSAGEGPDSKKTRPFEKPDLDYLFVEVHDHQTSKQGMFIFPLTVLLKKGVVRSEKAKGKMALRVFPPWTSSRGEVKSQVFSESAKRTQRWQCEYFVWMENNVITDVEKFAHLFGAPLN
>NZ_CP046164.1|WP_052126644.1|326414_327278_-|3-keto-5-aminohexanoate-cleavage-protein
MDKLIITAAVNGGITPRSKQPAIPHTPKEIADAVIQCSQAGASVAHIHARDDAGRPSYDQAVWREIIERIRERSDILLNLSTSGLNLPKNSPEEEAWNHLEYRPEIASFNCGSVNHGDKPFINSPALAKKLAQALKANQVMPEIEIYHSGVIHEAVTLQQQGYLGERLVFAFAMGIHGGVRPTCKDLLHLVDSLPTNSLWSAIGIGQAQLPLNTYSILLGGHVRTGLEDNIYYRKGELATSNAQLVDRVVRLSHELGRDVATVNEARALLGLSRSQPQTNPIAAATI
>NZ_CP046164.1|WP_043011670.1|325711_326389_-|dienelactone-hydrolase-family-protein
MLPLQTDIHPYTMCIEGAPLSDDNPVVILLHGRRQTADDMASLIDKLAIPEATYCLPRAPEATWYPRGFTRELDDNQPQLDQGLKVIDQILQALLSQGVNRQRIWLMGFSQGGCMAAEFVRRALQPLGGVIVFTGGLFGPQCPVAPVQKPVFEGMPLWLSGSHTDTWVPAKRITQTAAYFDQLGAHVHLEIAAERAHHVSQSEIEQARALITACYAPTHEEAAHV
>NZ_CP046164.1|WP_152472780.1|324516_325719_-|3-oxoadipyl-CoA-thiolase
MSNAYLCDFVRTPIGRYAGALSSIRADDLAAIPLKALTERHTTVDWRRVDDVILGCANQAGEDNRNVARMSLLLAGLDTDVPGSTVNRLCASGMEAVSIAARTIKTGEANLIIAGGVESMSRAPYVMGKPDAPFARNTELYDTTMGWRFINASLESQYGACSMPETAENLAVKFGISRHDQDVFARWSQTKYVAAQERGFFRHEIVPVEVARRRQDPLVVDTDEHPRLSSLETLAKLKPVVQPQGTVTAGNASGINDGAAALLLASESALGDHQLVPKARIVATACAGVEPSLMGFGPTPAIKKVLELTRLSLDQMDVIELNEAFASQVLSVVNHLGIVPDDPRLNPNGGAIALGHPLGMSGARVIGTAMNQLTLQQGRYALCSLCVGVGQGMAMIIERV
>NZ_CP046164.1|WP_152472933.1|323415_324360_-|porphobilinogen-synthase
MRTMVREHDVQLHDLIYPLFVEEALASPVPIAGLPGLTRIPESQLTDEIRALDALGIRAVMPFGVSHHKDDIGSDTWHQDGLLSRMIRTIKSTCPHMLVIPDICFCEYTTHGHCGALSKHDVDNDQTVANLVKQCINAAEAGADMLAPSSMMDGQVGAIRRGLDAAGFTKVAILAHSAKFASAFYGPFRQAVECELEGDRRTYQLDYANGRQALSEALLDEQEGADILMVKPGTPYLDVLTQLRTQTRLPLAAYQVSGEYAAIKCSAEMGIVNEQEAVLETLTGFKRAGADLIVTYFAKQFAIWQQADTMPIVE
>NZ_CP046164.1|WP_040122413.1|334722_335271_+|TetR/AcrR-family-transcriptional-regulator
MPKIVDREAYRNELIAKAVDIFSEHGLNGLGMRGIAGALGVSKTALYHYFSSKEELFTACTEFVLEPHSLYGIDSTSPLPEDKEQAIVQLIKTLDSRFKGEMTVVLDYVKNRDSRDIANDELLKMADNQFLVELSKIVGREHANQAYALLLGGLMTRLLNGNQTKVEEIASWILQLSTRESS
>NZ_CP046164.1|WP_040122414.1|335527_335842_-|helix-turn-helix-transcriptional-regulator
MTSKTGTLAELDALMSPEALTKAKHRAKDILLGMQLAQLRESLGLTQSDVAKIMGVTQPTISSMESNGLNLKVETVERYIAACGGHHTTIQATLPGGERIEMVL
>NZ_CP046164.1|WP_040122415.1|335843_336182_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MYEIKPREIFKEWFSGLDETDQIEVRACIDVLREYGPTLRRPRVGKINGSAHPNMKELVVQSQGNPIRIFFVFDPNRTGILLCGGDKSNQKRFYKEQIKIADKEYSDHLKGE
>NZ_CP046164.1|WP_039951375.1|336919_337153_-|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MRTVSIFRNGKNQTIRLPKDFEFDGVNELEIHKEGDVITLRPVRPDWLSFGNQEEANDDFMANREDGITDEGRFNFD
>NZ_CP046164.1|WP_040122417.1|337436_338348_-|LysR-family-transcriptional-regulator
MAFHKQLENLYLFHLVALSGSFQGAADKVGLPRSSVSKRIAKLEQTLNLRLLERSTRKLSLTQSGHELLKSTEPLQQVLHHTETLSEQVHARPQGKVRIGCSTLMAHRLLIPHIHALSDTYPDICFDFNLTDEVVDLIDNHVDIAIRIGHLPDSSLLARQIGEKTFGWYASPAYLAQNGAPESPESLLHHRCLVFKNKAVTLDNWVFVHPSGGVNAINVTPAMISDDARGLVQLATLGQGIIMVDPAFIDQELRSNELVPVLTDYTHPDKQPIHLVCLGKKGRSRAVTCVWEALSEHLLIAPK
>NZ_CP046164.1|WP_019274892.1|338455_339208_+|SDR-family-oxidoreductase
MSFQTILITGATSGIGFEAAKQYVKQGWRVVFTGRDQERIASATARLRDDAHSPDQILGLLCDNANAQHYPALVSDIRHNVGTLDAVILNAGVFHPRHFSETTQSELMTTMSVNFTGPAMLLQALLPVLNDPCSVVYVSSIVVERAFPTASSYSASKAAFEAYANVLNLELAPQGVRINYLRPGVTATEIQSKAGMSEHQIDELNASLANLPLGRMLEPTEMLSSLEFLTSSSSLALRGAHITVDGGYCL
>NZ_CP046164.1|WP_152472773.1|339244_340144_-|LysR-family-transcriptional-regulator
MNWTAISFDWNRTRAFLATAELGSLSAAAHSLNVTQPTLSRQVSALEHELGVALFERSAQKLTLTRSGIELLHIAREMGDVAHKFSMVASGQSEDLNGVVVLSVCQLDAMYRLPSILAKLRRVEPKLSIDLVVTNQVSDLKRRDADIALRSAQPTQPSLIAKKLGDERVSLYGTRAYLTPFIEAQSIEDVPELQIIGFGNNGPIMTQFSHHGWSLNEDNFKLSTDFQPAQLALCKQHLGVMYLPEDIAAQEPQLMRAPDGLFPTMQLPLWLVCHEELKTNRRVRRVFDLLAAELTILDE
>NZ_CP046164.1|WP_152472772.1|340238_340961_+|NAD(P)H-binding-protein
MAVLVLGATGATGRLVVRELLSRGDRVKVVVRALERVDRDLIACESLDIVVSNVLDLSEAQLMGHLRECEAVICCLGHNLTLNGIYGQPRKLVSDTIKRICQAAAQLKPSQPIKLVLMSTTGFQNRRRGEVVSWRHRMVIQLIRQLLPPHVDNEEAARYLQDQVGDTSPYLEWVAVRPDSLVDHPFKTEFSVHASPTCDPLFAPRKSSRINVAHFMVELVGSPQTWSRWKQDMPVLYNNP
>NZ_CP046164.1|WP_154741313.1|340975_341290_-|hypothetical-protein
MHGVMNTTKWNELWTAMCTLHPRPRWRTREVDSGYVSDWDRDWFYHFRASSFRTIEWVEITTDTPSQHQSVKTVLRKIHVPADELDSGFKIYGYIPDAKYVDYL
>NZ_CP046164.1|WP_080568975.1|341427_341835_-|GFA-family-protein
MYKGSCLCGSIQFELHGGITDPIYCHCSRCRKASGSAFATNGYVNTSELQLTDEKGTLTYYESSVGKRKYFCSTCGAPIYSSNSATPDKVRIRLGAIDSDITERPISHNFITSKGNWEELDTTLPRYEGHEPSRK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046164_1	1.1\|334587\|33\|NZ_CP046164\|CRISPRCasFinder	334587-334619	33	NZ_CP046164	Vibrio sp. THAF191c plasmid pTHAF191c_c, complete sequence	334587-334619	0	1.0
NZ_CP046164_1	1.1\|334587\|33\|NZ_CP046164\|CRISPRCasFinder	334587-334619	33	NZ_CP046067	Vibrio sp. THAF191d plasmid pTHAF191d_c, complete sequence	83086-83118	0	1.0
NZ_CP046164_1	1.1\|334587\|33\|NZ_CP046164\|CRISPRCasFinder	334587-334619	33	NZ_CP009266	Vibrio coralliilyticus strain OCN014 plasmid pOCN014, complete sequence	8877-8909	0	1.0
NZ_CP046164_1	1.1\|334587\|33\|NZ_CP046164\|CRISPRCasFinder	334587-334619	33	NZ_CP009620	Vibrio coralliilyticus strain RE98 plasmid p319, complete sequence	73169-73201	0	1.0
NZ_CP046164_1	1.1\|334587\|33\|NZ_CP046164\|CRISPRCasFinder	334587-334619	33	NZ_CP045357	Vibrio sp. THAF64 plasmid pTHAF64_b, complete sequence	245568-245600	0	1.0
NZ_CP046164_1	1.1\|334587\|33\|NZ_CP046164\|CRISPRCasFinder	334587-334619	33	NZ_CP020455	Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence	139183-139215	1	0.97

1. spacer 1.1|334587|33|NZ_CP046164|CRISPRCasFinder matches to NZ_CP046164 (Vibrio sp. THAF191c plasmid pTHAF191c_c, complete sequence) position: , mismatch: 0, identity: 1.0

taaggttaaccgctcaaattttgtcttgtcaat	CRISPR spacer
taaggttaaccgctcaaattttgtcttgtcaat	Protospacer
*********************************

2. spacer 1.1|334587|33|NZ_CP046164|CRISPRCasFinder matches to NZ_CP046067 (Vibrio sp. THAF191d plasmid pTHAF191d_c, complete sequence) position: , mismatch: 0, identity: 1.0

taaggttaaccgctcaaattttgtcttgtcaat	CRISPR spacer
taaggttaaccgctcaaattttgtcttgtcaat	Protospacer
*********************************

3. spacer 1.1|334587|33|NZ_CP046164|CRISPRCasFinder matches to NZ_CP009266 (Vibrio coralliilyticus strain OCN014 plasmid pOCN014, complete sequence) position: , mismatch: 0, identity: 1.0

taaggttaaccgctcaaattttgtcttgtcaat	CRISPR spacer
taaggttaaccgctcaaattttgtcttgtcaat	Protospacer
*********************************

4. spacer 1.1|334587|33|NZ_CP046164|CRISPRCasFinder matches to NZ_CP009620 (Vibrio coralliilyticus strain RE98 plasmid p319, complete sequence) position: , mismatch: 0, identity: 1.0

taaggttaaccgctcaaattttgtcttgtcaat	CRISPR spacer
taaggttaaccgctcaaattttgtcttgtcaat	Protospacer
*********************************

5. spacer 1.1|334587|33|NZ_CP046164|CRISPRCasFinder matches to NZ_CP045357 (Vibrio sp. THAF64 plasmid pTHAF64_b, complete sequence) position: , mismatch: 0, identity: 1.0

taaggttaaccgctcaaattttgtcttgtcaat	CRISPR spacer
taaggttaaccgctcaaattttgtcttgtcaat	Protospacer
*********************************

6. spacer 1.1|334587|33|NZ_CP046164|CRISPRCasFinder matches to NZ_CP020455 (Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence) position: , mismatch: 1, identity: 0.97

taaggttaaccgctcaaattttgtcttgtcaat	CRISPR spacer
taagattaaccgctcaaattttgtcttgtcaat	Protospacer
****.****************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

133260 : 143482

Vibrio_phage(80.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052131813.1\|133260_134610_-	replicative DNA helicase	A0A1B0VG30	Salmonella_phage	1.0e-135	56.5
WP_052131814.1\|135099_136224_-	cyclopropane fatty acyl phospholipid synthase	A0A2I2L5L3	Orpheovirus	3.1e-64	38.4
WP_040122553.1\|136464_136824_+	hypothetical protein	NA	NA	NA	NA
WP_152472654.1\|136998_137367_-	hypothetical protein	Q858Q3	Vibrio_phage	1.8e-45	76.3
WP_152472653.1\|137494_137719_+	hypothetical protein	NA	NA	NA	NA
WP_152472652.1\|137780_138971_+	replication initiation factor domain-containing protein	G8IRU5	Vibrio_phage	4.0e-155	66.6
WP_152472651.1\|138961_139276_+	hypothetical protein	NA	NA	NA	NA
WP_095562278.1\|139279_139504_+	hypothetical protein	R9TMT7	Vibrio_phage	6.4e-14	53.4
WP_152472650.1\|139539_139752_+	hypothetical protein	G8IRU8	Vibrio_phage	1.3e-05	45.7
WP_152472649.1\|139891_141187_+	hypothetical protein	G8IRU9	Vibrio_phage	6.1e-16	31.0
WP_095562275.1\|141188_141533_+	DUF2523 domain-containing protein	R9TRT6	Vibrio_phage	2.6e-30	55.8
WP_152472648.1\|141537_142899_+	toxin	Q64EV0	Vibrio_phage	2.4e-148	57.1
WP_152472647.1\|142908_143091_+	hypothetical protein	NA	NA	NA	NA
WP_172974092.1\|143124_143289_+	hypothetical protein	NA	NA	NA	NA
WP_019277002.1\|143290_143482_+	hypothetical protein	A0A2I7RE17	Vibrio_phage	1.3e-07	42.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP046163

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

153005 : 161681

Pseudomonas_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961584.1\|153005_154136_+	GGDEF domain-containing protein	A0A2K8I9Y5	Pseudomonas_phage	1.6e-07	39.8
WP_006961585.1\|154237_154987_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.5e-14	29.4
WP_006961586.1\|155044_155908_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_006961587.1\|155929_156862_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_006961588.1\|156957_157779_-	phosphate ABC transporter substrate-binding protein	M1U9L0	Synechococcus_phage	2.1e-06	28.5
WP_039952180.1\|158153_159797_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.1e-13	31.9
WP_006961590.1\|159901_160621_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.7e-07	33.6
WP_152472563.1\|160775_161681_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.3e-08	33.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046162

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046165

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP046164

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP046163

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection