CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP046069	Pseudomonas aeruginosa strain KRP1 chromosome, complete genome	2 crisprs	csa3,RT,DEDDh,cas3,WYL,PD-DExK,DinG	0	0	6	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046069_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046069_1

341871-341984

Orphan

Consensus_repeat	Method
GGCCAAAGAACTGGAGGGCAAGGTATGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046069_1

>merge|NZ_CP046069|1|341871-341984|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGAGCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGTGGCCAAAGAACTGGAGGGCAAGGTATGA

>NZ_CP046069|1|1|341871-341984|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGA	GCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGT
GGCCAAAGAACTGGAGGGCAAGGTATGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046069.1\|WP_003084339.1\|351655_352348_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP046069.1\|WP_003084301.1\|338683_339781_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_CP046069.1\|WP_003112945.1\|351156_351651_+\|DUF523-domain-containing-protein	unknown	unknown	gnl\|CDD\|224597
NZ_CP046069.1\|WP_003118764.1\|349616_350315_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226274
NZ_CP046069.1\|WP_003118762.1\|347166_347778_-\|thiol-disulfide-isomerase	unknown	unknown	gnl\|CDD\|239267
NZ_CP046069.1\|WP_003112937.1\|331803_333180_-\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
NZ_CP046069.1\|WP_003112938.1\|333458_334211_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|336781
NZ_CP046069.1\|WP_023114765.1\|329760_330426_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP046069.1\|WP_003084290.1\|334251_335610_+\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
NZ_CP046069.1\|WP_003084320.1\|348815_349568_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046069.1\|WP_003112941.1\|345527_346580_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890
NZ_CP046069.1\|WP_003084297.1\|335675_337046_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|180994
NZ_CP046069.1\|WP_003084303.1\|339835_340990_+\|polyamine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|183226
NZ_CP046069.1\|WP_003111119.1\|328719_329598_-\|N-carbamoylputrescine-amidase	unknown	unknown	gnl\|CDD\|274553
NZ_CP046069.1\|WP_003118763.1\|347776_348796_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
NZ_CP046069.1\|WP_003112946.1\|352419_353190_-\|cystine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270430
NZ_CP046069.1\|WP_003112942.1\|346558_347062_-\|transcriptional-regulator	unknown	unknown	unknown
NZ_CP046069.1\|WP_003084327.1\|350336_350891_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046069.1\|WP_023114764.1\|330486_331548_-\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_CP046069.1\|WP_003084299.1\|337161_338265_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377

Protein	Function_ID	Function_description	E-value
NZ_CP046069.1\|WP_003084301.1\|338683_339781_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
NZ_CP046069.1\|WP_003112945.1\|351156_351651_+\|DUF523-domain-containing-protein	gnl\|CDD\|224597	COG1683, COG1683, Uncharacterized conserved protein [Function unknown].	2.14015e-67
NZ_CP046069.1\|WP_003118762.1\|347166_347778_-\|thiol-disulfide-isomerase	gnl\|CDD\|239267	cd02969, PRX_like1, Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a conserved cysteine that aligns to the first cysteine in the CXXC motif of TRX. This does not correspond to the peroxidatic cysteine found in PRXs, which aligns to the second cysteine in the CXXC motif of TRX. In addition, these proteins do not contain the other two conserved residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF.	0.00342131
NZ_CP046069.1\|WP_003112937.1\|331803_333180_-\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	1.09186e-161
NZ_CP046069.1\|WP_003112938.1\|333458_334211_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|336781	pfam07722, Peptidase_C26, Peptidase C26. These peptidases have gamma-glutamyl hydrolase activity; that is they catalyze the cleavage of the gamma-glutamyl bond in poly-gamma-glutamyl substrates. They are structurally related to pfam00117, but contain extensions in four loops and at the C-terminus.	1.81471e-108
NZ_CP046069.1\|WP_023114765.1\|329760_330426_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.47331e-08
NZ_CP046069.1\|WP_003084290.1\|334251_335610_+\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	5.71424e-158
NZ_CP046069.1\|WP_003118764.1\|349616_350315_+\|hypothetical-protein	gnl\|CDD\|226274	COG3751, EGL-9, Predicted proline hydroxylase [Posttranslational modification, protein turnover, chaperones].	2.81845e-78
NZ_CP046069.1\|WP_003112941.1\|345527_346580_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	2.54039e-32
NZ_CP046069.1\|WP_003084297.1\|335675_337046_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|180994	PRK07480, PRK07480, putative aminotransferase; Validated.	0
NZ_CP046069.1\|WP_003084303.1\|339835_340990_+\|polyamine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|183226	PRK11607, potG, putrescine ABC transporter ATP-binding subunit PotG.	0
NZ_CP046069.1\|WP_003111119.1\|328719_329598_-\|N-carbamoylputrescine-amidase	gnl\|CDD\|274553	TIGR03381, putative_carbon-nitrogen_hydrolase, N-carbamoylputrescine amidase. Members of this family are N-carbamoylputrescine amidase (3.5.1.53). Bacterial genes are designated AguB. The AguAB pathway replaces SpeB for conversion of agmatine to putrescine in two steps rather than one. [Central intermediary metabolism, Polyamine biosynthesis].	0
NZ_CP046069.1\|WP_003118763.1\|347776_348796_+\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	3.48481e-56
NZ_CP046069.1\|WP_003112946.1\|352419_353190_-\|cystine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270430	cd13712, PBP2_FliY, Substrate binding domain of an Escherichia coli ABC transporter; the type 2 periplasmic binding protein fold. This group contains cystine binding domain FliY and its related proteins. Cystine is an oxidized dimeric form of cysteine that is required for optimal bacterial growth. In Bacillus subtilis, three ABC transporters, TcyJKLMN (YtmJKLMN), TcyABC (YckKJI), and YxeMNO are involved in uptake of cystine. Likewise, three uptake systems were identified in Salmonella enterica serovar Typhimurium, while in Escherichia coli, two transport systems seem to be involved in cystine uptake. Moreover, L-cystine limitation was shown to prevent virulence of Neisseria gonorrhoeae; thus, its L-cystine solute receptor (Ngo0372) may be suited as target for an antimicrobial vaccine. The cystine receptor belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.13159e-122
NZ_CP046069.1\|WP_003084339.1\|351655_352348_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	3.29364e-79
NZ_CP046069.1\|WP_023114764.1\|330486_331548_-\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.45331e-164
NZ_CP046069.1\|WP_003084299.1\|337161_338265_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0

>NZ_CP046069.1|WP_003084303.1|339835_340990_+|polyamine-ABC-transporter-ATP-binding-protein
MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLTINKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYALFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQRIAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENPIYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYLGGHSVYYIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS
>NZ_CP046069.1|WP_003084301.1|338683_339781_+|polyamine-ABC-transporter-substrate-binding-protein
MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIKTGK
>NZ_CP046069.1|WP_003084299.1|337161_338265_+|polyamine-ABC-transporter-substrate-binding-protein
MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSGK
>NZ_CP046069.1|WP_003084297.1|335675_337046_+|aspartate-aminotransferase-family-protein
MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRERFTDKGVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQTAAAVLA
>NZ_CP046069.1|WP_003084290.1|334251_335610_+|glutamine-synthetase
MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAEKGMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVIHDTFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPVGRSGRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHGDALDLADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGKNIFSNADGTMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPDSSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERRNLRLPLTIEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLLSV
>NZ_CP046069.1|WP_003112938.1|333458_334211_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIPALGESIDQAALLDSVDGLLFTGSPSNVEPRHYSGPASEPGTLHDSDRDATTLPLVRAAIDAGIPVLGICRGFQEMNVAFGGSLHQKVHEVGTFMDHREPADQPLEVQYAPRHAMHVQPGGVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGVQWHPEWQVLTNPNYLAIFQAFGKACSKRAGQR
>NZ_CP046069.1|WP_003112937.1|331803_333180_-|glutamine-synthetase
MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIERNSLNKVFEKGINLPASLFALDITGSTVESTGLGLDIGDADRICYPIPGTLSMEPWQKRPTAQLLMTMHELEGEPFFADPREVLRQVVARFTEMELTIVAAFELEFYLIDQENVNGRPQPPRSPISGKRPQSVQVYSIDDLDEYVECLQDIIDGARAQGIPADAIVAESAPAQFEVNLNHVNDALKACDHAVLLKRLVKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDKHGNNIFTSEDPEQNAALRHAIGGVLETLPASMAFLCPNVNSYRRFGSQFYVPNAPSWGLDNRTVALRVPTGSPDAVRLEHRVAGADANPYLLLAAVLAGVHHGLTNKVEPGAPIEGNSYEQMEPSLPNNLRDALRELDESEIMAKYIDPKYIDIFVACKESELEEFEHSISDLEYNWYLHTV
>NZ_CP046069.1|WP_023114764.1|330486_331548_-|polyamine-ABC-transporter-substrate-binding-protein
MPRLSALLFLALAPWLAQAEETLRVYNWNDYIDPQVLESFQKDTGIRVEYHTFATAEELDKALRSGEAIDVAVPSHDTLPALLKDNLLRPLDFTQLPNRSHLDRQLLSKLAAVDPDNRHAIPYLWGAVGLAINTPQAEAAYGGPLPNSWSLLFDASQSQRLKSCGISLLDAPDETLAILLNYQGRNLARTAPSQVRRAAEALHGLRPNLRYVDSERYIADLEGGRLCLAMAWVGDALRAAKAGQPVSFEVPQEGSVLFIDNLVIPAGAQHPREAHRFIDYLMQPKIAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPPEKLRPVVDEIWKAFRGASH
>NZ_CP046069.1|WP_023114765.1|329760_330426_-|TetR/AcrR-family-transcriptional-regulator
MQPTSSTRKPRASSQARIAAILDAARGLLADEGIGGLTIYSVAERAEMPPSSVYHFFPSVPALLQGLTGEVHAAFRACLEQPVEHAGLRCWRDLSRIVEERMLAVYARDAAARQLILASHGLAEVTQADRQHDVQLGQAMRALFERHFLLPPLPTDIEIFSLAMELGDRVYALSVQRHGIIDARLAEEGMRVFDAYLGLYLPPILEKRSEPLTGFISDLNR
>NZ_CP046069.1|WP_003111119.1|328719_329598_-|N-carbamoylputrescine-amidase
MTRNVTVAATQMACSWDRPANIARAEKLVRQAAARGAQIILIQELFETPYFCQKPNPDYLQLATTVEENAAIAHFQALARELQVVLPISFFERAGRARFNSIAVIDADGGNLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYARIGVGICWDQWFPESARSMALLGAELLFYPTAIGSEPHDASISSRDHWQRVQQGHAGANLMPLVASNRIGREEQDGYDITFYGSSFIADPFGEKVEELNRTEEGILVHTFDLDALERTRSAWGVFRDRRPNLYGPLKTLDGSLES
>NZ_CP046069.1|WP_003112941.1|345527_346580_+|AraC-family-transcriptional-regulator
MQDDPSTSPLTHSATLRRLLYEALDALGLDPTRVYRSVYRRIPLPPPTLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEEALRSFVRFQHILSGGFAARLEVEGETARLILDINYLGYASLRQQIECLMLLFLKLLALISDDEFVAERIEFRHRAPPRLGEHRRLFGRLPLFSRPHDALVFSAALLRRPSRNANPDMHDVLTRHAEEQSRELSENRLLNRVRYLIELRLGEGYGLRQCAAELGLGSGALQRALAAGGASFRQVRDEVRRQRASEMLLAGRAIREVAKACGFAELSPFYRAFRRWHAAPPEQYRARLAKREEGYSTSGT
>NZ_CP046069.1|WP_003112942.1|346558_347062_-|transcriptional-regulator
MSLRPTLALLALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLADVDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLKLLLDYAQAYNSGNVSDDQASKLIERVDDLQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIGRQVPLVE
>NZ_CP046069.1|WP_003118762.1|347166_347778_-|thiol-disulfide-isomerase
MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLAAYWWFEIRYIRPFSEQTTLFSGDSLRLPAELAGPGAIRLVHFWDPACPCNVGNQQHLGELIERFAGKGVEFHVLQKPGSQGRLPDNLAALRPLAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSEGAVCTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWTPEKG
>NZ_CP046069.1|WP_003118763.1|347776_348796_+|alpha/beta-hydrolase
MCSRAAEYPWVSPVARPRIDCSPEPPMSEAFNPDYLRQHLRPLAAAEADAAVLAYQAYYGLDLRSRHPRLQARLGSMAVDGRRLAVQAWLLPEARGSLLLMHGYYDHMGLYRHVVDWALGMGFSVLACDLPGHGLSEGERASIRDFAEYQAVFKGLLGQAAELDLAAPWHLCGQSTGGAILLDYLLHGGERPELGETILLAPLVRPRAWGWSKLSYRLLSPFVDSIPRRFSENSSDPQFLDFLREHDPLQPRTLPTAWVGALTRWVPRIERAPRRALSPLVVQGESDETVDWRHGLKVLREKFDEPRILLLEEARHHLANESEGLRRRYFDFLSDALGA
>NZ_CP046069.1|WP_003084320.1|348815_349568_-|hypothetical-protein
MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAAQKRYQDKLPPALYQTLVDNSNRRFAPAEVDQRALNGLRENLPDSASPLNFFESPLGRKVVAAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVAADSLSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRDLSDAELTQYVNFAESPAGRSYYQAALAALKAGLAVDQAVAP
>NZ_CP046069.1|WP_003118764.1|349616_350315_+|hypothetical-protein
MGRYCRHAADRLSRHRGGTLQWTMHINVNHPLLHRIVDELVDQGWSHQSIFMPERLTTRLAEECRTRAVAGDLTPAAIGRGDGQVIREGIRGDLTQWLEPGESEACDEYLGVMDSLRQALNASLFLGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVLYLNDAWLPEHGGALRLHLPQRQVDIQPTGGSLVVFMSAGTEHEVLPASRDRLSLTGWFRRRNESLLQLS
>NZ_CP046069.1|WP_003084327.1|350336_350891_-|hypothetical-protein
MLPTRSLLPFFLAPALLASAASQAAMEALDNDSLSQVTGQAGISLRLDLRAGAARVAWVDDGGSLSLRNLVIDNGCVKAGDCPDGRGGNIPLGAAQLGLSLPIFGVEQPTLALDVTTGSGGGQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLYIGDNSIGRIELRDITDLRGTIKVWGH
>NZ_CP046069.1|WP_003112945.1|351156_351651_+|DUF523-domain-containing-protein
MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWHAQGRIVALCPEVAGGLPTPRPPAEIPGGQGGEVLDRLNRVFTVDGEDVSEAFLLGAEAAVELVRRHDIRMAVLKARSPSCGNLENYDGRFNGNRVAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGLDAGG
>NZ_CP046069.1|WP_003084339.1|351655_352348_-|amino-acid-ABC-transporter-permease
MNSLQKLLEWLANLVELLGMAWPFLLQGAMYTVLFAAVSMVLGLILGFSVAVVRVTKVPVVSQIAAVYVSAFRGTPLLVQIFVLYYGLPSVGIEFTPVTAGILALTLNVAAYLSESMRGAILGIDKGQWEAGLSVGLTWGQTLWNIITPQALRLAVPSLSNSLISLIKDTSLISVITVTELMLATKEVIAETFQPLPLYLAAAGIYWLLSALFERVQKALENRLTAPLRR
>NZ_CP046069.1|WP_003112946.1|352419_353190_-|cystine-ABC-transporter-substrate-binding-protein
MRFLPRLLMLVSLAAPLAHAELLDDVHQRGALRIALEGTYPPFNFKQGGKLTGFETELGELLAAELAVKPEFVTTEWSGILAGLQSGKYDIALNQVSVNEQRRKVFDFSEPYTISSAQLIVRADETRQFKSLEDLKGLKLGVGQGTNYADLAKSVAGVNVRTYPGAPEYLQDLASKRIDAALNDRLLIPFAIREAKLPVKPGAAVGPVANMAIPYRKNNPKFGEALNAALEKIKADGRFAKLSEKWFGLDVSQPPK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP046069_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046069_2

6660522-6660679

Orphan

Consensus_repeat	Method
CCCCGGCCCGGCCATCCTGGCCGGTCGTTCGCATTGAAAAACGCATGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046069_2

>merge|NZ_CP046069|2|6660522-6660679|CRISPRCasFinder
CCCCGGCCCGGCCATCCTGGCCGGTCGTTCGCATTGAAAAACGCATGCGGTTTGGCGTCTTGGGTGAGGCCGAGCCGACATCCTGTCAGGGCCTCGTCGTTCAGCCCATCCCCGGCCCGGCCATCCTGGCCGGTCGTTCGCATTGAAAAACGCATGCG

>NZ_CP046069|2|2|6660522-6660679|CRISPRCasFinder
CCCCGGCCCGGCCATCCTGGCCGGTCGTTCGCATTGAAAAACGCATGCG	GTTTGGCGTCTTGGGTGAGGCCGAGCCGACATCCTGTCAGGGCCTCGTCGTTCAGCCCAT
CCCCGGCCCGGCCATCCTGGCCGGTCGTTCGCATTGAAAAACGCATGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046069.1\|WP_003096975.1\|6652573_6653452_-\|endonuclease/exonuclease/phosphatase-family-protein	unknown	unknown	gnl\|CDD\|226098
NZ_CP046069.1\|WP_003096992.1\|6664704_6665208_+\|transcriptional-repressor	unknown	unknown	gnl\|CDD\|223806
NZ_CP046069.1\|WP_003096987.1\|6660691_6661381_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223287
NZ_CP046069.1\|WP_003118455.1\|6656309_6659051_-\|DNA-polymerase-I	unknown	unknown	gnl\|CDD\|235591
NZ_CP046069.1\|WP_003096984.1\|6659128_6659419_+\|DUF2782-domain-containing-protein	unknown	unknown	gnl\|CDD\|378588
NZ_CP046069.1\|WP_003097007.1\|6669595_6670378_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270315
NZ_CP046069.1\|WP_003125958.1\|6650561_6652577_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP046069.1\|WP_003102827.1\|6659452_6660403_+\|homoserine-kinase	unknown	unknown	gnl\|CDD\|235369
NZ_CP046069.1\|WP_003102836.1\|6649850_6650444_-\|MarC-family-protein	unknown	unknown	gnl\|CDD\|170674
NZ_CP046069.1\|WP_003097004.1\|6668841_6669519_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922
NZ_CP046069.1\|WP_003122325.1\|6666839_6667628_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274513
NZ_CP046069.1\|WP_003146829.1\|6661397_6663602_-\|adenosylcobalamin-dependent-ribonucleoside-diphosphate-reductase	unknown	unknown	gnl\|CDD\|274168
NZ_CP046069.1\|WP_003096976.1\|6653467_6654103_-\|thiol:disulfide-interchange-protein-DsbA/DsbL	unknown	unknown	gnl\|CDD\|239317
NZ_CP046069.1\|WP_003096979.1\|6654921_6655215_-\|cytochrome-c5-family-protein	unknown	unknown	gnl\|CDD\|225784
NZ_CP046069.1\|WP_003096998.1\|6666009_6666798_+\|zinc-ABC-transporter-permease-subunit-ZnuB	unknown	unknown	gnl\|CDD\|181938
NZ_CP046069.1\|WP_003097002.1\|6667834_6668842_+\|methionine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|236863
NZ_CP046069.1\|WP_003161102.1\|6655398_6656046_+\|YihA-family-ribosome-biogenesis-GTP-binding-protein	unknown	unknown	gnl\|CDD\|234770
NZ_CP046069.1\|WP_003102831.1\|6654270_6654876_-\|cytochrome-c4	unknown	unknown	gnl\|CDD\|225418
NZ_CP046069.1\|WP_003099732.1\|6665207_6666017_+\|zinc-ABC-transporter-ATP-binding-protein-ZnuC	unknown	unknown	gnl\|CDD\|181939
NZ_CP046069.1\|WP_003099734.1\|6663711_6664635_-\|zinc-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226908

Protein	Function_ID	Function_description	E-value
NZ_CP046069.1\|WP_003096975.1\|6652573_6653452_-\|endonuclease/exonuclease/phosphatase-family-protein	gnl\|CDD\|226098	COG3568, ElsH, Metal-dependent hydrolase [General function prediction only].	1.23885e-61
NZ_CP046069.1\|WP_003096992.1\|6664704_6665208_+\|transcriptional-repressor	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	1.3923e-42
NZ_CP046069.1\|WP_003096987.1\|6660691_6661381_-\|hypothetical-protein	gnl\|CDD\|223287	COG0209, NrdA, Ribonucleotide reductase, alpha subunit [Nucleotide transport and metabolism].	5.19108e-14
NZ_CP046069.1\|WP_003118455.1\|6656309_6659051_-\|DNA-polymerase-I	gnl\|CDD\|235591	PRK05755, PRK05755, DNA polymerase I; Provisional.	0
NZ_CP046069.1\|WP_003096984.1\|6659128_6659419_+\|DUF2782-domain-containing-protein	gnl\|CDD\|378588	pfam11191, DUF2782, Protein of unknown function (DUF2782). This is a bacterial family of proteins whose function is unknown.	3.76643e-30
NZ_CP046069.1\|WP_003097007.1\|6669595_6670378_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270315	cd13597, PBP2_lipoprotein_Tp32, The substrate-binding domain of the 32-kilodalton lipoprotein (Tp32) from Treponema pallidum binds L-methionine; the type 2 periplasmic-binding protein fold. This group includes the lipoprotein Tp32, a periplasmic component of a methionine uptake transporter system, and its closely related homologs. The Tp32 has both structural and sequential homology to the MetQ family of substrate-binding protein, and thus it belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea.	6.38438e-133
NZ_CP046069.1\|WP_003125958.1\|6650561_6652577_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	2.41074e-62
NZ_CP046069.1\|WP_003102827.1\|6659452_6660403_+\|homoserine-kinase	gnl\|CDD\|235369	PRK05231, PRK05231, homoserine kinase; Provisional.	7.54032e-167
NZ_CP046069.1\|WP_003102836.1\|6649850_6650444_-\|MarC-family-protein	gnl\|CDD\|170674	PRK10739, PRK10739, YhgN family NAAT transporter.	4.81982e-48
NZ_CP046069.1\|WP_003097004.1\|6668841_6669519_+\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	1.33335e-106
NZ_CP046069.1\|WP_003122325.1\|6666839_6667628_+\|hypothetical-protein	gnl\|CDD\|274513	TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO. Members of this protein family include YfiO, a near-essential protein of the outer membrane, part of a complex involved in protein insertion into the bacterial outer membrane. Many proteins in this family are annotated as ComL, based on the involvement of this protein in natural transformation with exogenous DNA in Neisseria gonorrhoeae. This protein family shows sequence similarity to, but is distinct from, the tol-pal system protein YbgF (TIGR02795). [Protein fate, Protein and peptide secretion and trafficking].	0.000920553
NZ_CP046069.1\|WP_003146829.1\|6661397_6663602_-\|adenosylcobalamin-dependent-ribonucleoside-diphosphate-reductase	gnl\|CDD\|274168	TIGR02504, ribonucleotide_reductase, ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent. This model represents a group of adenosylcobalamin(B12)-dependent ribonucleotide reductases (Class II RNRs) related to the characterized species from Pyrococcus, Thermoplasma, Corynebacterium, and Deinococcus. RNR's are responsible for the conversion of the ribose sugar of RNA into the deoxyribose sugar of DNA. This is the rate-limiting step of DNA biosynthesis. This model identifies genes in a wide range of deeply branching bacteria. All are structurally related to the class I (non-heme iron dependent) RNRs. In most species this gene is known as NrdJ, while in mycobacteria it is called NrdZ. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP046069.1\|WP_003096976.1\|6653467_6654103_-\|thiol:disulfide-interchange-protein-DsbA/DsbL	gnl\|CDD\|239317	cd03019, DsbA_DsbA, DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold. It is involved in the oxidative protein folding pathway in prokaryotes, and is the strongest thiol oxidant known, due to the unusual stability of the thiolate anion form of the first cysteine in the CXXC motif. The highly unstable oxidized form of DsbA directly donates disulfide bonds to reduced proteins secreted into the bacterial periplasm. This rapid and unidirectional process helps to catalyze the folding of newly-synthesized polypeptides. To regain catalytic activity, reduced DsbA is then reoxidized by the membrane protein DsbB, which generates its disulfides from oxidized quinones, which in turn are reoxidized by the electron transport chain.	1.63388e-70
NZ_CP046069.1\|WP_003096979.1\|6654921_6655215_-\|cytochrome-c5-family-protein	gnl\|CDD\|225784	COG3245, CycB, Cytochrome c5 [Energy production and conversion].	1.51706e-36
NZ_CP046069.1\|WP_003096998.1\|6666009_6666798_+\|zinc-ABC-transporter-permease-subunit-ZnuB	gnl\|CDD\|181938	PRK09543, znuB, zinc ABC transporter permease subunit ZnuB.	7.07263e-93
NZ_CP046069.1\|WP_003097002.1\|6667834_6668842_+\|methionine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|236863	PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional.	0
NZ_CP046069.1\|WP_003161102.1\|6655398_6656046_+\|YihA-family-ribosome-biogenesis-GTP-binding-protein	gnl\|CDD\|234770	PRK00454, engB, GTP-binding protein YsxC; Reviewed.	4.02419e-107
NZ_CP046069.1\|WP_003102831.1\|6654270_6654876_-\|cytochrome-c4	gnl\|CDD\|225418	COG2863, COG2863, Cytochrome c553 [Energy production and conversion].	1.5355e-43
NZ_CP046069.1\|WP_003099732.1\|6665207_6666017_+\|zinc-ABC-transporter-ATP-binding-protein-ZnuC	gnl\|CDD\|181939	PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed.	8.54289e-114
NZ_CP046069.1\|WP_003099734.1\|6663711_6664635_-\|zinc-ABC-transporter-substrate-binding-protein	gnl\|CDD\|226908	COG4531, ZnuA, ABC-type Zn2+ transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism].	2.34354e-156

>NZ_CP046069.1|WP_003102827.1|6659452_6660403_+|homoserine-kinase
MSVFTPLERSTLEAFLAPYDLGRLRDFRGIAEGSENSNFFVSLEHGEFVLTLVERGPVQDLPFFIELLDVLHEDGLPVPYALRTRDGEALRRLEGKPALLQPRLAGRHERQPNAHHCQEVGDLLGHLHAATRGRILERPSDRGLPWMLEQGANLAPRLPEQARALLAPALAEIAALDAERPALPRANLHADLFRDNVLFDGPHLAGLIDFYNACSGWMLYDLAITLNDWCSNTDGSLDPARARALLAAYANRRPFTALEAEHWPSMLRVACVRFWLSRLIAAEAFAGQDVLIHDPAEFEMRLAQRQNVEIHLPFAL
>NZ_CP046069.1|WP_003096984.1|6659128_6659419_+|DUF2782-domain-containing-protein
MRTLNRLMLAGLLAFAPLVAMAADDDAPSGEPDVTIRQEGDKTIQEYRVNGFLYAIKVVPKHGKPYFLVRADGSDGNFIRSDQPDKLIPQWEIFSW
>NZ_CP046069.1|WP_003118455.1|6656309_6659051_-|DNA-polymerase-I
MSQAPLVLVDGSSYLYRAFHALPPLTTSTGKPTGAVKGVLNMLLSLRKQYPDSPFAVVFDAKGPTFRDELFAEYKANRPSMPDDLRVQVEPLHASVRALGLPLLCVEGVEADDVIGTLARSSAAADRPVVISTGDKDMAQLVDGHITLVNTMTGSRLDVDGVKEKFGVGPELIIDFLALMGDKVDNIPGVPGVGEKTALGLLTGVGGGLEVLYASLDKVPELPIRGAKGLPAKLEENREQAFLSYQLATIKTDVELDVEIDKLYPGEPQREALIALYRELEFKNWLDDLLREAKEAGENGEAETPIQAEVDYDVVLDQAGFDAWLKKLEEAELIAFDTETTSIDAQQAQVVGVSFAVKEGEAAYVPLAHSYMGVPEQLDRDAVLRALKPLLEDPKKLKVGQHAKYDINVLANASTPIALRGVAYDTMLESYVLDSTATRHDMDSLALKYLGHSTIRFEDIAGKGAKQLTFDQIAIEQAGPYAAEDADVTLRLHQALWQKLEAIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKMVALERQAYDLAGQEFNLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDFELPKVIMQYRSMSKLKSTYTDRLPEQINPRTGRIHTSYHQAVAATGRLSSSDPNLQNIPIRTAEGRRIRQAFVAPQGYKLLAADYSQIELRIMAHLAKDDGLLDAFRHDLDVHRATAAEVFGVPLEDVSGDQRRSAKAINFGLIYGMSAFGLAKQIGVERKEAQAYIDRYFARYPGVLAYMERTRAQAAEQGFVETLFGRRLYLPEIHSKNGAMRKAAERTAINAPMQGTAADIMKRAMVAVDNWLQESGLDARVILQVHDELVLEVREELVEQVCEGIRPLMSGAATLDVPLVVEAGVGSNWDEAH
>NZ_CP046069.1|WP_003161102.1|6655398_6656046_+|YihA-family-ribosome-biogenesis-GTP-binding-protein
MSEKNPIVGLCQKASFLISAAQVDQCPPDEGLEVAFAGRSNAGKSSALNTLTHANLARTSKTPGRTQLLNFFALDDSRRLVDLPGYGYAKVPIPLKQHWQRHLEAYLSSRASLAGVFLMMDIRHPLTDFDRLMLDWAQASQLPIHVLMTKADKLAFGAAKNALLKVRREVQQGWGDVATLQLFSAPKRQGIDEAQMVLAQWLGLLDEEQEAFEEA
>NZ_CP046069.1|WP_003096979.1|6654921_6655215_-|cytochrome-c5-family-protein
MKKLLLAATVVAVAVTAQAAQDPEAVFNRTCGACHDGQLPMAPKKGDHAAWEPRLAKGMPTLVQHVTNGFNAMPPRGLCTDCSAEDYQATIQWMVKK
>NZ_CP046069.1|WP_003102831.1|6654270_6654876_-|cytochrome-c4
MNKLLVSLLLTLGLTGLAHAAGDAAAGQAKAAVCGACHGADGNSPAPNFPKLAGQGERYLLKQMHDIKDGKRTVLEMTGLLTNLSDQDLADIAAYFASQKMSVGMADPNLVAQGEALFRGGKIAEGMPACTGCHSPSGVGIATAGFPHLGGQHATYVAKQLTDFREGTRTNDGDTKIMQSIAAKLSNKDIAAISSYIQGLH
>NZ_CP046069.1|WP_003096976.1|6653467_6654103_-|thiol:disulfide-interchange-protein-DsbA/DsbL
MRNLILTAMLAMASLFGMAAQADDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLESMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAKK
>NZ_CP046069.1|WP_003096975.1|6652573_6653452_-|endonuclease/exonuclease/phosphatase-family-protein
MLRRWQREPRVAGSCDPRVNPSCDDSRELPDDGRLRLLSFNIQVGISTERYRHYLTRGWQHLLPHAGRATNLKRIGELLADYDLVALQEADGGSLRSGYVNQVEHLAQLGAFPYWYQQLNRNLGRIAQHSNGLLSRWRPTLLEDHPLPGPPGRGAIFVRFGEGADALVVVMMHLALGARTRTRQLAYIRELIGDYRHQVLMGDMNTHAVDLLENSPLRDLGLMAPQVEATFPSWRPQRNLDHILLSSDLALERVDVLDQPISDHLPVSVEIRLPDNLRDKALVVRGDAGSPP
>NZ_CP046069.1|WP_003125958.1|6650561_6652577_-|diguanylate-cyclase
MSRDDVQRWKDKYLENIEQQERLQRRWDARIDLLRRGLVRSSLAAEGSDKAVDQCMKELREILRRDDMDAGLSGLIPRLEKAVLDSEQRRQQRTQQNIDALGELAQQLLALDLPRELRKPLKQFARDIEERARQSREIPILLSELSRLQRQALAERKGGDAEDGRPSLLQRLFGGKESETTAEPSASVPSVVAASNTPIQPAAAAPSLPVAEHDEAPGGPPQPLPACTVAAIESAPAGWVGVAERGEPNQILLDEPREIWLDSLPLPAGLSFSETLEEAGAEPSPAMPADVESAPEAPATPVDNLDGQAVDEAYELPPPIPEPGYSAVAPHIEASLLRLLDGLSLPSSHQPQAEALRERIDGSLNWYELVPVLDDLAVLVLSLADSGQRDFEEYLRQLNERLESFLGHLGDAHAGYTDVLDNARGFDQSLREQVSGLQASVQQATDLNSLKLAVDSRLNGLLASMDEHQREQAEHEQEVSGRLQALMERVNSMEQDAKAFHSHLEDQRQKALTDPLTGLPNRAALSERLEQEVARRHRDGGDLLLAVLDIDHFKRINDDFGHLAGDKVLKIIAGELRKRLRQADFIARFGGEEFVVLLPATSLEAGRQLLERLRAAIAACPFHFKGEPLSITCSAGITAFEGNEAGEAVFERADQALYRAKRAGRDRLEVA
>NZ_CP046069.1|WP_003102836.1|6649850_6650444_-|MarC-family-protein
MDMFGVAVLIFLVTDPFGNIAVFLAALKGVAPGRRLRVAFRELAFALGLLLLFLTLGEHILSGLGLSREATGIAGGIILFVIAMRLIFPSPQGLLGEVPDGEPLLVPLATPAVAGPSALAMLITLRTTFDGPLWELYLAVVLAWAATALILLQAAFLQRFLGPRGLTAIERLAGMLLIMLSVDMLLDNLRSVLHIAA
>NZ_CP046069.1|WP_003096987.1|6660691_6661381_-|hypothetical-protein
MSAVKITQKIKGFKVVNEAEEQALAAAAEAASVVQMDETLERPDTLIGATYKIKSPLFEHALYVTINDMVLNAGTAHEQRRPFEIFINSKNMDHFQWIVALTRIMSAVFRKGGDCTFLVEELKAVFDPRGGYLKKGGIYMPSIVAEIGGVLERHLTAIGLLRGPELDEEQRLFLAEKRAAYEAAQGTSKVEPGEGFPAGAQLCGKCNSMAVVQMDGCATCLNCGHSKCG
>NZ_CP046069.1|WP_003146829.1|6661397_6663602_-|adenosylcobalamin-dependent-ribonucleoside-diphosphate-reductase
MLRTVAGFGRPNNHREVNQRMAKTDARSPRTERGTIALQDASQDIWDKKYRLKSKDGTPVDASVDGTWQRVARALADVEEKASREHWYGRFLWALRNGAIPAGRIISNAGALGHKPATSTINCTVSGTIQDSMDNILEKVHEAGLTLKAGCGIGYEFSTLRPRGAYVSGAGAYTSGPLSFMDIYDKMCFTVSSAGGRRGAQMGTFDVSHPDVREFIRAKREDGRLRQFNLSLLITDQFMQAVEQDADWPLVFPVHVKERDEIDLDDPNAVVWREWPIQDDYVQRADGLVACKVYGQVRARHLWDMIMVSTYDYAEPGFILIDRVNELNNNWWCEAIRATNPCGEQPLPPYGSCLLGSVNLTCFVEQPFGDEARFDWDRFREVVRVFTRMLDNVVEINGLPLEQQRQEILGKRRHGMGFLGLGSTLTLLKLRYGSPEACVFTEEVAREMALVGWEVALELAREKGPAPILAQDYEVTAEMLRKRPEMAADGYKAGDRIRGSVLHAKYSRYMQRVAEHAPELIEALAETGARFTHHSSIAPTGTISLSLANNASNGIEPSFAHHYSRNLIREGRKTKEKVEVYSYELLAYRTLVNAQALPDSDDPARRLPDYFITADSVTPAQHVDIQAAAQKWVDSSISKTANVPTDYPFEDFKDIYRYAWHQGLKGCTTFRFNPEAFQGVLVKESDLEKTRYRFELEDGSVVEFKGNEQVEYDGEIHTAANLFDALKEGYYGKY
>NZ_CP046069.1|WP_003099734.1|6663711_6664635_-|zinc-ABC-transporter-substrate-binding-protein
MTLRPFALLSACFALFLLASPARAEVSVLTSIKPLQLVAAAIQDGVGQPDVLLPPGASPHQYALRPSDVRRLREVQLFYWIGPDLENFLPKVLAGRQGASVAVQDLPGMHLRKFVNFEEEEHAGHDEHDHDHRPGMLDAHLWLLPANARTIAARMAEDLAQVDPANAGRYRANLKAFEERLGGLDGKLRERLGKLAGKPFFVFHEAFDYFEEAYGLRHTGVFAVSAEVQPGARHVAAMRAQLKAAGPACIFSEPPLRPRLADTLSEGLPVRLAELDDLGVNVSVDANGYENLLNNLAGEFAGCLEKL
>NZ_CP046069.1|WP_003096992.1|6664704_6665208_+|transcriptional-repressor
MYKIAPKTPLACQPHDHSQCVSTALAEADALCARQGVRLTELRRRVLELVWQSHKPLGAYDILAVLSETDGRRAAPPTVYRALDFLQENGLVHRIASLNAFVGCNNPEHSHQGQFLICRTCHTAIELEQPDISRAIVAGANSVGFAVESQTVEVVGLCGTCRDQKDA
>NZ_CP046069.1|WP_003099732.1|6665207_6666017_+|zinc-ABC-transporter-ATP-binding-protein-ZnuC
MDNALVRLTQVGVSFNGQAVLSDVDLAIEPGQIVTLIGPNGAGKTTLVRSVLGLLKPHVGEVWRRPRLTIGYMPQKLHVDATLPLSVLRFLRLVPGVRREQALAALREVGAAHVLERPLQSISGGELQRVLLARALLRKPELLVLDEPVQGVDVAGQAELYRLIGKLRDRYGCGVLMVSHDLHLVMSATDQVVCLNRHVCCSGHPEQVSGDPAFVELFGQDARSLAIYHHHHDHAHDLHGEVVKAGPGALPPGTRFTPVHKHGPDCNHG
>NZ_CP046069.1|WP_003096998.1|6666009_6666798_+|zinc-ABC-transporter-permease-subunit-ZnuB
MADFLLNALLAGLALALVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFLLDVSPTLAVTVGCVLLAVLLVTLQQRQPLAADTLLGILAHSTLSLGLVTLSFMKEVRVDLMAYLFGDLLAVSASDLLWIIAGSALVLALICFLWRPLLAITVHEELAKVEGLPVGAIRLALMLLIAIVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMAVGASLLGLVAVCAGLALSWFKDTPAGPSIVVSAAGLFLLSFVLPRRTV
>NZ_CP046069.1|WP_003122325.1|6666839_6667628_+|hypothetical-protein
MSSFFRLLSVLAAALLVSACQGNASSQPTPVVAPQAQPADPYAELQQTLAAGKLEQAEQQWLALRSAAAGDERVEAFRRQLAEAYMQRGETALRQGDLNTATSALGHARGLMPKAPALTAGLDGAINRAKVDPARAEQARRMQQAAQQQMQQIIQTPPGGELKPLPGAPHLIDPQAASSAVPLPMLDGTGQGGLGAVLDAVAADVVAYRCRVHIEVRRDSDYPLVSDQLLARVKKLSPDFDLHLSHVVQADKPTRLILTPRN
>NZ_CP046069.1|WP_003097002.1|6667834_6668842_+|methionine-ABC-transporter-ATP-binding-protein
MIEFHDVHKTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEGEDVTALDAEGLRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELLARVGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRRFVFEAERVDEDERHDDFAHVPGLILRLTFRGEATYAPLLGTVARQTGVDYSILSGRIDRIKDTPYGQLTLALVGGDLEAAMSQLNAADVHVEVLR
>NZ_CP046069.1|WP_003097004.1|6668841_6669519_+|ABC-transporter-permease
MDFFETMSFANIDWYEIWLASVDTFWMLGGSLLFTVVLGLPLGVLLFLTGPRQMFEQKAVYTLLSLVVNILRSLPFIILLIVMIPLTVLITGTSLGVAGAIPPLVVGATPFFARLVETALREVDKGIIEATQAMGASTRQIIWNALLPEARPGIIAAITVTAITLVSYTAMAGVVGAGGLGDLAIRFGYQRFQTDVMVVTVVMLLILVQILQTVGDKLVVHFSRK
>NZ_CP046069.1|WP_003097007.1|6669595_6670378_+|ABC-transporter-substrate-binding-protein
MKKLLAAFSAVAALGLTAAQAAESLTVAATPVPHAEILNVVKPLLAKEGVDLKIKEFTDYVQPNVQVSEKRLDANFFQHQPYLDEFNKAKGTDLVAVTGVHIEPLGAYSSKYKKLDELPSGATVVIPNDATNGGRALLLLDKAGVIKLKDNKSITATPKDIVDNPKNIKIRELEAATLPRVLTQVDMALINTNYALEAKLNPTKDALAIEGSDSPYVNILVARPDNKDSDAMQKLAKALHSAEVKQFIQEKYKGAVVPAF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

638135 : 695658

Pseudomonas_phage(55.56%)

holin,tRNA,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009875776.1\|638135_639161_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	8.3e-109	58.1
WP_003085061.1\|639239_639809_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_003099587.1\|639892_640246_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_003142783.1\|640236_640779_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_022580735.1\|640751_641984_-	multifunctional CCA addition/repair protein	A0A076G5T8	Escherichia_phage	1.6e-77	43.1
WP_003085071.1\|642027_642534_-	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_003099581.1\|642628_644182_-	SpoVR family protein	NA	NA	NA	NA
WP_003099579.1\|644178_645450_-	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	4.2e-09	37.2
WP_003085078.1\|645550_647473_-	PrkA family serine protein kinase	NA	NA	NA	NA
WP_003099577.1\|647751_648084_-	thiosulfate sulfurtransferase GlpE	NA	NA	NA	NA
WP_003113213.1\|648127_648979_-	symmetrical bis(5'-nucleosyl)-tetraphosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.1e-08	33.3
WP_003085085.1\|648978_649359_-	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
WP_023114717.1\|649395_650202_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_023114716.1\|650317_651304_-	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
WP_003129198.1\|651300_652593_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_004352244.1\|652573_655357_-	LPS-assembly protein LptD	NA	NA	NA	NA
WP_003109031.1\|655489_657202_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.0e-282	82.1
WP_003099554.1\|658474_659491_+	phosphotransferase	NA	NA	NA	NA
WP_003099549.1\|659487_660162_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_004352246.1\|660163_660922_+	DnaJ domain-containing protein	NA	NA	NA	NA
WP_004352248.1\|660922_661984_-	DUF3530 family protein	NA	NA	NA	NA
WP_003459408.1\|662135_664529_+	PAS domain S-box protein	NA	NA	NA	NA
WP_003085103.1\|664574_665207_+	response regulator transcription factor	NA	NA	NA	NA
WP_023114715.1\|665335_666370_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_003085109.1\|666603_667713_+	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.8e-28	34.4
WP_003099539.1\|667768_668815_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003113206.1\|668929_670177_+	ABC transporter permease	NA	NA	NA	NA
WP_003099535.1\|670282_671113_+	ABC transporter permease	NA	NA	NA	NA
WP_003085122.1\|671236_671911_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_003113205.1\|671910_672729_+	phosphoglycolate phosphatase	NA	NA	NA	NA
WP_003113204.1\|672801_674280_+	anthranilate synthase component I	NA	NA	NA	NA
WP_003113203.1\|674598_674913_-	transcription regulatory protein PrtN	NA	NA	NA	NA
WP_003113202.1\|675012_675783_-	helix-turn-helix transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	1.4e-71	59.1
WP_003085132.1\|676240_676441_+	repressor PtrB	W6ATC1	Enterobacter_phage	3.7e-05	58.3
WP_003113201.1\|676488_676848_+	hypothetical protein	NA	NA	NA	NA
WP_003117965.1\|677304_677652_+\|holin	holin	B5TK61	Pseudomonas_phage	3.9e-26	51.8
WP_003118917.1\|677667_678297_+	glycoside hydrolase family 19 protein	A0A125RNP1	Pseudomonas_phage	7.1e-87	78.0
WP_003142810.1\|678293_678656_+	hypothetical protein	NA	NA	NA	NA
WP_003118919.1\|678652_678910_+	hypothetical protein	A0A125RNP3	Pseudomonas_phage	8.3e-18	64.6
WP_003113190.1\|679225_679720_+	hypothetical protein	A0A286S1Q8	Klebsiella_phage	1.4e-45	56.5
WP_004352265.1\|679731_680079_+	hypothetical protein	NA	NA	NA	NA
WP_003113188.1\|680108_680363_+	hypothetical protein	A0A2H4PI34	Pseudomonas_phage	6.3e-10	38.4
WP_023114714.1\|680409_682248_+\|tail	phage tail tape measure protein	A0A0S2SYD9	Pseudomonas_phage	2.6e-28	35.8
WP_003113186.1\|682240_682582_+\|tail	phage tail protein	Q6UAW6	Klebsiella_phage	1.4e-17	40.0
WP_003118922.1\|682589_683285_+\|tail	phage minor tail protein L	A0A1B0VNE0	Pseudomonas_phage	1.5e-69	50.2
WP_003129219.1\|683287_684058_+	peptidase P60	A0A2D1GNP8	Pseudomonas_phage	5.5e-81	55.6
WP_016252934.1\|684112_684715_+\|tail	tail assembly protein	A0A1V0E8A0	Vibrio_phage	4.9e-53	57.3
WP_004352268.1\|684773_688388_+\|tail	phage tail protein	A0A0S2SYC5	Pseudomonas_phage	0.0e+00	55.3
WP_004352269.1\|688623_689412_+	hypothetical protein	NA	NA	NA	NA
WP_003115342.1\|689435_690527_+	hypothetical protein	A0A0S2SY45	Pseudomonas_phage	1.3e-46	36.9
WP_003113180.1\|690526_690862_+	hypothetical protein	NA	NA	NA	NA
WP_004352270.1\|690842_691073_+	hypothetical protein	A0A1W6JT87	Pseudomonas_phage	1.1e-18	64.0
WP_004352271.1\|691168_692221_+	hypothetical protein	A0A0H5AXZ9	Pseudomonas_phage	2.7e-62	52.5
WP_023114713.1\|692220_692523_+	hypothetical protein	A0A0H5B141	Pseudomonas_phage	6.3e-33	70.0
WP_003118930.1\|692519_692750_+	hypothetical protein	C8ZKF3	Pseudomonas_phage	1.4e-24	71.6
WP_003117978.1\|693168_693774_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	2.1e-75	66.3
WP_003085203.1\|693775_694825_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.8e-111	57.8
WP_003085205.1\|694821_695658_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.1e-70	56.9

DBSCAN-SWA_2

1486298 : 1495327

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003098558.1\|1486298_1486934_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.0e-40	52.3
WP_003115226.1\|1486979_1487873_+	peptidoglycan DD-metalloendopeptidase family protein	A0A0S2SXL7	Bacillus_phage	3.0e-06	34.3
WP_003113871.1\|1487977_1488982_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	7.0e-36	37.3
WP_003092272.1\|1489408_1489732_-	Ferredoxin 1	NA	NA	NA	NA
WP_003113873.1\|1489798_1492366_-	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	3.2e-24	22.1
WP_003092265.1\|1492491_1493499_-	TolB family protein	NA	NA	NA	NA
WP_003092262.1\|1493646_1494153_+	CinA family protein	B5TK85	Pseudomonas_phage	8.1e-57	76.0
WP_003092260.1\|1494286_1495327_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.5e-113	59.5

DBSCAN-SWA_3

2600334 : 2607227

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003160440.1\|2600334_2601615_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.8e-98	45.4
WP_003113366.1\|2601616_2603014_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_023114465.1\|2603018_2603993_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_003108776.1\|2604080_2605064_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	9.3e-142	74.3
WP_003090393.1\|2605060_2605396_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	3.3e-38	69.4
WP_003090391.1\|2605392_2605698_-	sulfurtransferase complex subunit TusB	NA	NA	NA	NA
WP_003090389.1\|2605697_2606057_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	1.4e-34	61.7
WP_003090387.1\|2606053_2606449_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.7e-47	72.1
WP_003090386.1\|2606558_2607227_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	1.5e-90	82.1

DBSCAN-SWA_4

4821568 : 4905823

Pseudomonas_virus(72.09%)

tail,portal,terminase,integrase,protease,head,plate,holin,tRNA,capsid

attL 4867320:4867335|attR 4908215:4908230

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003085573.1\|4821568_4822537_+\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
WP_003101974.1\|4822627_4823374_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_003101972.1\|4823366_4824068_-	DNA repair protein RecO	NA	NA	NA	NA
WP_003085566.1\|4824128_4825046_-	GTPase Era	NA	NA	NA	NA
WP_003085565.1\|4825038_4825728_-	ribonuclease III	A0A2K9L5P0	Tupanvirus	7.2e-24	31.4
WP_023086589.1\|4825724_4826102_-	DUF4845 domain-containing protein	NA	NA	NA	NA
WP_003101969.1\|4826270_4827125_-	signal peptidase I	NA	NA	NA	NA
WP_023102293.1\|4827130_4828930_-	elongation factor 4	A0A2K9L2P9	Tupanvirus	3.3e-20	38.5
WP_003101964.1\|4829079_4830504_-\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	3.4e-28	32.0
WP_003110245.1\|4830543_4830999_-	positive regulator for alginate biosynthesis MucC	NA	NA	NA	NA
WP_003101960.1\|4830995_4831946_-	sigma factor AlgU regulatory protein MucB	NA	NA	NA	NA
WP_003101958.1\|4831954_4832539_-	sigma factor AlgU negative regulatory protein	NA	NA	NA	NA
WP_003085543.1\|4832570_4833152_-	RNA polymerase sigma-H factor	NA	NA	NA	NA
WP_003114182.1\|4833560_4835177_+	L-aspartate oxidase	NA	NA	NA	NA
WP_003114181.1\|4835145_4835598_-	hypothetical protein	NA	NA	NA	NA
WP_003085532.1\|4835581_4835836_-	succinate dehydrogenase assembly factor 2	NA	NA	NA	NA
WP_003101947.1\|4836108_4837053_+	folate-binding protein YgfZ	NA	NA	NA	NA
WP_003085528.1\|4837153_4837990_+	HDOD domain-containing protein	A0A1C3NFB0	Phage_NCTB	2.5e-26	36.6
WP_010793854.1\|4837998_4839381_-	sensor histidine kinase	NA	NA	NA	NA
WP_003085524.1\|4839373_4840045_-	response regulator	NA	NA	NA	NA
WP_003116508.1\|4840255_4841539_+	OprD family porin	NA	NA	NA	NA
WP_003085519.1\|4841568_4842552_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_023114050.1\|4842600_4843071_+	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
WP_003120784.1\|4843081_4844599_+	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
WP_003114172.1\|4844591_4845629_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_003106436.1\|4845755_4846451_-	uracil-DNA glycosylase	A0A0A7D9F8	Equid_alphaherpesvirus	1.0e-49	45.2
WP_003106439.1\|4846550_4847372_-	hypothetical protein	NA	NA	NA	NA
WP_003106441.1\|4847428_4848310_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_023114048.1\|4848442_4849951_+	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_023114047.1\|4849962_4851126_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_003085498.1\|4851191_4852010_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_019372102.1\|4852068_4853172_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_023114046.1\|4853283_4854180_+	3-hydroxyisobutyrate dehydrogenase	NA	NA	NA	NA
WP_003085490.1\|4854236_4854881_+	two pore domain potassium channel family protein	NA	NA	NA	NA
WP_003110820.1\|4854996_4855638_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_023112778.1\|4855672_4857649_-	alkyl/aryl-sulfatase	M1I0S7	Paramecium_bursaria_Chlorella_virus	8.1e-161	44.9
WP_003116515.1\|4857751_4858666_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003098351.1\|4858669_4858858_-	hypothetical protein	NA	NA	NA	NA
WP_003085479.1\|4858980_4859226_-	DUF1145 domain-containing protein	NA	NA	NA	NA
WP_003114164.1\|4859342_4859798_-	hypothetical protein	NA	NA	NA	NA
WP_003098355.1\|4859893_4860073_-	hypothetical protein	NA	NA	NA	NA
WP_003114162.1\|4860305_4861382_+	DUF2157 domain-containing protein	NA	NA	NA	NA
WP_003098357.1\|4861378_4862194_+	DUF4824 family protein	NA	NA	NA	NA
WP_003120794.1\|4862214_4862487_+	cysteine-rich CWC family protein	NA	NA	NA	NA
WP_003114159.1\|4862486_4863179_+	16S rRNA pseudouridine(516) synthase	NA	NA	NA	NA
WP_003098363.1\|4863314_4864358_+	L,D-transpeptidase	NA	NA	NA	NA
WP_003114158.1\|4864437_4865175_+	murein L,D-transpeptidase catalytic domain family protein	NA	NA	NA	NA
WP_016263849.1\|4865626_4866529_+	alpha/beta hydrolase	NA	NA	NA	NA
4867320:4867335	attL	NA	NA	NA	NA
WP_023114045.1\|4867541_4868597_-\|portal	phage portal protein	Q9ZXM6	Pseudomonas_virus	1.7e-197	97.1
WP_031275675.1\|4868593_4870357_-\|terminase	terminase ATPase subunit family protein	Q9ZXM5	Pseudomonas_virus	0.0e+00	100.0
WP_023089196.1\|4870512_4871334_+\|capsid	GPO family capsid scaffolding protein	Q9ZXM4	Pseudomonas_virus	3.4e-129	99.6
WP_023091259.1\|4871369_4872386_+\|capsid	phage major capsid protein, P2 family	Q9ZXM3	Pseudomonas_virus	1.7e-191	99.4
WP_023083461.1\|4872391_4873093_+\|terminase	terminase endonuclease subunit	Q9ZXM2	Pseudomonas_virus	6.2e-124	98.7
WP_023083460.1\|4873196_4873658_+\|head	head completion/stabilization protein	Q9ZXM1	Pseudomonas_virus	3.1e-79	98.0
WP_003098378.1\|4873657_4873870_+\|tail	tail protein X	Q9ZXL9	Pseudomonas_virus	4.9e-32	94.1
WP_003098379.1\|4873894_4874248_+	hypothetical protein	Q9ZXL8	Pseudomonas_virus	6.0e-59	100.0
WP_003098380.1\|4874249_4874522_+\|holin	phage holin family protein	Q9ZXL7	Pseudomonas_virus	2.6e-38	97.8
WP_023115051.1\|4874518_4875325_+	DUF3380 domain-containing protein	Q9ZXL6	Pseudomonas_virus	1.0e-141	96.2
WP_016852029.1\|4875321_4875564_+	hypothetical protein	NA	NA	NA	NA
WP_016852030.1\|4875560_4876022_+	peptidase	Q9ZXL5	Pseudomonas_virus	5.3e-63	87.6
WP_016852031.1\|4876099_4876636_+\|tail	phage tail protein	Q9ZXL3	Pseudomonas_virus	7.9e-95	98.9
WP_016852032.1\|4876628_4877087_+	phage virion morphogenesis protein	Q9ZXL2	Pseudomonas_virus	7.0e-68	89.5
WP_016852033.1\|4877156_4877729_+\|plate	phage baseplate assembly protein V	Q9ZXL0	Pseudomonas_virus	3.6e-93	98.9
WP_016852034.1\|4877725_4878070_+\|plate	phage baseplate protein	Q9ZXK9	Pseudomonas_virus	7.9e-56	97.4
WP_023115050.1\|4878066_4878981_+\|plate	baseplate assembly protein	Q9ZXK8	Pseudomonas_virus	4.4e-154	94.1
WP_015967199.1\|4878980_4879517_+\|tail	phage tail protein I	Q9ZXK7	Pseudomonas_virus	1.4e-99	100.0
WP_023115049.1\|4879518_4881909_+	hypothetical protein	Q9ZXK6	Pseudomonas_virus	0.0e+00	89.2
WP_023115048.1\|4881960_4882422_+	hypothetical protein	Q9ZXK5	Pseudomonas_virus	8.5e-37	53.9
WP_023115047.1\|4882512_4883688_+\|tail	phage tail sheath protein	Q9ZXK4	Pseudomonas_virus	2.3e-219	98.5
WP_057427955.1\|4883744_4884260_+\|tail	phage major tail tube protein	Q9ZXK3	Pseudomonas_virus	7.4e-90	94.2
WP_016852041.1\|4884314_4884644_+\|tail	phage tail assembly protein	Q9ZXK2	Pseudomonas_virus	1.5e-48	95.4
WP_003098394.1\|4884652_4884772_+\|tail	GpE family phage tail protein	Q9ZXK1	Pseudomonas_virus	1.8e-15	100.0
WP_023115045.1\|4884761_4887521_+\|tail	phage tail tape measure protein	Q9ZXK0	Pseudomonas_virus	0.0e+00	92.3
WP_003098399.1\|4887526_4887967_+\|tail	phage tail protein	Q9ZXJ9	Pseudomonas_virus	1.8e-76	99.3
WP_023115044.1\|4887963_4889247_+	phage late control D family protein	Q9ZXJ8	Pseudomonas_virus	1.4e-235	97.4
WP_023114951.1\|4889307_4890111_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	1.5e-44	37.3
WP_023114952.1\|4890107_4891304_-	DGQHR domain-containing protein	NA	NA	NA	NA
WP_124119585.1\|4891300_4891798_-	hypothetical protein	NA	NA	NA	NA
WP_031637493.1\|4892005_4892476_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_020750421.1\|4892502_4892733_+	phage-associated protein, BcepMu gp16 family	NA	NA	NA	NA
WP_031637512.1\|4892762_4893236_+	hypothetical protein	Q9ZXJ2	Pseudomonas_virus	3.3e-52	69.5
WP_023114954.1\|4893243_4893462_-	hypothetical protein	NA	NA	NA	NA
WP_023089222.1\|4893460_4893652_+	hypothetical protein	NA	NA	NA	NA
WP_003098408.1\|4893654_4893948_+	ogr/Delta-like zinc finger family protein	Q9ZXJ1	Pseudomonas_virus	1.1e-50	99.0
WP_003098409.1\|4893944_4894295_+	hypothetical protein	NA	NA	NA	NA
WP_023115041.1\|4894366_4894600_+	hypothetical protein	Q9ZXI9	Pseudomonas_virus	2.9e-38	98.7
WP_023089226.1\|4897360_4897714_+	hypothetical protein	Q9ZXI7	Pseudomonas_virus	2.4e-60	97.4
WP_003098417.1\|4897725_4897932_+	TraR/DksA family transcriptional regulator	Q9ZXI6	Pseudomonas_virus	7.3e-33	100.0
WP_023115039.1\|4898235_4900146_+	hypothetical protein	A0A0U1T6D1	Pseudomonas_phage	6.6e-285	94.3
WP_023115038.1\|4900142_4901375_+	phosphoadenosine phosphosulfate reductase family protein	R9TRT5	Rhizobium_phage	7.2e-176	72.1
WP_016852059.1\|4901558_4901927_+	ASCH domain-containing protein	A0A291AUQ6	Sinorhizobium_phage	2.7e-30	50.4
WP_003098423.1\|4902119_4902323_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_023115037.1\|4902329_4903532_-\|integrase	integrase family protein	A0A248SL35	Klebsiella_phage	2.2e-36	30.9
WP_018076254.1\|4903969_4905823_+\|integrase	tyrosine-type recombinase/integrase	A0A0U1UNT3	Pseudomonas_phage	1.1e-103	51.0
4908215:4908230	attR	NA	NA	NA	NA

DBSCAN-SWA_5

5875380 : 5911730

Pseudomonas_phage(77.55%)

terminase,integrase,transposase,protease,head

attL 5864055:5864072|attR 5921762:5921779

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5864055:5864072	attL	NA	NA	NA	NA
WP_003099504.1\|5875380_5875605_-	hypothetical protein	Q5ZQV7	Pseudomonas_phage	7.2e-34	97.3
WP_003099502.1\|5875683_5875971_-	hypothetical protein	A0A076FSS3	Pseudomonas_phage	6.2e-46	95.8
WP_023098814.1\|5875967_5877116_-	hypothetical protein	B7SE13	Pseudomonas_virus	2.7e-225	99.2
WP_003099498.1\|5877112_5879320_-	hypothetical protein	A0A0A1IX03	Pseudomonas_phage	0.0e+00	98.4
WP_003099496.1\|5879309_5879528_-	hypothetical protein	A0A076FR11	Pseudomonas_phage	5.7e-36	100.0
WP_003099487.1\|5879524_5879764_-	hypothetical protein	A0A076FRB9	Pseudomonas_phage	2.1e-39	100.0
WP_003099484.1\|5879772_5880594_-	DUF2163 domain-containing protein	A0A076FSS7	Pseudomonas_phage	2.6e-161	99.3
WP_003099481.1\|5880583_5882287_-	hypothetical protein	L7P7V0	Pseudomonas_phage	0.0e+00	98.1
WP_003099478.1\|5882286_5883210_-	hypothetical protein	A0A125RNJ1	Pseudomonas_phage	2.4e-176	93.8
WP_023098816.1\|5883211_5884168_-	hypothetical protein	A0A0A7DK02	Pseudomonas_phage	2.4e-182	94.7
WP_003099473.1\|5884175_5887874_-	tape measure protein	B7SE05	Pseudomonas_virus	0.0e+00	98.2
WP_031630143.1\|5888000_5888519_-	hypothetical protein	B7SE04	Pseudomonas_virus	1.5e-82	98.0
WP_003099463.1\|5888523_5889294_-	hypothetical protein	A0A0A1IW08	Pseudomonas_phage	8.0e-141	99.2
WP_003099460.1\|5889326_5889506_-	hypothetical protein	A0A0U5G7J8	unidentified_phage	2.9e-25	100.0
WP_003099458.1\|5889493_5889967_-	hypothetical protein	A0A0A1IUZ7	Pseudomonas_phage	5.0e-85	99.4
WP_003094564.1\|5889963_5890380_-	DUF1320 domain-containing protein	L7P7K2	Pseudomonas_phage	3.9e-73	100.0
WP_003099454.1\|5890543_5890984_-	hypothetical protein	A0A125RNI2	Pseudomonas_phage	1.2e-45	100.0
WP_003099452.1\|5891051_5891966_-\|head	head protein	I6PBD3	Pseudomonas_phage	9.2e-176	100.0
WP_031630145.1\|5891969_5893067_-\|protease	protease	A0A125RNI0	Pseudomonas_phage	6.4e-200	99.7
WP_003099449.1\|5893269_5893737_-	phage virion morphogenesis protein	B7SDZ4	Pseudomonas_virus	2.4e-79	96.8
WP_003099448.1\|5893736_5895023_-	virion morphogenesis protein	B7SDZ3	Pseudomonas_virus	5.9e-245	99.5
WP_003099445.1\|5895022_5896603_-	DUF935 domain-containing protein	A0A0A1IVG5	Pseudomonas_phage	8.4e-302	99.6
WP_003099444.1\|5896612_5898259_-\|terminase	phage terminase large subunit	A0SMN6	Pseudomonas_virus	0.0e+00	98.2
WP_003099442.1\|5898853_5899354_-	DUF1804 family protein	A0A1C6ZDN3	Pseudomonas_phage	8.5e-83	99.4
WP_003094538.1\|5899362_5899551_-	hypothetical protein	A0A0A1IVG3	Pseudomonas_phage	1.0e-25	100.0
WP_003099439.1\|5899661_5900063_-	hypothetical protein	A0A0A7DJP8	Pseudomonas_phage	1.1e-64	97.0
WP_003099438.1\|5900059_5900302_-	hypothetical protein	L7P808	Pseudomonas_phage	2.6e-37	98.8
WP_003099436.1\|5900301_5900718_-	structural protein	A0A125RNG7	Pseudomonas_phage	3.9e-73	100.0
WP_031630147.1\|5900717_5901140_-	hypothetical protein	A0A0U5LBV3	unidentified_phage	4.3e-72	98.6
WP_016050131.1\|5901132_5901480_-	hypothetical protein	I6P9D0	Pseudomonas_phage	1.9e-57	100.0
WP_015649664.1\|5901582_5902032_-	hypothetical protein	I6PBD0	Pseudomonas_phage	4.6e-80	100.0
WP_003099430.1\|5902018_5902426_-	regulatory protein GemA	I6PBV8	Pseudomonas_phage	7.9e-71	100.0
WP_003099427.1\|5902422_5902719_-	hypothetical protein	L7P7Y1	Pseudomonas_phage	1.2e-44	100.0
WP_003099425.1\|5902789_5903059_-	hypothetical protein	A0A0A7DJS6	Pseudomonas_phage	6.6e-42	97.8
WP_003094506.1\|5903061_5903268_-	hypothetical protein	A0A0A1IWY9	Pseudomonas_phage	2.2e-29	100.0
WP_003099423.1\|5903269_5903551_-	hypothetical protein	A0A125RNF9	Pseudomonas_phage	2.1e-46	100.0
WP_003094501.1\|5903553_5903862_-	hypothetical protein	L7P806	Pseudomonas_phage	8.4e-49	100.0
WP_003099420.1\|5903863_5904067_-	hypothetical protein	I6PBV7	Pseudomonas_phage	1.7e-29	98.5
WP_003099419.1\|5904066_5904585_-	host-nuclease inhibitor protein Gam	L7P7I4	Pseudomonas_phage	1.5e-90	99.4
WP_020750458.1\|5904601_5904913_-	hypothetical protein	A0A1C6ZDI6	Pseudomonas_phage	3.1e-51	99.0
WP_003099415.1\|5904875_5905289_-	hypothetical protein	A0A0A1IWY8	Pseudomonas_phage	1.2e-71	100.0
WP_003099411.1\|5905389_5906025_-	hypothetical protein	A0A125RNF2	Pseudomonas_phage	5.9e-113	99.1
WP_003099409.1\|5906096_5906762_-	hypothetical protein	A0A125RNF1	Pseudomonas_phage	1.7e-123	99.5
WP_012613772.1\|5906758_5907529_-	ATP-binding protein	A0A125RN40	Pseudomonas_phage	4.9e-138	100.0
WP_003099405.1\|5907525_5909595_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0U5LBU1	unidentified_phage	0.0e+00	99.4
WP_003099403.1\|5909587_5910019_-	hypothetical protein	L7P827	Pseudomonas_phage	4.0e-65	100.0
WP_003094469.1\|5910018_5910453_-	hypothetical protein	L7P7J4	Pseudomonas_phage	2.3e-76	100.0
WP_003094467.1\|5910455_5910812_-	nucleotide excision repair protein	A0A0U5KN61	unidentified_phage	4.5e-62	100.0
WP_003099400.1\|5911052_5911730_+	helix-turn-helix transcriptional regulator	H1ZZB6	Pseudomonas_virus	1.1e-117	97.3
5921762:5921779	attR	NA	NA	NA	NA

DBSCAN-SWA_6

6186953 : 6275531

Pseudomonas_virus(76.6%)

tail,portal,terminase,integrase,transposase,protease,head,plate,holin,tRNA,capsid

attL 6209459:6209504|attR 6225700:6225745

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003104666.1\|6186953_6187415_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_003096050.1\|6187473_6187965_-	protein-export chaperone SecB	NA	NA	NA	NA
WP_023114929.1\|6188001_6188256_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	4.7e-13	43.4
WP_003096058.1\|6188257_6188677_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_003114478.1\|6189001_6190549_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_014603391.1\|6190862_6191681_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_031637483.1\|6191830_6193117_+	murein hydrolase activator EnvC	G9BW84	Planktothrix_phage	2.9e-10	39.8
WP_003123646.1\|6193145_6194456_+	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	5.0e-26	29.0
WP_003096069.1\|6194455_6195229_+	divergent polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_010793678.1\|6195297_6196779_+	hypothetical protein	NA	NA	NA	NA
WP_003096075.1\|6196815_6197571_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003106330.1\|6197720_6198473_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003106332.1\|6198563_6199310_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003106334.1\|6199481_6200252_-	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_003106336.1\|6200262_6201000_-	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_003112624.1\|6201048_6201309_-	DUF2164 domain-containing protein	NA	NA	NA	NA
WP_003096087.1\|6201312_6201951_-	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_003096088.1\|6201950_6202544_-	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_003112623.1\|6202704_6203103_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003112622.1\|6203139_6203376_+	hypothetical protein	NA	NA	NA	NA
WP_003112621.1\|6203372_6204479_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003105535.1\|6204572_6206825_+	AsmA family protein	NA	NA	NA	NA
WP_004352428.1\|6206821_6207889_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_003096100.1\|6207932_6208205_+	oxidative damage protection protein	NA	NA	NA	NA
WP_003112619.1\|6208232_6209315_+	oxidoreductase	NA	NA	NA	NA
6209459:6209504	attL	NA	NA	NA	NA
WP_124033777.1\|6209530_6210715_+\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	5.5e-48	38.4
WP_023114932.1\|6211026_6213105_+	ATP-binding protein	NA	NA	NA	NA
WP_023114933.1\|6213456_6213849_+	hypothetical protein	NA	NA	NA	NA
WP_023114934.1\|6213991_6214654_+	hypothetical protein	NA	NA	NA	NA
WP_023114935.1\|6214672_6215875_+	ImmA/IrrE family metallo-endopeptidase	B6SBZ6	Clostridium_virus	1.5e-40	30.1
WP_023114936.1\|6216426_6217473_-	hypothetical protein	NA	NA	NA	NA
WP_124033778.1\|6217740_6218076_+	hypothetical protein	NA	NA	NA	NA
WP_023114937.1\|6218076_6220332_-	DotA/TraY family protein	NA	NA	NA	NA
WP_124033779.1\|6220328_6220643_-	hypothetical protein	NA	NA	NA	NA
WP_124033780.1\|6220630_6220879_-	DNA-binding protein	NA	NA	NA	NA
WP_124074571.1\|6221504_6221726_+	hypothetical protein	NA	NA	NA	NA
WP_031637489.1\|6221781_6222234_-	hypothetical protein	NA	NA	NA	NA
WP_086009326.1\|6222782_6223920_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	7.7e-47	38.7
WP_094868201.1\|6223947_6225453_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_003096148.1\|6225801_6226539_-	SDR family oxidoreductase	NA	NA	NA	NA
6225700:6225745	attR	NA	NA	NA	NA
WP_023114939.1\|6226697_6227387_+	DUF502 domain-containing protein	NA	NA	NA	NA
WP_003096153.1\|6227635_6228409_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.3e-20	31.1
WP_003096156.1\|6228423_6229176_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016562461.1\|6229237_6229933_+	ABC transporter permease	NA	NA	NA	NA
WP_003096163.1\|6229929_6230622_+	ABC transporter permease	NA	NA	NA	NA
WP_010793675.1\|6230690_6231911_+	methyltransferase	NA	NA	NA	NA
WP_003110596.1\|6232309_6232780_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003112617.1\|6232783_6234262_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_003105511.1\|6234276_6235461_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_003096173.1\|6235471_6237001_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_071534457.1\|6238063_6238591_+	SocA family protein	NA	NA	NA	NA
WP_124033784.1\|6239021_6239441_+	hypothetical protein	L7TJK7	Pseudomonas_virus	2.2e-23	38.8
WP_023114940.1\|6239437_6240493_-\|portal	phage portal protein	Q9ZXM6	Pseudomonas_virus	6.0e-195	96.5
WP_031643136.1\|6240492_6242253_-\|terminase	terminase ATPase subunit family protein	Q9ZXM5	Pseudomonas_virus	0.0e+00	99.8
WP_023121181.1\|6242408_6243230_+\|capsid	GPO family capsid scaffolding protein	Q9ZXM4	Pseudomonas_virus	2.2e-128	98.9
WP_016852024.1\|6243265_6244282_+\|capsid	phage major capsid protein, P2 family	Q9ZXM3	Pseudomonas_virus	6.6e-191	99.1
WP_023114941.1\|6244287_6244989_+\|terminase	terminase endonuclease subunit	Q9ZXM2	Pseudomonas_virus	1.1e-123	98.7
WP_023116818.1\|6245092_6245554_+\|head	head completion/stabilization protein	Q9ZXM1	Pseudomonas_virus	6.8e-79	97.4
WP_003098378.1\|6245553_6245766_+\|tail	tail protein X	Q9ZXL9	Pseudomonas_virus	4.9e-32	94.1
WP_003098379.1\|6245790_6246144_+	hypothetical protein	Q9ZXL8	Pseudomonas_virus	6.0e-59	100.0
WP_003098380.1\|6246145_6246418_+\|holin	phage holin family protein	Q9ZXL7	Pseudomonas_virus	2.6e-38	97.8
WP_023114944.1\|6246414_6247221_+	DUF3380 domain-containing protein	Q9ZXL6	Pseudomonas_virus	9.0e-143	96.9
WP_016852029.1\|6247217_6247460_+	hypothetical protein	NA	NA	NA	NA
WP_016852030.1\|6247456_6247918_+	peptidase	Q9ZXL5	Pseudomonas_virus	5.3e-63	87.6
WP_016852031.1\|6247995_6248532_+\|tail	phage tail protein	Q9ZXL3	Pseudomonas_virus	7.9e-95	98.9
WP_023089204.1\|6248524_6248983_+	phage virion morphogenesis protein	Q9ZXL2	Pseudomonas_virus	9.8e-70	91.3
WP_023089205.1\|6248992_6249421_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023089206.1\|6249598_6250171_+\|plate	phage baseplate assembly protein V	Q9ZXL0	Pseudomonas_virus	9.7e-91	96.8
WP_023089207.1\|6250167_6250512_+	hypothetical protein	Q9ZXK9	Pseudomonas_virus	4.6e-56	97.4
WP_023114945.1\|6250508_6251423_+\|plate	baseplate assembly protein	Q9ZXK8	Pseudomonas_virus	7.0e-160	96.7
WP_023091255.1\|6251422_6251959_+\|tail	phage tail protein I	Q9ZXK7	Pseudomonas_virus	3.1e-99	99.4
WP_023089210.1\|6251960_6254318_+\|tail	phage tail fiber protein	Q9ZXK6	Pseudomonas_virus	0.0e+00	87.5
WP_023114946.1\|6254314_6254779_+	hypothetical protein	Q9ZXK5	Pseudomonas_virus	2.3e-42	60.7
WP_023114947.1\|6254869_6256045_+\|tail	phage tail sheath protein	Q9ZXK4	Pseudomonas_virus	2.3e-219	98.5
WP_023114948.1\|6256101_6256617_+\|tail	phage major tail tube protein	Q9ZXK3	Pseudomonas_virus	2.1e-89	94.2
WP_023083449.1\|6256671_6257001_+\|tail	phage tail assembly protein	Q9ZXK2	Pseudomonas_virus	5.3e-49	96.3
WP_003098394.1\|6257009_6257129_+\|tail	GpE family phage tail protein	Q9ZXK1	Pseudomonas_virus	1.8e-15	100.0
WP_023114949.1\|6257118_6259866_+\|tail	phage tail tape measure protein	Q9ZXK0	Pseudomonas_virus	0.0e+00	94.1
WP_003098399.1\|6259871_6260312_+\|tail	phage tail protein	Q9ZXJ9	Pseudomonas_virus	1.8e-76	99.3
WP_023121182.1\|6260308_6261595_+	phage late control D family protein	Q9ZXJ8	Pseudomonas_virus	3.1e-230	96.2
WP_071534455.1\|6261816_6262356_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_031633861.1\|6262478_6263012_+	hypothetical protein	NA	NA	NA	NA
WP_023096284.1\|6263065_6263416_-	hypothetical protein	Q9ZXJ5	Pseudomonas_virus	2.9e-53	89.6
WP_121334483.1\|6263733_6264096_-	helix-turn-helix transcriptional regulator	E5E3P4	Burkholderia_phage	2.1e-06	42.1
WP_031643139.1\|6264174_6264387_+	hypothetical protein	A0A2H4JE67	uncultured_Caudovirales_phage	1.9e-07	46.8
WP_031293865.1\|6264416_6264887_+	hypothetical protein	Q9ZXJ2	Pseudomonas_virus	2.5e-76	93.6
WP_003098408.1\|6264883_6265177_+	ogr/Delta-like zinc finger family protein	Q9ZXJ1	Pseudomonas_virus	1.1e-50	99.0
WP_023096288.1\|6265173_6265524_+	hypothetical protein	NA	NA	NA	NA
WP_003098410.1\|6265594_6265828_+	hypothetical protein	Q9ZXI9	Pseudomonas_virus	7.8e-39	100.0
WP_023121183.1\|6265824_6268545_+	hypothetical protein	Q9ZXI8	Pseudomonas_virus	0.0e+00	96.6
WP_023114956.1\|6268589_6268943_+	hypothetical protein	Q9ZXI7	Pseudomonas_virus	2.4e-60	97.4
WP_003098417.1\|6268954_6269161_+	TraR/DksA family transcriptional regulator	Q9ZXI6	Pseudomonas_virus	7.3e-33	100.0
WP_023114957.1\|6269464_6271150_+	hypothetical protein	L7TH64	Pseudomonas_virus	4.8e-287	90.8
WP_023114958.1\|6271160_6271349_+	hypothetical protein	Q38017	Pseudomonas_virus	7.0e-06	76.5
WP_023114959.1\|6271345_6271558_+	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_023114960.1\|6271554_6272703_+	hypothetical protein	V9IQN0	Stenotrophomonas_phage	1.8e-72	40.5
WP_023114962.1\|6273169_6273676_+	type II toxin-antitoxin system death-on-curing family toxin	NA	NA	NA	NA
WP_023114963.1\|6274211_6275531_+	DUF4102 domain-containing protein	Q7M297	Enterobacteria_phage	1.2e-64	34.2

Anti-CRISPR protein detection

Acr_ID: NZ_CP046069.1|WP_003158163.1|5424610_5424985_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP046069.1|WP_021205795.1|5426726_5427119_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP046069.1|WP_003158159.1|5427137_5427461_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP046069.1|WP_003158163.1|5424610_5424985_+|hypothetical-protein

5424610_5424985_+

124 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|27	1.0	1	1.0

NZ_CP046069.1|WP_021205795.1|5426726_5427119_+|hypothetical-protein

5426726_5427119_+

130 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|3	0.4251968503937008	0.9307692307692308	0.8785714285714286

NZ_CP046069.1|WP_003158159.1|5427137_5427461_+|hypothetical-protein

5427137_5427461_+

107 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|15	0.6213592233009708	0.9719626168224299	0.99

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046069

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information