CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP046045	Acinetobacter towneri strain 19110F47 chromosome, complete genome	0 crisprs	cas3f,cas14j,cas3,DEDDh,csa3,WYL,c2c9_V-U4	0	5
NZ_CP046043	Acinetobacter towneri strain 19110F47 plasmid p19110F47-1, complete sequence	0 crisprs	NA	0	4
NZ_CP046044	Acinetobacter towneri strain 19110F47 plasmid p19110F47-2, complete sequence	1 crisprs	PrimPol	2	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

142512 : 185166

Escherichia_phage(42.86%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032073143.1\|142512_143217_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	5.1e-118	84.1
WP_154320196.1\|143282_146741_-	PAS domain S-box protein	NA	NA	NA	NA
WP_154320197.1\|147666_148239_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.8e-28	43.5
WP_154320198.1\|148453_149743_+	salicylate 1-monooxygenase	NA	NA	NA	NA
WP_154320199.1\|149797_151150_+	aromatic acid/H+ symport family MFS transporter	NA	NA	NA	NA
WP_154320200.1\|151200_152094_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005096107.1\|154128_154497_+	hypothetical protein	NA	NA	NA	NA
WP_035269736.1\|154545_155871_+	TolC family protein	NA	NA	NA	NA
WP_104472702.1\|155872_157102_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_096902762.1\|157091_160232_+	CusA/CzcA family heavy metal efflux RND transporter	NA	NA	NA	NA
WP_005028603.1\|160318_161218_+	cation transporter	NA	NA	NA	NA
WP_000678311.1\|161404_161971_+	recombinase family protein	M9Q1K0	Clostridium_phage	6.1e-29	41.4
WP_154320201.1\|162476_163022_+	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|163055_163760_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000018323.1\|163889_164705_+	APH(3')-I family aminoglycoside O-phosphotransferase	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	1.3e-160	98.2
WP_001067855.1\|164768_165473_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_032490158.1\|166218_166692_+	trimethoprim-resistant dihydrofolate reductase DfrA16	A0A1B2IBQ4	Erwinia_phage	3.1e-18	32.9
WP_001931474.1\|166856_167723_+	PSE family carbenicillin-hydrolyzing class A beta-lactamase CARB-2	A0A077SL40	Escherichia_phage	4.8e-57	44.1
WP_001261740.1\|167840_168632_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA2	NA	NA	NA	NA
WP_001256773.1\|168893_170153_+	chloramphenicol efflux MFS transporter CmlA6	S4TR35	Salmonella_phage	2.8e-26	31.7
WP_001206316.1\|170245_171037_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
WP_000679427.1\|171200_171548_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|171541_172381_+	sulfonamide-resistant dihydropteroate synthase Sul1	NA	NA	NA	NA
WP_000376623.1\|172508_173009_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001067855.1\|173138_173843_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_154320202.1\|173867_174056_+	hypothetical protein	NA	NA	NA	NA
WP_171501091.1\|174595_175615_-	hypothetical protein	A0A0N9SHY1	Staphylococcus_phage	1.3e-32	35.2
WP_154320204.1\|175523_176387_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_154320205.1\|176836_178462_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	6.2e-143	53.6
WP_000618087.1\|178535_178871_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_004828545.1\|178867_179251_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_154320109.1\|179905_180694_-	hypothetical protein	NA	NA	NA	NA
WP_154320110.1\|180660_181134_-	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_154320111.1\|181203_181767_+	macro domain-containing protein	E2CTW8	Turbot_reddish_body_iridovirus	1.5e-24	37.1
WP_154320207.1\|181894_182209_-	BrnA antitoxin family protein	NA	NA	NA	NA
WP_154320208.1\|182195_182483_-	BrnT family toxin	NA	NA	NA	NA
WP_074163995.1\|182949_183450_-	META domain-containing protein	NA	NA	NA	NA
WP_074163994.1\|183452_184136_-	hypothetical protein	NA	NA	NA	NA
WP_001067784.1\|184461_185166_-\|transposase	IS6-like element IS1006 family transposase	A0A077SL39	Escherichia_phage	1.9e-120	85.8

DBSCAN-SWA_2

1023855 : 1065005

Acinetobacter_phage(23.33%)

portal,integrase,terminase

attL 1035054:1035067|attR 1065298:1065311

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154320518.1\|1023855_1024671_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	4.7e-38	36.0
WP_096902393.1\|1024670_1025444_-	ABC transporter permease	NA	NA	NA	NA
WP_154320519.1\|1025440_1026376_-	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.2e-22	32.4
WP_121594692.1\|1026712_1026979_-	hypothetical protein	NA	NA	NA	NA
WP_154320520.1\|1026975_1027305_-	hypothetical protein	NA	NA	NA	NA
WP_154320521.1\|1027297_1027597_-	hypothetical protein	A0A2I7QNA8	Vibrio_phage	8.5e-06	32.9
WP_154320522.1\|1028039_1028630_-	HNH endonuclease	A0A2H4JIA5	uncultured_Caudovirales_phage	9.2e-20	30.9
WP_154320523.1\|1028631_1028877_-	hypothetical protein	NA	NA	NA	NA
WP_154320524.1\|1028876_1029191_-	hypothetical protein	A0A068CGE8	Acinetobacter_phage	4.0e-06	33.7
WP_154320525.1\|1029187_1029676_-	hypothetical protein	A0A142IE12	Pseudomonas_phage	3.2e-18	46.7
WP_154320526.1\|1029672_1030308_-	hypothetical protein	A0A1X9SFE6	Acinetobacter_phage	1.6e-46	45.3
WP_171501095.1\|1030294_1031095_-	recombinase RecT	G9L6A2	Escherichia_phage	2.6e-57	58.0
WP_154320527.1\|1031091_1031502_-	hypothetical protein	NA	NA	NA	NA
WP_154320528.1\|1031498_1031723_-	hypothetical protein	NA	NA	NA	NA
WP_154320529.1\|1031965_1032658_-	helix-turn-helix domain-containing protein	A0A0R6PHY1	Moraxella_phage	2.9e-49	43.4
WP_130235212.1\|1032816_1033041_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_154321255.1\|1033319_1033883_+	phage antirepressor KilAC domain-containing protein	A0A0E3GMP7	Bacillus_phage	4.7e-13	28.5
WP_171501096.1\|1033879_1034047_+	hypothetical protein	NA	NA	NA	NA
WP_171501097.1\|1034855_1036166_+	AAA family ATPase	A0A1X9SFL1	Acinetobacter_phage	8.6e-143	58.9
1035054:1035067	attL	NA	NA	NA	NA
WP_154320531.1\|1036162_1036420_+	winged helix-turn-helix domain-containing protein	A0A1B1P9H6	Acinetobacter_phage	5.2e-12	50.6
WP_154320532.1\|1036416_1037394_+	hypothetical protein	NA	NA	NA	NA
WP_154320533.1\|1037390_1037981_+	hypothetical protein	NA	NA	NA	NA
WP_171501098.1\|1037977_1038142_+	hypothetical protein	NA	NA	NA	NA
WP_154320534.1\|1038134_1038452_+	hypothetical protein	Q6J1P1	Burkholderia_virus	5.3e-14	48.1
WP_154320535.1\|1038444_1038819_+	hypothetical protein	NA	NA	NA	NA
WP_154320536.1\|1038811_1039150_+	DUF1064 domain-containing protein	A0A0R6PIZ9	Moraxella_phage	6.4e-26	54.5
WP_154320537.1\|1039160_1039427_+	hypothetical protein	NA	NA	NA	NA
WP_154320538.1\|1039437_1039977_+	hypothetical protein	A0A0D4DCD6	Acinetobacter_phage	3.9e-49	55.1
WP_154320539.1\|1040507_1040687_+	hypothetical protein	A0A2H4JC09	uncultured_Caudovirales_phage	9.2e-16	62.7
WP_154320540.1\|1040945_1041449_+	hypothetical protein	A0A2H4JDI9	uncultured_Caudovirales_phage	1.9e-66	72.5
WP_154320541.1\|1041453_1041879_+\|terminase	terminase small subunit	E5AGA2	Erwinia_phage	9.2e-38	61.2
WP_154320542.1\|1041853_1043140_+\|terminase	PBSX family phage terminase large subunit	L7TP33	Pseudomonas_virus	1.1e-73	39.5
WP_154320543.1\|1043143_1045390_+\|portal	portal protein p19	A8HNY9	Thalassomonas_phage	8.8e-71	33.0
WP_154320544.1\|1045379_1046192_+	hypothetical protein	NA	NA	NA	NA
WP_154320545.1\|1046195_1047401_+	hypothetical protein	C8CLI7	Xylella_phage	6.2e-71	43.8
WP_154320546.1\|1047455_1047872_+	hypothetical protein	NA	NA	NA	NA
WP_154320547.1\|1047926_1048547_+	hypothetical protein	I3PUX2	Vibrio_phage	5.9e-09	24.6
WP_154321256.1\|1048533_1049940_+	hypothetical protein	A0A0E3JSB2	Rhodoferax_phage	3.3e-76	37.3
WP_154320548.1\|1049939_1050290_+	hypothetical protein	NA	NA	NA	NA
WP_154320549.1\|1050276_1050609_+	hypothetical protein	NA	NA	NA	NA
WP_154320550.1\|1050605_1051181_+	aspartyl/asparaginyl beta-hydroxylase domain-containing protein	NA	NA	NA	NA
WP_154320551.1\|1051177_1051633_+	GNAT family N-acetyltransferase	A0A2I7RY08	Vibrio_phage	1.6e-16	34.4
WP_154320552.1\|1051634_1052342_+	DNA transfer protein p32	NA	NA	NA	NA
WP_154320553.1\|1052341_1053715_+	hypothetical protein	NA	NA	NA	NA
WP_154320554.1\|1053756_1054488_+	glycoside hydrolase family protein	H9C1A7	Pectobacterium_phage	3.9e-36	55.3
WP_154320555.1\|1054503_1056711_+	hypothetical protein	NA	NA	NA	NA
WP_154320556.1\|1056820_1057321_-	lipoprotein	NA	NA	NA	NA
WP_154320557.1\|1057389_1059861_+	hypothetical protein	A0A0E3JSA8	Rhodoferax_phage	7.1e-13	35.1
WP_154320558.1\|1059937_1060207_+	hypothetical protein	NA	NA	NA	NA
WP_154320559.1\|1060193_1060973_+	N-acetylmuramoyl-L-alanine amidase	U5PZX6	Acinetobacter_phage	2.9e-53	60.9
WP_154320560.1\|1061049_1062036_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P9F9	Acinetobacter_phage	5.7e-139	73.8
WP_154320561.1\|1062393_1063623_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	2.8e-71	39.6
WP_154320562.1\|1063862_1065005_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J339	uncultured_Caudovirales_phage	4.2e-69	38.2
1065298:1065311	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1106833 : 1115542

uncultured_Caudovirales_phage(42.86%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_104852204.1\|1106833_1107961_+	toxic anion resistance protein	K4F9M7	Cronobacter_phage	4.3e-18	22.0
WP_131261786.1\|1108017_1108935_+	hypothetical protein	NA	NA	NA	NA
WP_096901839.1\|1109151_1110717_+	alkyl hydroperoxide reductase subunit F	A0A0D3MT87	Lactococcus_phage	8.7e-25	31.5
WP_004972931.1\|1110953_1111223_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	6.7e-18	50.0
WP_136144203.1\|1111250_1112633_-\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	3.5e-134	65.8
WP_154320582.1\|1112857_1113286_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	1.4e-41	61.9
WP_136144348.1\|1113384_1113702_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	6.7e-25	67.1
WP_004972938.1\|1113706_1114765_+	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_004972939.1\|1114837_1115542_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.2e-93	71.2

DBSCAN-SWA_4

1150031 : 1214876

Acinetobacter_phage(29.03%)

capsid,transposase,integrase,terminase

attL 1145296:1145312|attR 1204418:1204434

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1145296:1145312	attL	NA	NA	NA	NA
WP_154320598.1\|1150031_1150379_-	hypothetical protein	A0A2H4J8T6	uncultured_Caudovirales_phage	3.0e-10	40.8
WP_154320599.1\|1150375_1150693_-	hypothetical protein	NA	NA	NA	NA
WP_154320600.1\|1150685_1151003_-	hypothetical protein	A0A2H4J3E7	uncultured_Caudovirales_phage	1.4e-27	96.7
WP_154320601.1\|1151011_1151209_-	hypothetical protein	NA	NA	NA	NA
WP_154320602.1\|1151208_1151631_-	hypothetical protein	NA	NA	NA	NA
WP_154320603.1\|1151630_1151987_-	hypothetical protein	NA	NA	NA	NA
WP_154320604.1\|1151986_1152220_-	hypothetical protein	A0A2H4J515	uncultured_Caudovirales_phage	9.2e-24	72.7
WP_154320605.1\|1152216_1152849_-	ERF family protein	A0A1B1IP10	uncultured_Mediterranean_phage	1.1e-31	57.9
WP_154320606.1\|1152852_1153173_-	hypothetical protein	NA	NA	NA	NA
WP_154320607.1\|1153169_1153349_-	hypothetical protein	NA	NA	NA	NA
WP_154320608.1\|1153345_1153570_-	hypothetical protein	NA	NA	NA	NA
WP_154320609.1\|1153772_1154456_-	helix-turn-helix transcriptional regulator	A0A2H4J597	uncultured_Caudovirales_phage	5.2e-83	67.4
WP_154320610.1\|1154580_1154781_+	hypothetical protein	NA	NA	NA	NA
WP_154320611.1\|1154795_1155086_+	hypothetical protein	NA	NA	NA	NA
WP_171501101.1\|1155183_1155354_+	hypothetical protein	NA	NA	NA	NA
WP_154321259.1\|1155340_1156219_+	Lrp/AsnC family transcriptional regulator	A0A068C8G6	Acinetobacter_phage	1.7e-46	56.2
WP_171501097.1\|1156218_1157529_+	AAA family ATPase	A0A1X9SFL1	Acinetobacter_phage	8.6e-143	58.9
WP_154320531.1\|1157525_1157783_+	winged helix-turn-helix domain-containing protein	A0A1B1P9H6	Acinetobacter_phage	5.2e-12	50.6
WP_154320612.1\|1157779_1158769_+	hypothetical protein	NA	NA	NA	NA
WP_154320533.1\|1158765_1159356_+	hypothetical protein	NA	NA	NA	NA
WP_171501102.1\|1159352_1159517_+	hypothetical protein	NA	NA	NA	NA
WP_154320613.1\|1159509_1159860_+	hypothetical protein	I2GUD3	Acinetobacter_phage	1.6e-11	52.5
WP_154320614.1\|1159856_1160165_+	hypothetical protein	V5YTP3	Pseudomonas_phage	1.5e-13	47.4
WP_154320615.1\|1160157_1160496_+	DUF1064 domain-containing protein	A0A0R6PIZ9	Moraxella_phage	3.5e-24	52.7
WP_154320616.1\|1160506_1160773_+	hypothetical protein	NA	NA	NA	NA
WP_154320617.1\|1160782_1161223_+	hypothetical protein	A0A2H4J548	uncultured_Caudovirales_phage	4.1e-49	62.1
WP_154320618.1\|1161277_1162624_+	AAA family ATPase	NA	NA	NA	NA
WP_154321260.1\|1163188_1163368_+	hypothetical protein	NA	NA	NA	NA
WP_154320619.1\|1163557_1164175_+\|transposase	transposase	A0A1B1P9K3	Acinetobacter_phage	1.8e-58	57.4
WP_154320620.1\|1164221_1164677_+	DUF2280 domain-containing protein	A0A0D4DC15	Acinetobacter_phage	9.5e-49	78.9
WP_154320621.1\|1164639_1166001_+\|terminase	PBSX family phage terminase large subunit	A0A077KAW0	Edwardsiella_phage	3.4e-166	62.9
WP_154321261.1\|1166078_1167302_+	DUF1073 domain-containing protein	M4SN90	Psychrobacter_phage	5.5e-75	38.4
WP_154320622.1\|1167276_1168170_+\|capsid	minor capsid protein	M4T3R2	Psychrobacter_phage	1.9e-45	40.1
WP_154320623.1\|1168166_1169339_+	DUF2213 domain-containing protein	M4SN93	Psychrobacter_phage	1.1e-64	44.0
WP_154320624.1\|1169353_1169824_+	hypothetical protein	NA	NA	NA	NA
WP_154320625.1\|1169827_1170790_+	DUF2184 domain-containing protein	M4SQD1	Psychrobacter_phage	1.4e-62	42.4
WP_154320626.1\|1170800_1171016_+	hypothetical protein	NA	NA	NA	NA
WP_154320627.1\|1171023_1171515_+	hypothetical protein	M4SN98	Psychrobacter_phage	6.3e-22	37.3
WP_154320628.1\|1171511_1171910_+	DUF1320 family protein	NA	NA	NA	NA
WP_154320629.1\|1171913_1172351_+	hypothetical protein	NA	NA	NA	NA
WP_171501103.1\|1172359_1172515_+	hypothetical protein	NA	NA	NA	NA
WP_154320630.1\|1172514_1173276_+	hypothetical protein	NA	NA	NA	NA
WP_154320631.1\|1173349_1173919_+	hypothetical protein	NA	NA	NA	NA
WP_154320632.1\|1173968_1174592_+	hypothetical protein	NA	NA	NA	NA
WP_154320633.1\|1174603_1174891_-	Arc family DNA-binding protein	Q76H48	Enterobacteria_phage	3.1e-05	38.4
WP_154320634.1\|1175002_1175164_+	Arc family DNA-binding protein	A0A0P0I460	Acinetobacter_phage	1.2e-06	49.1
WP_154320635.1\|1175240_1176206_+	KilA-N domain-containing protein	I6R977	Salmonella_phage	6.7e-44	44.4
WP_154320636.1\|1179387_1179789_+	hypothetical protein	NA	NA	NA	NA
WP_154320637.1\|1179788_1181759_+	hypothetical protein	A0A0M4U447	Ralstonia_phage	4.2e-93	34.7
WP_154320638.1\|1181770_1183387_+	hypothetical protein	A0A0M4U447	Ralstonia_phage	9.3e-115	40.4
WP_154320639.1\|1183439_1184708_+	hypothetical protein	NA	NA	NA	NA
WP_154320640.1\|1184707_1185004_+	hypothetical protein	NA	NA	NA	NA
WP_154320641.1\|1185000_1185387_+	hypothetical protein	NA	NA	NA	NA
WP_154320642.1\|1185404_1187483_+	hypothetical protein	NA	NA	NA	NA
WP_045796833.1\|1187475_1187706_+	hypothetical protein	NA	NA	NA	NA
WP_154320643.1\|1187768_1188032_+	hypothetical protein	NA	NA	NA	NA
WP_154320644.1\|1188015_1188522_+	glycoside hydrolase family protein	A0A0B5L5F7	Acinetobacter_phage	2.4e-56	63.1
WP_154321262.1\|1188518_1188893_+	hypothetical protein	NA	NA	NA	NA
WP_154320645.1\|1189087_1190299_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A0P0IRB7	Acinetobacter_phage	6.1e-119	53.6
WP_154320646.1\|1190746_1191013_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	1.8e-15	51.2
WP_154320647.1\|1190966_1191251_-	antitoxin	NA	NA	NA	NA
WP_154320648.1\|1191631_1192453_+	PhzF family phenazine biosynthesis isomerase	NA	NA	NA	NA
WP_154320649.1\|1192691_1195508_+	insulinase family protein	A0A2K9LA15	Tupanvirus	4.9e-18	28.5
WP_096901876.1\|1195604_1196669_-	amidohydrolase family protein	NA	NA	NA	NA
WP_154320650.1\|1196810_1197212_-	DUF3144 domain-containing protein	NA	NA	NA	NA
WP_154320651.1\|1197320_1197953_+	hypothetical protein	NA	NA	NA	NA
WP_154320652.1\|1198074_1199541_-	CHAD domain-containing protein	NA	NA	NA	NA
WP_154320653.1\|1199745_1201212_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_154320654.1\|1201721_1202105_+	DUF962 domain-containing protein	NA	NA	NA	NA
WP_096900945.1\|1202747_1203368_+	thiamine phosphate synthase	NA	NA	NA	NA
WP_154320655.1\|1203414_1204716_+	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
1204418:1204434	attR	NA	NA	NA	NA
WP_154320656.1\|1205202_1205847_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_154320657.1\|1205993_1208831_+	RNA polymerase-associated protein RapA	A0A1B1IUI1	uncultured_Mediterranean_phage	2.5e-22	39.1
WP_154320658.1\|1209050_1209873_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_154320659.1\|1209878_1210247_-	hypothetical protein	NA	NA	NA	NA
WP_171501104.1\|1210446_1211127_-	HTH-type transcriptional repressor FabR	NA	NA	NA	NA
WP_154320661.1\|1211281_1212352_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_096900933.1\|1212365_1213460_+	acyl-CoA desaturase	NA	NA	NA	NA
WP_085945815.1\|1213800_1214876_-\|transposase	IS3-like element ISAba20 family transposase	S5WIU1	Leptospira_phage	5.0e-48	40.2

DBSCAN-SWA_5

1961285 : 1966555

Acinetobacter_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_171062566.1\|1961285_1961861_+	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A0P0IKJ1	Acinetobacter_phage	1.4e-105	96.3
WP_096901041.1\|1961878_1962925_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.1e-164	86.5
WP_104853201.1\|1962946_1963753_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	4.3e-121	81.0
WP_104853200.1\|1963769_1964459_+	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	1.5e-85	72.9
WP_171062567.1\|1964552_1965101_+	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	5.8e-93	95.6
WP_104853199.1\|1965199_1966555_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.3e-20	40.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046043

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 5746

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004676219.1\|1659_1884_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_154320104.1\|2033_2279_+	hypothetical protein	NA	NA	NA	NA
WP_154320105.1\|3659_4643_-	RepB family plasmid replication initiator protein	A0A218MNI2	uncultured_virus	2.2e-42	38.8
WP_004897614.1\|5107_5746_+	AAA family ATPase	J9Q7R7	Salmonella_phage	1.2e-44	49.0

DBSCAN-SWA_2

14842 : 17594

Turbot_reddish_body_iridovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154320111.1\|14842_15406_+	macro domain-containing protein	E2CTW8	Turbot_reddish_body_iridovirus	1.5e-24	37.1
WP_023274838.1\|15533_15848_-	BrnA antitoxin family protein	NA	NA	NA	NA
WP_086384391.1\|15834_16122_-	BrnT family toxin	NA	NA	NA	NA
WP_016658833.1\|16609_16939_+	four-helix bundle copper-binding protein	NA	NA	NA	NA
WP_000246755.1\|17348_17594_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	A0A2H4JBG1	uncultured_Caudovirales_phage	1.9e-11	42.0

DBSCAN-SWA_3

24882 : 34473

Leptospira_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096902762.1\|24882_28023_+	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	1.2e-73	24.4
WP_005028603.1\|28109_29009_+	cation transporter	A0A1V0SED0	Indivirus	1.2e-10	31.5
WP_004993315.1\|29164_29812_+	recombinase family protein	A0A0A8WIK3	Clostridium_phage	2.6e-15	31.4
WP_004201167.1\|30247_30613_-	bleomycin binding protein Ble-MBL	NA	NA	NA	NA
WP_004201164.1\|30616_31429_-	subclass B1 metallo-beta-lactamase NDM-1	NA	NA	NA	NA
WP_004994718.1\|31529_32555_-\|transposase	IS30-like element ISAba125 family transposase	W5R8L2	Staphylococcus_phage	1.2e-51	38.1
WP_014386410.1\|32706_33486_-	APH(3')-VI family aminoglycoside O-phosphotransferase	E4ZFP6	Streptococcus_phage	6.9e-31	34.7
WP_001067855.1\|33768_34473_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0

DBSCAN-SWA_4

39070 : 42773

uncultured_Caudovirales_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154320115.1\|39070_40378_-	DUF4113 domain-containing protein	A0A2H4JBL5	uncultured_Caudovirales_phage	4.0e-156	60.7
WP_004871202.1\|40393_40972_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	3.6e-53	58.4
WP_154320116.1\|41225_42773_+	N-6 DNA methylase	A0A2H4PQP4	Staphylococcus_phage	5.0e-49	27.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP046044

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046044_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046044_1

70510-70637

Orphan

Consensus_repeat	Method
AGACCTCCCACCTTTGAGTGACAAACCTTCCACTTT	PILER-CR
GTGACAAACTTTCCACTTTACGGTGACA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP046044_1

>merge|NZ_CP046044|1|70510-70637|PILER-CR,CRISPRCasFinder
AGTGACAAACCTTCCACTCTTGTGACAAACTTTCCACTTTACGGTGACAGACCTCCCACCTTTGAGTGACAGACCTTCCACCTTTGAGTGACAGACCTTCCACCTTTGAGTGACAAACCTTCCACTTT

>NZ_CP046044|1|1|70510-70637|PILER-CR
AGTGACAAACCTTCCACTCTTGTGACAAACTTTCCACT	TTACGGTGACAGACCTCCCACCTTTGAGTG
ACAGACCTTCCACCTTTGAGTGACAGACCTTCCACCTT	TGAGTGA
CAAACCTTCCACTTT

>NZ_CP046044|1|1|70511-70602|CRISPRCasFinder
GTGACAAACCTTCCACTCTTGTGACAAA	CTTTCCACTTTACGGTGACAGACCTCCCACCTTTGA
GTGACAGACCTTCCACCTTTGAGTGACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046044.1\|WP_154320134.1\|53055_53718_-\|response-regulator	unknown	unknown	gnl\|CDD\|182612
NZ_CP046044.1\|WP_070153152.1\|61108_63379_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046044.1\|WP_104915058.1\|74738_75854_+\|restriction-endonuclease-subunit-S	unknown	unknown	gnl\|CDD\|341156
NZ_CP046044.1\|WP_154320138.1\|80766_81291_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046044.1\|WP_004974304.1\|53790_55098_-\|TolC-family-protein	unknown	unknown	gnl\|CDD\|224455
NZ_CP046044.1\|WP_070153126.1\|76471_76948_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046044.1\|WP_154320136.1\|73194_74742_+\|N-6-DNA-methylase	unknown	unknown	gnl\|CDD\|223363
NZ_CP046044.1\|WP_004974301.1\|55097_55421_-\|DUF3240-family-protein	unknown	unknown	gnl\|CDD\|338041
NZ_CP046044.1\|WP_070153138.1\|72688_72967_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046044.1\|WP_167846516.1\|75909_76443_+\|DUF2939-domain-containing-protein	unknown	unknown	gnl\|CDD\|378575
NZ_CP046044.1\|WP_094069344.1\|70884_71658_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379293
NZ_CP046044.1\|WP_094069347.1\|68856_70029_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP046044.1\|WP_094069346.1\|60417_61122_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046044.1\|WP_004974307.1\|51690_53055_-\|sensor-histidine-kinase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|182388
NZ_CP046044.1\|WP_154320139.1\|81722_82127_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046044.1\|WP_154320135.1\|63362_66551_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|334163
NZ_CP046044.1\|WP_004974298.1\|55413_58497_-\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|226220
NZ_CP046044.1\|WP_167846494.1\|77023_80272_+\|HsdR-family-type-I-site-specific-deoxyribonuclease	unknown	unknown	gnl\|CDD\|223683
NZ_CP046044.1\|WP_070153141.1\|71671_72583_+\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|319251
NZ_CP046044.1\|WP_004974297.1\|58507_59731_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273386

Protein	Function_ID	Function_description	E-value
NZ_CP046044.1\|WP_154320134.1\|53055_53718_-\|response-regulator	gnl\|CDD\|182612	PRK10643, PRK10643, two-component system response regulator PmrA.	3.72518e-79
NZ_CP046044.1\|WP_154320136.1\|73194_74742_+\|N-6-DNA-methylase	gnl\|CDD\|223363	COG0286, HsdM, Type I restriction-modification system methyltransferase subunit [Defense mechanisms].	1.93808e-139
NZ_CP046044.1\|WP_004974304.1\|53790_55098_-\|TolC-family-protein	gnl\|CDD\|224455	COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion].	3.22878e-09
NZ_CP046044.1\|WP_004974301.1\|55097_55421_-\|DUF3240-family-protein	gnl\|CDD\|338041	pfam11582, DUF3240, Protein of unknown function (DUF3240). This family of proteins with unknown function appears to be restricted to Proteobacteria.	4.21651e-14
NZ_CP046044.1\|WP_104915058.1\|74738_75854_+\|restriction-endonuclease-subunit-S	gnl\|CDD\|341156	cd17267, RMtype1_S_EcoAO83I-TRD1-CR1_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to S.EcoAO83I TRD1-CR1 and S.AbaB8342I TRD2-CR2. Escherichia coli strain A0 34/86 S subunit (S.EcoAO83I) recognizes 5'... GGANNNNNNNNATGC ... 3, and Acinetobacter baumannii B8342 S subunit (S.AbaB8342I) recognizes 5'... TTCANNNNNNTCC ... 3. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. For example S.AbaB8342I-TRD1 recognizes TTCA/TGAA and S.AbaB8342I-TRD2 recognizes GGA/TCC. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It also includes TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases such as Type IIG restriction enzyme/N6-adenine DNA methyltransferases from Thermus scotoductus RFL1 (RM.TstI) and Acinetobacter lwoffi Ks 4-8 (RM.AloI), as well as type I DNA methyltransferases such as Sideroxydans lithotrophicus ES-1 Type I N6-adenine DNA methyltransferase (M.SliESORF1090P). RM.TstI recognizes 5' ... CACNNNNNNTCC ... 3' and RM.AloI recognizes 5' ... GAACNNNNNNTCC ... 3'.	1.10154e-87
NZ_CP046044.1\|WP_167846516.1\|75909_76443_+\|DUF2939-domain-containing-protein	gnl\|CDD\|378575	pfam11159, DUF2939, Protein of unknown function (DUF2939). This bacterial family of proteins has no known function.	3.33211e-33
NZ_CP046044.1\|WP_094069344.1\|70884_71658_+\|AAA-family-ATPase	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	9.59946e-51
NZ_CP046044.1\|WP_004974298.1\|55413_58497_-\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|226220	COG3696, COG3696, Putative silver efflux pump [Inorganic ion transport and metabolism].	0
NZ_CP046044.1\|WP_004974307.1\|51690_53055_-\|sensor-histidine-kinase-N-terminal-domain-containing-protein	gnl\|CDD\|182388	PRK10337, PRK10337, sensor protein QseC; Provisional.	6.16274e-61
NZ_CP046044.1\|WP_154320135.1\|63362_66551_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|334163	pfam00589, Phage_integrase, Phage integrase family. Members of this family cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment. The catalytic site residues in CRE recombinase are Arg-173, His-289, Arg-292 and Tyr-324.	7.47977e-10
NZ_CP046044.1\|WP_094069347.1\|68856_70029_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	7.57315e-28
NZ_CP046044.1\|WP_167846494.1\|77023_80272_+\|HsdR-family-type-I-site-specific-deoxyribonuclease	gnl\|CDD\|223683	COG0610, COG0610, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms].	0
NZ_CP046044.1\|WP_070153141.1\|71671_72583_+\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|319251	cd16393, SPO0J_N, Thermus thermophilus stage 0 sporulation protein J-like N-terminal domain, ParB family member. Spo0J (stage 0 sporulation protein J) is a ParB family member, a critical component of the ParABS-type bacterial chromosome segregation system. The Spo0J N-terminal region acts in protein-protein interaction and is adjacent to the DNA-binding domain that binds to parS sites. Two Spo0J bind per parS site, and Spo0J interacts with neighbors via the N-terminal domain to form oligomers via an Arginine-rich patch (RRXR). This superfamily represents the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.	4.79715e-39
NZ_CP046044.1\|WP_004974297.1\|58507_59731_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273386	TIGR00999, Nickel-cobalt-cadmium_resistance_protein_NccB, Membrane Fusion Protein cluster 2 (function with RND porters). [Transport and binding proteins, Other].	2.05478e-22

>NZ_CP046044.1|WP_094069347.1|68856_70029_-|replication-initiation-protein
MTESESLQEELNHIPYCIGNIRHNGVVSTSNRLIRPIELSANEYKALLYAMAVANYSEKNRVNGEITEQTYIYLYKDDLADLLGLNKRNSINVAIDRIYKELSSRVAHFIIEEPTDDGKRKTKKVHSVVPIIRELRWEDDSKNAIQIRFTSEVLPYFTQLAGGNFTTYQLKHLFALDSVASMSLYTYFIKNEFKYASQKSYEVPMLLENLKALIDINETKYDRWVDFRRYVLDKIVAEINENTDLQLEYETIKKGRPIVGVNFKLHQRITDKTLNETAVIEKIYLDVPFEENALVKELGAKFDTNVRSWYIFNNDEKYSQFKKWFKKIGCLTDSQANIVINDTLFQMDFAEVGMSLNDFKRNMKHKLKNNPEFVQSIRDRLNDIFGKELV
>NZ_CP046044.1|WP_154320135.1|63362_66551_+|tyrosine-type-recombinase/integrase
MSSSLKKADQLFAEKKRELTRQLNEQKIQNEVHASLRKYFSEQQFDQNPHLLGDYGEVYSHIKKNSTSKKWIKFAYDFFEDYIKELNAQHRLDLELPHAVLDIKRDKPIVTMSWNADGHEINDLVQQLYNYWELAESCDSFSNEEIVGNIILSAILFGGLNEKAELNALLEHLRNPVKVRHYKDLNILFLESHSNHYGDIFIDEYTVRKSRNFIPDPVTRLWLIHFNLRDIRHVHLPVEGYLEYIFRKIKKKFKKNSLSHLLQHARYNWLQLPNVDIDPALSECLIGNLLSCGLPEQEFERFVQPKFKYKHELTTEVIHQSKNLPPQTVYLHHEQDALKDVLKIHKDLLKIIRLRQTDAPIYQLMIDYCMENAKLFNEYSKRITLWLISLFKPPQEDIDLLAQRFDFCATIFAKIISNNSQLAKSSIYTYYTRIGEPWLIYSLQYQFSEDDEETRLQKIYAQIYQNNCIAESLLEDTVKKSAAQIVKTLKRFHQFQEQLFDAPAFTLETLDQQTRPRTRIISPVTFQLLIKKLQQAHLQNIISQHDYENLSLIYTLAYRTGMRINEMIGLRIKDTEGLNRISLLVKPYGSEKIGNEHRLKTDSAQRSVPVYCLLKASEYQQFHQYVVKQRLTKKPNDYLFSQFNENKKLSQHMLTAPFKNFMDQLFKQHHYTFHSFRHSAANHLALIFKCDYHFLSDSLTDYTEVEYNQLRAELLRNSIDQNHWIIIAHLLGHLEPIETFKSYIHVAYFIAGYQFSKYRPLLSNGLVKKMLGISNSTQELHFLKSLNDQSEFNFEMHATTLCKLLLNNQEKWIASNAHTLHAELEVNQTQEHCIFDYFVATPESKIDLDLFYKALCLLELYKYDTERVAQELCLSHELIKYWYDNAIQLKQLKSRKNNPRLFHITELQYIKPSMIDTNEDLLLVTHFFNYLQACYQKSPENIRYVLEFFINHVTASHTGLHSTRKNIQNLEKFYYAAKDLFPANMWHLLGIDMVNFLNKEITPNLLKLAKANQKLEGYPTTKENNARLQLYSLKQGKALPAFKFCLHLACIGRPAQLQLEIK
>NZ_CP046044.1|WP_070153152.1|61108_63379_+|hypothetical-protein
MHESETKPLPQPKILLSDLLKKLFNAEDLCLHAHINFIADLLVYHDCSDYLKGLVLSEIESDISTSSPPRIPATLQASRKSKIGDSPITYYINSIASIYHAHTELLTWNVLVLKAALYLLALPQIKPDLFEKQHTEHLNTIKRLFQRFRVANKSFFAKKKDAHALDYQAFLTLKFPALFLSLEQFVESALQPEADQELNDFQKNFCDELRIAFNYVLKSRPKIAKSSVDSKLQYRTWDTDGTINEIIETKKSNRGLANEQALDEQEDPSVIVQADQITPLARHSKNAQRMALSLIPKHMQRQDHLLTASCLLPSVYTISDLITYLYHDDKKHNDKSVLVVLLCLITGVGFKDWLNFQKRRVKRLNHRQVIKLQSDQYYLSTKFSIFEDATFEYPESLINNTVHLDIPIPNHFIDRIKAEPIITEDELKKKIRIIKDEVKIPQLNLSKTSSLLHHVILQKTGNRQLADIITGVDASHSSSSSYCHYNVNKLQKNYVKVLSELCTQLAENDYGDIVYSDQSICFGSQKAPSKNVIKDILFYLYTKIYTTSDNDWVESFNAYSIWMWHILLLFTAARPVRDFPGFLNNISFQQQTIMLSDKEVGGRRGFGRLIPLCAFLIGELKKYLRFLEHIQQHYMAINREISAQIDAIFNNEQPLLNLLQNGTLTPLTPSNVRDFHPEVGLAHPNWHRHTTRAFLTNKQIPEPLILALFGHEAFQQEAAHPFSSLSLNQYRALATHLNEMQEYFEIIGVNLNVLIA
>NZ_CP046044.1|WP_094069346.1|60417_61122_+|hypothetical-protein
MCRGTRKQVTSECSFNFDNPKIIFKRDLSKLALNTHPDFAGIHHCYHMAFRALRLTSHFRLASNKLNVWSIAGISNFWIADNFDLYLHHMKLPPSPQELHVYTFPPDANLQQQLKHYASFEFLSFLQANTFDIHNLNPQHLQQAINRYISTEVLLDFNRLHSFKAHKTLSLEGLGKLLNFSHTQLHNRNRKIHARRQHLLDEVSKQSKVVDHYLNQNDFSPNPTDFWNCSYARK
>NZ_CP046044.1|WP_004974297.1|58507_59731_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MDQRVDVLNFKKLLYLMSVLILISLGLWWGSKLLSNKNIEAKVERQVSEAERSPEVSEQQILISSKQIEQVGIKLHTLGASSTNIQKQIILQGQVQWSPESKVVLTSPVSGMVQQVLVQPLAEVTRNHHVLAVHSPDLIQIQNEILQLRAQQQLAQQNLTRERSLYAEGIIAEKRVQEAQNQVQRLNINLGAKQRMLQFMGGGQVNSLNSIVYVKSPTSGYIENLQVSTGQYVEAGTVLGQLVNADSPLQLLLQANLADSKYVHIGDVVQVEGCDITGHIQNIAPALVGNTQTQNIIVQMDTKHNCLRVQQFVKVHVQSKQPTVIAAWPVPSTAITSQDGKHIIFVKNQKGFEAVTVEVLSADQQQSYITAEKLKPKMQLAISGVERLKAVWSGFGAEQAPISTTER
>NZ_CP046044.1|WP_004974298.1|55413_58497_-|efflux-RND-transporter-permease-subunit
MLKRLIAFSLSQRILILLLTLAISVAGYIAFTKLPIDAFPDVSSTQVQIVMKSPGMTPEEVESRIVVPIEQEMLGISHQTVMRSQSKYAIAIITLDFAEGTDPYWARQQVNERLSNVMSALPSSTSGGIAPMTTPLGESFMFTLHGPLSDMEKRTLLDRVVRPQLRKIEGVADVNALGGLVRTFEVTPNLEALAARGLSLTQLQQAIELNNASDGAGRLNENGESLLIRSDSRVRNLEELGDIIVSSHQGTLVRVKDVAQVHTGALTRYGAVTENGQGEAVQGIVLTLKGANARQVVQHVREHLSDIEKTLPQGTTIEPFYDRGELVNRAIHTVSKTLLEAIVLVLILLLLFLGNLRSALVVAAVLPLSALSTFLMMHHFGLSANLMSLGGLTIAIGLLVDAAVVVVENIEMQLAEAKESPQRSFLPPLNMIYRAVSEVAVPVTAGMIIIMLVFIPLVTLEGLEGKLFSPVALTIVFALSSSLIFSLTVIPVLCSFFLKPKAHHTPFLVAKLETGYRKLLNLSLAHPKQIYVLAGGTLLLAALIFPFIGKSFMPTMDEGDTILQLEKIPSISLQNSIALDLDIQKRILEQVPEVERIVARTGSDELGLDPMGLNETDSFIVLKPQTQWQVKNKEQILEKIRLVLQDVPGVNLTFSQPIEMRTSEMLSGVRGDLAVKIFGSDLDQLNDLSKQIAIVLQGIEGNEDVMTLENSGVQYQELRIHRDMAIRNQLDSQNVQAQLKMLVEGKEIGSIIEQGRPVPLMMKGDPRLGESSFEFSNIALPIENAAAVPLLSLAEVVKTEGVVKIDRENASRMSVVRANVRDRDLVSFVDEAKQLVAEKVKLPTGYSLKWGGQFENQQRAAARLMLVVPAALTMIFFLLFTTLGSVRQAVLVFVNIPFALVGGVFALALTGEYLSVPASVGFIALMGIAVLNGLVMISYFNQLISRGVAIEEVVREGAMRRLRPVMMTASIAALGLIPLLFTTGPGAEIQRPLAIVVIGGLISCTLLTLILLPNLFKKFGLARDHHV
>NZ_CP046044.1|WP_004974301.1|55097_55421_-|DUF3240-family-protein
MSEICQLSINVSSDIAEELMEHLWLIPELISGCTCVNAQGFGNRQHYRNVQEKIRGATERNLILLIVQHESVSLVLAHIQQKFKSSDCFYWVIPTLISGYMSQGALD
>NZ_CP046044.1|WP_004974304.1|53790_55098_-|TolC-family-protein
MTLNIKFKSTLLGQIWYLFGLGYCFTVASTAIAKPQLEAALPPLEAVQQSLVEHPNVRAAISEQDYADFARQGLKVGQNPWTVTAGMQVRKTDTQLERKQANSYEPSLGIEKQIRLPNKYRLDQDLAQRISSIAELKYENAQHQASKMLLNSWFAYMRSTLHLKRLQEQLDQIQQFIQVTEQRIRAGDAPRLELMLLKNEYQQLEEQYMQAKAAYIQAQQLLARDYRGKIPEQWSSDVIQPSPIQYSQAEWVQKILSVNHELALVRMQATQQYAVLKREQLNRLPDPTIGFGYSREQSGEENLLGVSVSIPLTARQVGIASGMAAAEAKKADLEVLRVEKRLRQEIQGWVIQMESATVRNTKAQENLQLLQQQHHLMQKAYKLGELNLNELLLHSQQLIEARSRVDQAKVDYAESMSSLLLDSHQLWPLHEMDRI
>NZ_CP046044.1|WP_154320134.1|53055_53718_-|response-regulator
MRVLLVEDDSLLAKATARGLDQMGFVVDIASTAEQAYHFLVSYHYHFILLDLGLPDRNGIEILKSLRRKKNQVGIIILTAQDQVDDRITGLEAGADDFVVKPYDLHEVVARIHAVLRRISGEVGDLIQVGNISINKASKQVLLNQVEIELTHKEFHLLELFTLNRGRVISRENIENSFYAYDVDVSSNVVQVHIHNLRRKLGKNIIRTVQGFGYIMDEQH
>NZ_CP046044.1|WP_004974307.1|51690_53055_-|sensor-histidine-kinase-N-terminal-domain-containing-protein
MADPIRSYSLTQRLSIILLAITTSVWLGSLGSIYWGMQNTANNIFDKSLAETAHALLSTTLSTLDGKVPQHTVIEKAKGEHYDQIVFQIWHRDGQLIYRSIGVETQPFVQQDNFGWIKLNNNTYRSYSVWDSTHTIQVQIAQVWTIRKDIQQDMLLFLILVSIIFLPLLLWLIICTIRRHLLAVYSISQNLEKQSIEHLNPIKPVVPKEIEPLVSSLNTLLSEIAESMQREKRFTSNAAHELRTPLAAIRLHAQVLQNARSNEESKEAAQDIITGVDKASRMITQLLTLARLEPNATQNKSNIDLVDIVKGTVEMMGIQFRKAGVDLQLHLTSVCVWGQSDQLEIMLRNILENAILYRSSIHKPIIKVSCGSIGNGSFIQVEDNGIGLDEAQIPFIFQRFYRINQASSVVGSGLGLSIVKQIIDSHLGKITLQRANAVGGLIVRIEFFKKLNIY
>NZ_CP046044.1|WP_094069344.1|70884_71658_+|AAA-family-ATPase
MSAKIITVANHKGGCGKTTTVVHLASELANLGNKVLVIDLDPQANASLHIGIQHPSEIVVTSAELLVGDISLLADALQEETNFEKVSLIYGSLNLGKTEDQLKEEAPRPSEELSIKLELLKDLYDFILIDCPPSLKLLTSNALASSTHVIIPIESGSQYGLYGVTDLLNHLEKIKRINPDLELLGALLIKHDERQNVCKLIRDEALKQVGKILQTTIPQSTKVNQAAILQQPLLKVEKNSKVRKAFESLAYEIVAKV
>NZ_CP046044.1|WP_070153141.1|71671_72583_+|ParB/RepB/Spo0J-family-partition-protein
MASTKELLAQKLKQNTEKHQQAQKDNIKELKEFRRNVPIEDISRSPNQPRKVFEDSQLKELADSINEIGLLQPITVRKLDNLKYELIAGERRLRAHQLLGKSVIEAIIIDANDEEASLLTLAENLKRQDLTDYEIFIGLNSLDEKLKKNKQRLANSLGLNREDMYKYLSYEKLPKAMLNDLDLEPGLVGRTAATAFKKFLSDHIEQLSEAETALLGAWEKLKEKKLEQSKVTSYAEKLLSQDPEKVTTTSVVRKIEYDGKVAGNIKLNQKQLNISLKISEIDEASLLQLEDFLKQLIQKSEKV
>NZ_CP046044.1|WP_070153138.1|72688_72967_+|hypothetical-protein
MVTLEEFIPKNYLIRKIDKAIDLNIIHERVAHLYCPDKETVERILPLQNNYRVSVMQVTQQCLLSVTAQNLKKIALHLSKLIFIVFFSHQYA
>NZ_CP046044.1|WP_154320136.1|73194_74742_+|N-6-DNA-methylase
MARTPKQTKQEPIEVILWKAADKLRKNIDAAEYKHVVLGLIFLKYISDSFEAHYNLLVEGEGEFAGADPEDRDEYTAYNVFFVPEIARWSYLLNQAKQVTIGKIVDDAMEAIENENPQLKGVLPKVYARQNLDPTSLGELIDLIGNIALGDAKDRSADVLGHVFEYFLGEFALAEGKQGGQFYTPKSIVSLLVEMLEPYKGRVFDPCCGSGGMFVQSEKFVESHQGLVDDISIYGQESNQTTWRLAKMNLAIRGINSEHVKWNSEGSFLNDAHKDLKADYIIANPPFNVSDWSGEQLVGDARWSLGTPPAGNANFAWMQHFLYHMSPKGQAGVVLAKGALTSKTSGEGEIRKALVSEANVIDCIVNLPAKLFLNTQIPAALWFMRRDRVNSSQYQDRSNEILFIDARNLGHLINRRTKVLSDEDIKLITDTYHNWRNKGGEYEDVAGFCASVPLEKVAELDYVLTPGRYVGLADDEDEFDFKVRFTSLKAEFEAQLAEEAKLNQAIAENLAKVVV
>NZ_CP046044.1|WP_104915058.1|74738_75854_+|restriction-endonuclease-subunit-S
MSEWQVGRLDSFFTLKRGYDLPKQSRVSGSVPIIASSGFADFHNEAKVNESGVVTGRYGTIGSVFFSDVPFWPLNTSLYVNDFKGNDKKFIYYFLQTLDWEKFSDKSAVPGVNRNDVHQEEICFPSLPEQKAIASILSSLDDKIDLLHCQNKTLEAMAETLFRQWFIEEAKEDWDDLLVSDIATHIKDNVNPSKDPLKTYYHFSLPAFDSGEKPTIELGAEILSNKYRVCENSILVSKLNPRVPRIWLLTDVKDNYVCSTEFQNLKPKVGSHLMFLYSLFNSRDVIDELAMSASGTSGSHQRVKPEDMLNISFKTPSLDYLEEYSLLITPSMQKVSSNKKQIQTLEQLRDTLLPKLMSGEVRVQYQTEEVA
>NZ_CP046044.1|WP_167846516.1|75909_76443_+|DUF2939-domain-containing-protein
MNKKIIGAIIALVVVICGYLYASPYIAINNIKNAAQVGDSEKVSKYIDYPSVRQSFKDQMNAMMMKEMATHKDDGFAALGAMLASTMVDKMIDGFVTPEGMTMMMQGKDLKDAAHSSQGASTTETKEEDQAEYKTRYTSFSDFEVVIQHPNDSKAVTVKMVRDGLSWKVNKIAVPMD
>NZ_CP046044.1|WP_070153126.1|76471_76948_+|hypothetical-protein
MIKRMIQMGFGLIAVVSFAATVQAAPAKFNHSGIQKGKVIETCYHSPCSVAKFVSYKQLNKTATESKIQVTLLGGSREWEAKKIDWNRSPHKVTVNCSYQRPTVQIGSQKTLIPLNDGLGVPGVLMVDAELYLYVCHKFEGAIENAVQKYGYNVQDDE
>NZ_CP046044.1|WP_167846494.1|77023_80272_+|HsdR-family-type-I-site-specific-deoxyribonuclease
MTKMTESDIELMAIEQLEGLGYTYVYGPEIESKGTNPLRSYKQVILEDKVLDALQRLNPHLSQDKCTEALKQVTNIQSPDLLSNNQAFHRLLTEGINIEVSKEGNTQGEYAWLIDFENPTNNEFLVVNQVTIKEDRWTRRPDIILYVNGLPLVVIELKNATDENATVEGAYKQIQTYQSQIPSLFTYNAFNVISDGLEAKAGTVSADYSRYMAWKTNNGQTKAKKTQAQLEVLIHGLLNPVTLLDMIRHFIVYESTKHEDTNGLITIKTIKKMAAYHQYYAVNAAVLSTIRASAVNSDSKSAEVAMQHQGRSKLELVQQQAVGDKKAGVVWHTQGSGKSLSMVFYTGKIVLALDNPTVVVITDRNDLDDQLFGTFAASSQLLRQTPRQADSREELKELLKVGSGGVIFTTIQKFQPDDGTSVYEQLSDRTNIVVIADEAHRSQYGFNAKEVDVKDEDGKVVGKRTVYGFAKYMRDALPNATYLGFTGTPIEKTDVNTPAVFGNYVDIYDISQAVEDGATVRIFYESRLAKIAISEEGKELIEDFDDQFTEDDLNQTQKERAKWARVEGLIGSKERIKAIAKDIVEHFEQRLKANANQGKGMIVSMSRRIAVDLYNEIVKIKPEWHSDDLNDGVIKVVMTASASDGEVIAKHHTTKQQRQRLADRMKDNDDKLKLVIVRDMWLTGFDAPSMHTLYIDKPMKGHNLMQAIARVNRVYKDKAGGLVVDYLGIASDLKEALSFYSEAGGKGDPALVQDEAATILQEKLEVLDGILHGFNYQEYFTADTSRKLNIILEAEEHILGVDQGEGKTRFLTAVTAMSQAFALAVPHPHAMEAAPVVAFFQAVKARLAKFSDGTGKISGLSNAELEAKVKQTIDQALVTEQVVDIFDAAGIQKPDISILSDEFMQEMKDYKHKNIALETLKKLLGDEIKVREQRSVTQGKKLMDMLISAIKGYQNKVLTAAEVIDELIKLAKTIQESDKLAEELNLTEYEYAFYSAVADNDSARELMQKDILRELAVVLTDSIRKNVTLDWTIKEAARAKLRVIVKRLLKKYGYPPDMALLATETVLEQAEQLAEELSSSKE
>NZ_CP046044.1|WP_154320138.1|80766_81291_+|hypothetical-protein
MKKLVILLSMSTVFLSACGNKHDKMVGYWQLENVQGKRIMQIFKEGKDSYILKENVVARSNVVNGKEGSSLVLEKKDDTLAVNNGLAAMPLHLSDDGQTLRISKNQYKKVDENFVNKTIENIKVCHEIETEYRTKVKELPIFTRDPAIQEQRKTLAESTTKKMQAIEDCKFGIY
>NZ_CP046044.1|WP_154320139.1|81722_82127_+|hypothetical-protein
MMNRVFDWYMQLPLEWQSSLFVYRGHGANIKTVVKLLEQVSDNCLLAFYGDLDPYGINIASHFYKIRPLALIVPSIWQEITVTHIDNNVNKFLKQIVQTRDIAFDQAEPLILRELFHHVDPSQNNGQYFPLKIT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP038501	Acinetobacter baumannii strain CIAT758 plasmid unnamed1, complete sequence	45233-45262	0	1.0
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP046044	Acinetobacter towneri strain 19110F47 plasmid p19110F47-2, complete sequence	70528-70557	0	1.0
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP048015	Acinetobacter towneri strain 205 plasmid pAT205, complete sequence	151065-151094	0	1.0
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP046044	Acinetobacter towneri strain 19110F47 plasmid p19110F47-2, complete sequence	70539-70574	0	1.0
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP048015	Acinetobacter towneri strain 205 plasmid pAT205, complete sequence	151076-151111	0	1.0
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP038501	Acinetobacter baumannii strain CIAT758 plasmid unnamed1, complete sequence	45216-45251	1	0.972
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP026749	Acinetobacter baumannii strain WCHAB005133 plasmid pOXA58_005133, complete sequence	17551-17580	2	0.933
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP051863	Acinetobacter baumannii strain Ab-C102 plasmid pAb-C102_1, complete sequence	59457-59486	3	0.9
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP051867	Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_1, complete sequence	73318-73347	3	0.9
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP026749	Acinetobacter baumannii strain WCHAB005133 plasmid pOXA58_005133, complete sequence	17534-17569	3	0.917
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP051863	Acinetobacter baumannii strain Ab-C102 plasmid pAb-C102_1, complete sequence	59402-59437	3	0.917
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP038501	Acinetobacter baumannii strain CIAT758 plasmid unnamed1, complete sequence	45145-45174	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP046044	Acinetobacter towneri strain 19110F47 plasmid p19110F47-2, complete sequence	70616-70645	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP048015	Acinetobacter towneri strain 205 plasmid pAT205, complete sequence	151153-151182	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP026749	Acinetobacter baumannii strain WCHAB005133 plasmid pOXA58_005133, complete sequence	17463-17492	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP042995	Acinetobacter nosocomialis strain J1A plasmid unnamed1, complete sequence	65164-65193	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_KX426232	Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence	118973-119002	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	CP033573	Acinetobacter nosocomialis strain 2010N17-248 plasmid p2010N17-248, complete sequence	13622-13651	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP026129	Acinetobacter baumannii strain ABNIH28 plasmid pABA-2f10, complete sequence	47485-47514	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP030755	Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence	192215-192244	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP015616	Acinetobacter schindleri strain ACE plasmid p1AsACE, complete sequence	177494-177523	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP012956	Acinetobacter baumannii strain D36 plasmid pD36-4 clone GC1, complete sequence	46841-46870	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP051209	Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence	116987-117016	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP032112	Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence	22556-22585	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP032102	Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence	148695-148724	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP045132	Acinetobacter indicus strain TQ18 plasmid p18TQ-X3, complete sequence	28228-28257	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP033769	Acinetobacter baumannii strain FDAARGOS_533 plasmid unnamed1, complete sequence	29735-29764	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP042558	Acinetobacter baumannii strain E47 plasmid pE47_002, complete sequence	33103-33132	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP010358	Acinetobacter johnsonii XBB1 plasmid pXBB1-8, complete sequence	13199-13228	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP040912	Acinetobacter pittii strain AB17H194 plasmid pAB17H194-1, complete sequence	74372-74401	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	CP042210	Acinetobacter baumannii strain DS002 plasmid pTS134338, complete sequence	107036-107065	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP039146	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-3, complete sequence	73231-73260	4	0.867
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP038263	Acinetobacter baumannii strain LEV1449/17Ec plasmid pEC_gr13, complete sequence	29239-29268	4	0.867
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP051863	Acinetobacter baumannii strain Ab-C102 plasmid pAb-C102_1, complete sequence	59468-59503	4	0.889
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_KX426232	Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence	118956-118991	4	0.889
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP030755	Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence	192198-192233	4	0.889
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP012956	Acinetobacter baumannii strain D36 plasmid pD36-4 clone GC1, complete sequence	46824-46859	4	0.889
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP032112	Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence	22539-22574	4	0.889
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP032102	Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence	148678-148713	4	0.889
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP051209	Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence	116998-117033	4	0.889
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP051867	Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_1, complete sequence	73329-73364	4	0.889
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP051863	Acinetobacter baumannii strain Ab-C102 plasmid pAb-C102_1, complete sequence	59391-59420	5	0.833
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_KX426232	Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence	118995-119024	5	0.833
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_KX426232	Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence	119039-119068	5	0.833
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP030755	Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence	192237-192266	5	0.833
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP030755	Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence	192281-192310	5	0.833
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP051209	Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence	116921-116950	5	0.833
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP051209	Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence	116965-116994	5	0.833
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP032112	Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence	22578-22607	5	0.833
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP032112	Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence	22622-22651	5	0.833
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP032102	Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence	148717-148746	5	0.833
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP032102	Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence	148761-148790	5	0.833
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP044019	Acinetobacter indicus strain HY20 plasmid pAI01, complete sequence	75573-75602	5	0.833
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP038259	Acinetobacter baumannii strain 39741 plasmid pEH_gr13, complete sequence	19007-19036	5	0.833
NZ_CP046044_1	1.1\|70548\|30\|NZ_CP046044\|PILER-CR	70548-70577	30	NZ_CP038259	Acinetobacter baumannii strain 39741 plasmid pEH_gr13, complete sequence	19029-19058	5	0.833
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_KX426232	Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence	119022-119057	5	0.861
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP030755	Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence	192264-192299	5	0.861
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP032112	Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence	22605-22640	5	0.861
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP032102	Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence	148744-148779	5	0.861
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP051209	Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence	116932-116967	5	0.861
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP045132	Acinetobacter indicus strain TQ18 plasmid p18TQ-X3, complete sequence	28211-28246	5	0.861
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP039146	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-3, complete sequence	73214-73249	5	0.861
NZ_CP046044_1	1.3\|70539\|36\|NZ_CP046044\|CRISPRCasFinder	70539-70574	36	NZ_CP040912	Acinetobacter pittii strain AB17H194 plasmid pAB17H194-1, complete sequence	74383-74418	5	0.861

1. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP038501 (Acinetobacter baumannii strain CIAT758 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cttgtgacaaactttccactttacggtgac	CRISPR spacer
cttgtgacaaactttccactttacggtgac	Protospacer
******************************

2. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP046044 (Acinetobacter towneri strain 19110F47 plasmid p19110F47-2, complete sequence) position: , mismatch: 0, identity: 1.0

cttgtgacaaactttccactttacggtgac	CRISPR spacer
cttgtgacaaactttccactttacggtgac	Protospacer
******************************

3. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP048015 (Acinetobacter towneri strain 205 plasmid pAT205, complete sequence) position: , mismatch: 0, identity: 1.0

cttgtgacaaactttccactttacggtgac	CRISPR spacer
cttgtgacaaactttccactttacggtgac	Protospacer
******************************

4. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP046044 (Acinetobacter towneri strain 19110F47 plasmid p19110F47-2, complete sequence) position: , mismatch: 0, identity: 1.0

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ctttccactttacggtgacagacctcccacctttga	Protospacer
************************************

5. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP048015 (Acinetobacter towneri strain 205 plasmid pAT205, complete sequence) position: , mismatch: 0, identity: 1.0

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ctttccactttacggtgacagacctcccacctttga	Protospacer
************************************

6. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP038501 (Acinetobacter baumannii strain CIAT758 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.972

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ctttccactttacggtgacagaccttccacctttga	Protospacer
*************************.**********

7. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP026749 (Acinetobacter baumannii strain WCHAB005133 plasmid pOXA58_005133, complete sequence) position: , mismatch: 2, identity: 0.933

cttgtgacaaactttccactttacggtgac	CRISPR spacer
cttgtgacagaccttccactttacggtgac	Protospacer
*********.**.*****************

8. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP051863 (Acinetobacter baumannii strain Ab-C102 plasmid pAb-C102_1, complete sequence) position: , mismatch: 3, identity: 0.9

cttgtgacaaactttccactttacggtgac	CRISPR spacer
actgtgacaaaccttccactttacggtgac	Protospacer
 .**********.*****************

9. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP051867 (Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_1, complete sequence) position: , mismatch: 3, identity: 0.9

cttgtgacaaactttccactttacggtgac	CRISPR spacer
actgtgacaaaccttccactttacggtgac	Protospacer
 .**********.*****************

10. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP026749 (Acinetobacter baumannii strain WCHAB005133 plasmid pOXA58_005133, complete sequence) position: , mismatch: 3, identity: 0.917

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacagaccctccacctttga	Protospacer
*.**********************..**********

11. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP051863 (Acinetobacter baumannii strain Ab-C102 plasmid pAb-C102_1, complete sequence) position: , mismatch: 3, identity: 0.917

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccaccttaga	Protospacer
*.***********************.******* **

12. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP038501 (Acinetobacter baumannii strain CIAT758 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
tgagtgacaaaccttccactttacggtgac	Protospacer
.  *********.*****************

13. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP046044 (Acinetobacter towneri strain 19110F47 plasmid p19110F47-2, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
tgagtgacaaaccttccactttacggtgac	Protospacer
.  *********.*****************

14. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP048015 (Acinetobacter towneri strain 205 plasmid pAT205, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
tgagtgacaaaccttccactttacggtgac	Protospacer
.  *********.*****************

15. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP026749 (Acinetobacter baumannii strain WCHAB005133 plasmid pOXA58_005133, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
tgagtgacaaaccttccactttacggtgac	Protospacer
.  *********.*****************

16. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP042995 (Acinetobacter nosocomialis strain J1A plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
tgagtgacaaaccttccactttacggtgac	Protospacer
.  *********.*****************

17. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_KX426232 (Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acggtgacaaaccttccactttacggtgac	Protospacer
 . *********.*****************

18. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to CP033573 (Acinetobacter nosocomialis strain 2010N17-248 plasmid p2010N17-248, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
tgagtgacaaaccttccactttacggtgac	Protospacer
.  *********.*****************

19. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP026129 (Acinetobacter baumannii strain ABNIH28 plasmid pABA-2f10, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
tgagtgacaaaccttccactttacggtgac	Protospacer
.  *********.*****************

20. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP030755 (Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acggtgacaaaccttccactttacggtgac	Protospacer
 . *********.*****************

21. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP015616 (Acinetobacter schindleri strain ACE plasmid p1AsACE, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acggtgacaaaccttccactttacggtgac	Protospacer
 . *********.*****************

22. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP012956 (Acinetobacter baumannii strain D36 plasmid pD36-4 clone GC1, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acggtgacaaaccttccactttacggtgac	Protospacer
 . *********.*****************

23. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP051209 (Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acggtgacaaaccttccactttacggtgac	Protospacer
 . *********.*****************

24. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP032112 (Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acggtgacaaaccttccactttacggtgac	Protospacer
 . *********.*****************

25. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP032102 (Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acggtgacaaaccttccactttacggtgac	Protospacer
 . *********.*****************

26. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP045132 (Acinetobacter indicus strain TQ18 plasmid p18TQ-X3, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
atagtgacagaccttccactttacggtgac	Protospacer
 * ******.**.*****************

27. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP033769 (Acinetobacter baumannii strain FDAARGOS_533 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
ttagtgacaaactttccacttatcggtgac	Protospacer
.* ******************  *******

28. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP042558 (Acinetobacter baumannii strain E47 plasmid pE47_002, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
ttagtgacaaactttccacttatcggtgac	Protospacer
.* ******************  *******

29. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP010358 (Acinetobacter johnsonii XBB1 plasmid pXBB1-8, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
ttagtgacaaactttccacttatcggtgac	Protospacer
.* ******************  *******

30. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP040912 (Acinetobacter pittii strain AB17H194 plasmid pAB17H194-1, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
atagtgacagaccttccactttacggtgac	Protospacer
 * ******.**.*****************

31. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to CP042210 (Acinetobacter baumannii strain DS002 plasmid pTS134338, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
ttagtgacaaactttccacttatcggtgac	Protospacer
.* ******************  *******

32. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP039146 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-3, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
atagtgacagaccttccactttacggtgac	Protospacer
 * ******.**.*****************

33. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP038263 (Acinetobacter baumannii strain LEV1449/17Ec plasmid pEC_gr13, complete sequence) position: , mismatch: 4, identity: 0.867

cttgtgacaaactttccactttacggtgac	CRISPR spacer
ttagtgacaaactttccacttatcggtgac	Protospacer
.* ******************  *******

34. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP051863 (Acinetobacter baumannii strain Ab-C102 plasmid pAb-C102_1, complete sequence) position: , mismatch: 4, identity: 0.889

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccacttttaa	Protospacer
*.***********************.****.***.*

35. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_KX426232 (Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence) position: , mismatch: 4, identity: 0.889

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccacctttaa	Protospacer
*.******************.****.********.*

36. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP030755 (Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.889

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccacctttaa	Protospacer
*.******************.****.********.*

37. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP012956 (Acinetobacter baumannii strain D36 plasmid pD36-4 clone GC1, complete sequence) position: , mismatch: 4, identity: 0.889

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccacttttaa	Protospacer
*.***********************.****.***.*

38. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP032112 (Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence) position: , mismatch: 4, identity: 0.889

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccacctttaa	Protospacer
*.******************.****.********.*

39. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP032102 (Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence) position: , mismatch: 4, identity: 0.889

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccacctttaa	Protospacer
*.******************.****.********.*

40. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP051209 (Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence) position: , mismatch: 4, identity: 0.889

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccacctttaa	Protospacer
*.******************.****.********.*

41. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP051867 (Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_1, complete sequence) position: , mismatch: 4, identity: 0.889

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccacttttaa	Protospacer
*.***********************.****.***.*

42. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP051863 (Acinetobacter baumannii strain Ab-C102 plasmid pAb-C102_1, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acagtgacagaccttccactttacggtgac	Protospacer
 . ******.**.*****************

43. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_KX426232 (Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acagtgacagaccttccactttacggtgac	Protospacer
 . ******.**.*****************

44. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_KX426232 (Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acagtgacagaccttccactttacggtgac	Protospacer
 . ******.**.*****************

45. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP030755 (Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acagtgacagaccttccactttacggtgac	Protospacer
 . ******.**.*****************

46. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP030755 (Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acagtgacagaccttccactttacggtgac	Protospacer
 . ******.**.*****************

47. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP051209 (Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acagtgacagaccttccactttacggtgac	Protospacer
 . ******.**.*****************

48. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP051209 (Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acagtgacagaccttccactttacggtgac	Protospacer
 . ******.**.*****************

49. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP032112 (Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acagtgacagaccttccactttacggtgac	Protospacer
 . ******.**.*****************

50. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP032112 (Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acagtgacagaccttccactttacggtgac	Protospacer
 . ******.**.*****************

51. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP032102 (Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acagtgacagaccttccactttacggtgac	Protospacer
 . ******.**.*****************

52. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP032102 (Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
acagtgacagaccttccactttacggtgac	Protospacer
 . ******.**.*****************

53. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP044019 (Acinetobacter indicus strain HY20 plasmid pAI01, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
tgagtgacagaccttccactttacggtgac	Protospacer
.  ******.**.*****************

54. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP038259 (Acinetobacter baumannii strain 39741 plasmid pEH_gr13, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
tcggtgacaaaccttccacttttcggtgac	Protospacer
.. *********.********* *******

55. spacer 1.1|70548|30|NZ_CP046044|PILER-CR matches to NZ_CP038259 (Acinetobacter baumannii strain 39741 plasmid pEH_gr13, complete sequence) position: , mismatch: 5, identity: 0.833

cttgtgacaaactttccactttacggtgac	CRISPR spacer
tcagtgacaaaccttccacttttcggtgac	Protospacer
.. *********.********* *******

56. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_KX426232 (Acinetobacter lwoffii strain VS15 plasmid pALWVS1.1, complete sequence) position: , mismatch: 5, identity: 0.861

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccaccttaca	Protospacer
*.******************.****.*******  *

57. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP030755 (Acinetobacter schindleri strain H3 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.861

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccaccttaca	Protospacer
*.******************.****.*******  *

58. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP032112 (Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.2, complete sequence) position: , mismatch: 5, identity: 0.861

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccaccttaca	Protospacer
*.******************.****.*******  *

59. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP032102 (Acinetobacter lwoffii strain EK30A plasmid pALWEK1.1, complete sequence) position: , mismatch: 5, identity: 0.861

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccaccttaca	Protospacer
*.******************.****.*******  *

60. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP051209 (Acinetobacter sp. NEB149 plasmid pMsp179, complete sequence) position: , mismatch: 5, identity: 0.861

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacaaaccttccaccttaca	Protospacer
*.******************.****.*******  *

61. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP045132 (Acinetobacter indicus strain TQ18 plasmid p18TQ-X3, complete sequence) position: , mismatch: 5, identity: 0.861

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccactttata	Protospacer
*.***********************.****.**  *

62. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP039146 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-3, complete sequence) position: , mismatch: 5, identity: 0.861

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccactttata	Protospacer
*.***********************.****.**  *

63. spacer 1.3|70539|36|NZ_CP046044|CRISPRCasFinder matches to NZ_CP040912 (Acinetobacter pittii strain AB17H194 plasmid pAB17H194-1, complete sequence) position: , mismatch: 5, identity: 0.861

ctttccactttacggtgacagacctcccacctttga	CRISPR spacer
ccttccactttacggtgacagaccttccactttata	Protospacer
*.***********************.****.**  *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2174 : 83309

Leptospira_phage(16.67%)

transposase,integrase

attL 48829:48843|attR 66740:66754

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015344975.1\|2174_3668_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_119285041.1\|3860_5025_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.0e-139	85.2
WP_077170035.1\|5260_5719_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_038350081.1\|5845_6634_-	DUF4111 domain-containing protein	NA	NA	NA	NA
WP_087554624.1\|7046_8205_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.7e-49	38.4
WP_004658364.1\|9469_9691_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004658363.1\|9885_10137_+	hypothetical protein	NA	NA	NA	NA
WP_127800877.1\|10841_11729_-	cation transporter	NA	NA	NA	NA
WP_005245162.1\|11715_12447_-	transglutaminase family protein	NA	NA	NA	NA
WP_005245164.1\|12981_14181_-\|integrase	tyrosine-type recombinase/integrase	E5AGD0	Erwinia_phage	2.6e-37	29.3
WP_154320120.1\|15852_16371_-	hypothetical protein	NA	NA	NA	NA
WP_154320121.1\|16360_17749_-	hypothetical protein	NA	NA	NA	NA
WP_154320122.1\|17847_18923_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	6.8e-45	39.6
WP_154320123.1\|19159_19780_-	hypothetical protein	NA	NA	NA	NA
WP_154320124.1\|19798_25405_-	hemagglutinin repeat-containing protein	NA	NA	NA	NA
WP_154320125.1\|25576_26842_-	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	1.1e-41	37.6
WP_154320126.1\|26928_28686_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	A0A0R6PI85	Moraxella_phage	9.1e-31	26.6
WP_154320127.1\|28991_29330_+\|transposase	transposase	NA	NA	NA	NA
WP_094069408.1\|29952_31185_+	ATP-binding protein	NA	NA	NA	NA
WP_154320128.1\|33143_34748_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.1e-143	53.2
WP_002034689.1\|34822_35158_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_154320129.1\|35154_35538_-\|transposase	transposase	NA	NA	NA	NA
WP_094069355.1\|37020_37902_+	hypothetical protein	NA	NA	NA	NA
WP_094069354.1\|37924_38128_-	hypothetical protein	NA	NA	NA	NA
WP_154320130.1\|38518_38821_+	type II toxin-antitoxin system HigB family toxin	A0A0P0ZE17	Stx2-converting_phage	1.5e-10	34.0
WP_000354814.1\|38852_39224_+	transcriptional regulator	A0A222YXG1	Escherichia_phage	1.2e-30	56.4
WP_094069352.1\|39249_41658_+	DEAD/DEAH box helicase family protein	A7IW78	Paramecium_bursaria_Chlorella_virus	2.9e-35	31.8
WP_070153175.1\|43156_44470_+	ATP-binding protein	NA	NA	NA	NA
WP_154320131.1\|44613_45732_-	hypothetical protein	NA	NA	NA	NA
WP_070153169.1\|45742_46747_-	SEC-C domain-containing protein	NA	NA	NA	NA
WP_154320132.1\|46765_48115_-	HipA domain-containing protein	NA	NA	NA	NA
WP_070153163.1\|48104_48395_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
48829:48843	attL	NA	NA	NA	NA
WP_154320133.1\|49645_51322_-	phosphoethanolamine--lipid A transferase	NA	NA	NA	NA
WP_004974307.1\|51690_53055_-	sensor histidine kinase N-terminal domain-containing protein	W8CYF6	Bacillus_phage	3.2e-15	28.2
WP_154320134.1\|53055_53718_-	response regulator	W8CYM9	Bacillus_phage	6.3e-25	30.0
WP_004974304.1\|53790_55098_-	TolC family protein	NA	NA	NA	NA
WP_004974301.1\|55097_55421_-	DUF3240 family protein	NA	NA	NA	NA
WP_004974298.1\|55413_58497_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.2e-88	26.1
WP_004974297.1\|58507_59731_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_094069346.1\|60417_61122_+	hypothetical protein	NA	NA	NA	NA
WP_070153152.1\|61108_63379_+	hypothetical protein	NA	NA	NA	NA
WP_154320135.1\|63362_66551_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_094069347.1\|68856_70029_-	replication initiation protein	NA	NA	NA	NA
66740:66754	attR	NA	NA	NA	NA
WP_094069344.1\|70884_71658_+	AAA family ATPase	Q8JL10	Natrialba_phage	4.4e-14	33.3
WP_070153141.1\|71671_72583_+	ParB/RepB/Spo0J family partition protein	S5VSZ7	Leptospira_phage	2.6e-13	42.9
WP_070153138.1\|72688_72967_+	hypothetical protein	NA	NA	NA	NA
WP_154320136.1\|73194_74742_+	N-6 DNA methylase	A0A2H4PQP4	Staphylococcus_phage	4.5e-50	28.2
WP_104915058.1\|74738_75854_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_167846516.1\|75909_76443_+	DUF2939 domain-containing protein	NA	NA	NA	NA
WP_070153126.1\|76471_76948_+	hypothetical protein	NA	NA	NA	NA
WP_167846494.1\|77023_80272_+	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	1.0e-67	29.6
WP_154320138.1\|80766_81291_+	hypothetical protein	NA	NA	NA	NA
WP_154320139.1\|81722_82127_+	hypothetical protein	NA	NA	NA	NA
WP_154320140.1\|82150_83309_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	6.4e-49	38.4

DBSCAN-SWA_2

96138 : 103649

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000052512.1\|96138_97614_-	ABC-F type ribosomal protection protein Msr(E)	A0A1B0RXA0	Streptococcus_phage	2.3e-160	59.0
WP_154320141.1\|97986_98739_+	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	2.1e-133	99.6
WP_170852050.1\|98683_98854_+	rRNA adenine methyltransferase	E4ZFP9	Streptococcus_phage	3.4e-20	92.7
WP_171501087.1\|99173_99335_-	hypothetical protein	NA	NA	NA	NA
WP_004282341.1\|99821_100523_-\|transposase	IS1 family transposase	A0A218MNG1	uncultured_virus	1.4e-35	53.5
WP_154320142.1\|100751_102683_+	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	1.4e-61	30.8
WP_154320143.1\|102947_103649_+\|transposase	IS1 family transposase	A0A218MNG1	uncultured_virus	1.4e-35	53.5

DBSCAN-SWA_3

113954 : 123122

Burkholderia_virus(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_169538922.1\|113954_115019_-	efflux RND transporter periplasmic adaptor subunit	S5VL44	Leptospira_phage	5.0e-08	24.1
WP_074163998.1\|115544_116141_+	LysE family transporter	NA	NA	NA	NA
WP_032073151.1\|116168_116987_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_000985610.1\|117117_117399_-	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	5.7e-12	43.3
WP_154320144.1\|117399_117702_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	7.3e-21	49.0
WP_004976362.1\|117951_118161_+	hypothetical protein	NA	NA	NA	NA
WP_026438532.1\|118410_119865_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	2.9e-184	71.4
WP_004969304.1\|119975_120266_-	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	4.4e-15	48.9
WP_004647749.1\|120267_120564_-	type II toxin-antitoxin system RelE/ParE family toxin	A4JWV2	Burkholderia_virus	1.2e-15	38.8
WP_004969299.1\|120999_122082_-	hypothetical protein	NA	NA	NA	NA
WP_006581699.1\|122555_123122_+	recombinase family protein	Q2A092	Sodalis_phage	1.8e-28	41.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046045

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046043

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP046044

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection