CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP045924	Lactococcus petauri strain CF11 chromosome, complete genome	1 crisprs	cas3,csa3,DEDDh,DinG	0	0	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045924_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045924_1

1159845-1159952

Orphan

Consensus_repeat	Method
GGCTCTCTGAACTTGATGTTGATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045924_1

>merge|NZ_CP045924|1|1159845-1159952|CRISPRCasFinder
GGCTCTCTGAACTTGATGTTGATAAAGATGTCGAAAGTGAATCACTGATTGACACCGATGTCGATACCGAATCAGAAAGAGATTGGCGCTCTGAACTTGATGTTGATA

>NZ_CP045924|1|1|1159845-1159952|CRISPRCasFinder
GGCTCTCTGAACTTGATGTTGATA	AAGATGTCGAAAGTGAATCACTGATTGACACCGATGTCGATACCGAATCAGAAAGAGATT
GGCGCTCTGAACTTGATGTTGATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045924.1\|WP_019291733.1\|1155917_1156721_+\|kinase/pyrophosphorylase	unknown	unknown	gnl\|CDD\|377080
NZ_CP045924.1\|WP_019291735.1\|1158289_1158610_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380149
NZ_CP045924.1\|WP_019292580.1\|1166744_1167488_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045924.1\|WP_019292579.1\|1165652_1166528_-\|cation-transporter	unknown	unknown	gnl\|CDD\|223131
NZ_CP045924.1\|WP_019335899.1\|1156834_1157431_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375111
NZ_CP045924.1\|WP_019291730.1\|1151341_1151722_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319924
NZ_CP045924.1\|WP_019291738.1\|1160188_1160416_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380149
NZ_CP045924.1\|WP_004257024.1\|1152017_1152416_+\|phosphate-starvation-inducible-PsiE-family-protein	unknown	unknown	gnl\|CDD\|235075
NZ_CP045924.1\|WP_004256974.1\|1164385_1164595_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045924.1\|WP_004257007.1\|1157505_1157985_-\|VTT-domain-containing-protein	unknown	unknown	gnl\|CDD\|223659
NZ_CP045924.1\|WP_019292578.1\|1164780_1165218_+\|DUF1398-family-protein	unknown	unknown	gnl\|CDD\|227849
NZ_CP045924.1\|WP_019291740.1\|1161346_1161526_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045924.1\|WP_019291739.1\|1160524_1160842_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380149
NZ_CP045924.1\|WP_019291731.1\|1152456_1155075_-\|pyruvate,-phosphate-dikinase	unknown	unknown	gnl\|CDD\|236446
NZ_CP045924.1\|WP_004257029.1\|1151147_1151330_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045924.1\|WP_004256982.1\|1163113_1163548_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP045924.1\|WP_017370516.1\|1158180_1158291_-\|LPXTG-cell-wall-anchor-domain-containing-protein	unknown	unknown	gnl\|CDD\|273478
NZ_CP045924.1\|WP_019291732.1\|1155275_1155908_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|341387
NZ_CP045924.1\|WP_019292335.1\|1169127_1169478_-\|YxeA-family-protein	unknown	unknown	gnl\|CDD\|227613
NZ_CP045924.1\|WP_153924942.1\|1163793_1164219_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180

Protein	Function_ID	Function_description	E-value
NZ_CP045924.1\|WP_019291733.1\|1155917_1156721_+\|kinase/pyrophosphorylase	gnl\|CDD\|377080	pfam03618, Kinase-PPPase, Kinase/pyrophosphorylase. This family of regulatory proteins has ADP-dependent kinase and inorganic phosphate-dependent pyrophosphorylase activity.	3.42387e-123
NZ_CP045924.1\|WP_019291735.1\|1158289_1158610_+\|hypothetical-protein	gnl\|CDD\|380149	NF012181, MSCRAMM_SdrD, MSCRAMM family adhesin SdrD. Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.	2.0397e-06
NZ_CP045924.1\|WP_019292579.1\|1165652_1166528_-\|cation-transporter	gnl\|CDD\|223131	COG0053, MMT1, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism].	7.71689e-95
NZ_CP045924.1\|WP_019335899.1\|1156834_1157431_+\|hypothetical-protein	gnl\|CDD\|375111	pfam17294, Lipoprotein_22, Uncharacterized lipoprotein family. The proteins in this family all have an N-terminal lipoprotein attachment motif. No member of this family has been functionally characterized.	3.33503e-43
NZ_CP045924.1\|WP_019291730.1\|1151341_1151722_-\|VOC-family-protein	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	7.89608e-13
NZ_CP045924.1\|WP_019291738.1\|1160188_1160416_+\|hypothetical-protein	gnl\|CDD\|380149	NF012181, MSCRAMM_SdrD, MSCRAMM family adhesin SdrD. Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.	0.00325003
NZ_CP045924.1\|WP_004257024.1\|1152017_1152416_+\|phosphate-starvation-inducible-PsiE-family-protein	gnl\|CDD\|235075	PRK02833, PRK02833, phosphate-starvation-inducible protein PsiE; Provisional.	2.16636e-17
NZ_CP045924.1\|WP_019292578.1\|1164780_1165218_+\|DUF1398-family-protein	gnl\|CDD\|227849	COG5562, COG5562, Phage envelope protein [General function prediction only].	1.19439e-23
NZ_CP045924.1\|WP_004257007.1\|1157505_1157985_-\|VTT-domain-containing-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	2.95638e-17
NZ_CP045924.1\|WP_019291739.1\|1160524_1160842_+\|hypothetical-protein	gnl\|CDD\|380149	NF012181, MSCRAMM_SdrD, MSCRAMM family adhesin SdrD. Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.	1.06588e-05
NZ_CP045924.1\|WP_019291731.1\|1152456_1155075_-\|pyruvate,-phosphate-dikinase	gnl\|CDD\|236446	PRK09279, PRK09279, pyruvate phosphate dikinase; Provisional.	0
NZ_CP045924.1\|WP_004256982.1\|1163113_1163548_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	2.15808e-34
NZ_CP045924.1\|WP_017370516.1\|1158180_1158291_-\|LPXTG-cell-wall-anchor-domain-containing-protein	gnl\|CDD\|273478	TIGR01167, Zinc_metalloprotease_ZmpB, LPXTG-motif cell wall anchor domain. This model describes the LPXTG motif-containing region found at the C-terminus of many surface proteins of Streptococcus and Streptomyces species. Cleavage between the Thr and Gly by sortase or a related enzyme leads to covalent anchoring at the new C-terminal Thr to the cell wall. Hits that do not lie at the C-terminus or are not found in Gram-positive bacteria are probably false-positive. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region. [Cell envelope, Other].	0.000982907
NZ_CP045924.1\|WP_019291732.1\|1155275_1155908_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|341387	cd04617, CBS_pair_CcpN, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains of CcpN repressor. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	3.2766e-58
NZ_CP045924.1\|WP_019292335.1\|1169127_1169478_-\|YxeA-family-protein	gnl\|CDD\|227613	COG5294, COG5294, Uncharacterized protein conserved in bacteria [Function unknown].	8.68314e-14
NZ_CP045924.1\|WP_153924942.1\|1163793_1164219_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	2.45025e-32

>NZ_CP045924.1|WP_019291735.1|1158289_1158610_+|hypothetical-protein
MCSEFLDAKDVDSDALSDTEIDSLDDTDADSDIDDEVESESESLSDRDVEPLSDADSETDSLFEVDIEVDSLAESLVESRLDSEVEDETETESLVDTDRESLVEPD
>NZ_CP045924.1|WP_017370516.1|1158180_1158291_-|LPXTG-cell-wall-anchor-domain-containing-protein
MSTLPHTGDKDSIGLGMLGLGLIGAAALGKKKKKKA
>NZ_CP045924.1|WP_004257007.1|1157505_1157985_-|VTT-domain-containing-protein
MVEKMLNWVASLPLWQATLFLFIVVFFRAQMTFGLGKLIHMGILKTKWGKKAEKSEENRAGMLALQKYGWPVIPLSFLTVGFQTVVQLAAGMLDWKWSKYTLVALPGYLAWGFVYAAGGLTLFRSIANGSIGLLILFVIIVLLLWSVGTFLVKKLKPNA
>NZ_CP045924.1|WP_019335899.1|1156834_1157431_+|hypothetical-protein
MTKKLWIIPALILFIAGGYFAVSKVISLFHQPVHGIILYSSDKKELEQSLKDNQSYIKNNITVEGKYITETDTLVLDAASAEKLIQAKAVNTVSKKGDEFNFKHVTSLPKTPALWTADTQVNTIEDEKGQRFTAATTEYVVLGESSMTKKTLVLDKEAFKKFQAPAKYVSMIEEKRDAAHALTEYKADKAQIFNFKQK
>NZ_CP045924.1|WP_019291733.1|1155917_1156721_+|kinase/pyrophosphorylase
MQNIKIYLITDSVGETAKKIISAVVAQFPTVDLSDVQLYPFTNDKASLLEILNDAKKENALVAITLVDKSLVACVKKFSDTHDLAYVDFMSPLMHLIEERSGEQPTQESGSVHRLNQAYFNRVAAIEFAVKYDDGKDPKGFLNADIVLLGVSRTSKTPLSMYLANKGYKVANLPIIPEVEVAKELYKVDPRKIIGLTSTSESLSNIRSYREQTLGLKKKSMYSDEKRILEELAYADTLFEQLGIETIDVSKRSIEESSMLIENLIQK
>NZ_CP045924.1|WP_019291732.1|1155275_1155908_+|helix-turn-helix-transcriptional-regulator
MKLTTRQTEIINIVKAEQPISGEKIAQNLGLSRATLRNDLSILTMTGLLDAKPKVGYFYTGQKMQPLYIESCYSKKVADVMTSPLIVEQNMSVYDAATSLFLYDIGSIYVKNENGDLAGLLSRKDLLRFAISGNNLEKTPVAVIMTRMPNIHTITADKTLLEAGNILSQYEVDSLPVLEKVDSKKIIGKISIKHIMNAFIQTGNEMQGED
>NZ_CP045924.1|WP_019291731.1|1152456_1155075_-|pyruvate,-phosphate-dikinase
MSRAKKRVYNFTEGSKEQKALLGGKGANLAEMTGIGLPVPRGFTITTEACLEYLDSKKLLSELVKEIKEHIVRLENETGKKFADEENPLLVSVRSGSKFSMPGMMDTILNLGLNHQSVEIFARKTGNPVFAYDCYRRLIQMFGDVVKGVDKNIFEEALTQYKAAHGYSSDIEMKAEDWKEIIQQFTTIYLKEVGENFPQDPSKQLYAAVEAVFTSWNNPRAVTYRRIHEISDKLGTAVNIQEMVFGNTGGNSGTGVAFTRNPATGEAGVFGEFLLNAQGEDVVAGIRTPRPIQELKQDQPAIYLQFEKICHQLEAHYQDMQDIEFTIEEGKLFILQTRNGKRTAKAAFKIATQMAEDGVISKEESLKRLTPSMITQLLHPVFDEQMLAESQAIAKGLPASPGAASGRVYFHAEDAQNAHAAGQKVILLRTETSPEDIEGMVVSEAIVTSRGGMTSHAAVVARGMGVCCVVGCEQLTINEKLKQAYDGTHTINEGDLLSVDGTTGKIYRGEIKLDKAQDLDLLVKVLKWASHIGKLQVRANAETVEDIRAALEFGASGIGLARTEHMFFGKERILEMRKMFLSEDQLQRKQSLETLKEFQKKDFAEILNLTEGMPCTIRLLDPPLHEFMPKTKEEYEQVAEACGQTVDFIMQRGKDLEEFNPMLGHRGCRLAITYPEIYEMQVEAIMEAALELAKTGKQVKPEIMIPLVAEEKELSYLKKMLEDKIQHVFEKHKMKLTYKIGAMLEIPRACLTADQLATSAQFFSFGTNDLTQLTYGFSRDDSVKFLPDYIEKGILEDDPFQHLDQKGVGSLMKTAIELVKPRHKDISFGVCGEVGGDPDSVAFLQNIGLDYVSCSPYRVPAVLLTVAQMSIK
>NZ_CP045924.1|WP_004257024.1|1152017_1152416_+|phosphate-starvation-inducible-PsiE-family-protein
MIQFNFLSKTFNVIIKVCLSLLGLVIAFLMFKEIWVLLSSFTTGFIDYSFYDIIDRILTFFLFLEFLELIIHYLSDNDHPTIKKYIYIAVASIVRLLISNHETSQLSLFLQCSAILVLIIGTVMLNLWGDLK
>NZ_CP045924.1|WP_019291730.1|1151341_1151722_-|VOC-family-protein
MINLCNMLYVSDVPKHAEFWTKVGLQELRRQGSGSQETVIFAVDANAPSARIQLWNLDFIRQNSPEVADMKGSMLFTVDNLEEWHSRVAEATDTVSEINDFQGMVNFNFQDPDGNYYAFAQSELPE
>NZ_CP045924.1|WP_004257029.1|1151147_1151330_+|hypothetical-protein
MTVDRSYSPYESIRNYHDRGMMKWGAFATGELSEAQRKLREKEELENETFPKKATSKLDD
>NZ_CP045924.1|WP_019291738.1|1160188_1160416_+|hypothetical-protein
MLESERDSLTELDDERLSEVDSRLESESDSGMDSEALTESRAESERERLSELDSEAELDVERLIDVESDADSEAD
>NZ_CP045924.1|WP_019291739.1|1160524_1160842_+|hypothetical-protein
MLDSLTERLSESRSEADVDVEALDESERESRLEAETESETDVESLIDSDTDSLTDTEALVEALAESRSEPDVDVEALTESETDSREEFDVETDSEAEILSDCECE
>NZ_CP045924.1|WP_019291740.1|1161346_1161526_+|hypothetical-protein
MELDSLIEFVSELEAKESELESEIESRVESELEVLSELESLRESESDSLIELDVERLSE
>NZ_CP045924.1|WP_004256982.1|1163113_1163548_-|universal-stress-protein
MTDYYKNILVPVDGSEQSYKAVDEAIRIARLNHAKLHVLTVKDINKYYGAVHKGIVETPGLDQLAQDILANCKDIIREQVEYETYEIAGKPKLRIVNFAEEEDKNIDLIVIGATGTDMFDRLLVGSTTNYVINHAPCNVIVVKK
>NZ_CP045924.1|WP_153924942.1|1163793_1164219_-|universal-stress-protein
MEKQYHNILVALDGSDQSYNAVHEAITLAKRNNAKLHVLTVKDMEHHYGMTGFGIVENPEIDMMAQDILKKAAEIIGDEVPYDSYEIVGAPKHLIVQFAGDKKMDLIVIGATGAGMINKLMLGSTTQFVVNHAPCNVLVVK
>NZ_CP045924.1|WP_004256974.1|1164385_1164595_+|hypothetical-protein
MYVIVSFRRYHIEKGECIMTFTNKNKNFKYTVSLDTSKDIFKVFLANDPAVYGLGRTIEEAMHNLEELA
>NZ_CP045924.1|WP_019292578.1|1164780_1165218_+|DUF1398-family-protein
MISKNIQRAMLKANHVGAESKGFPYLAECLRQEGIVKNIWHLPSGDSFYFSETGSLVNPGNPLIGRVGPCPDFDQIALVQNIRANQAGKISFPEFLASLWKAGVIRYEVDFTTRQMSYFGAFDQVYQESYPSVAIDVSSTESFLP
>NZ_CP045924.1|WP_019292579.1|1165652_1166528_-|cation-transporter
MENKRYKELKIAEKGAWISISAYIILAFTKIFMGIFANSEALRADGLNNFTDVIASISVLIGLKLARKPKDDDHRYGHWKFENIASMITSFIMLMVGLEVLYSSFEKIVNNSFTPPNPLSALVGIGSALIMVAVYIYNSRLAKKVNSQALMAAAKDNLSDAYTSIGAAVAIAASYLHFYILDTIAAFIIGIIIIKTAIDIFRESSFTLSDGFPEEDLEKYKNYILEIPGVRGVPFLRGRTYGANIFLDIVIYVDAQLSVAESHLITEEIEQQLSEKFEVFDVDVHVEPFSD
>NZ_CP045924.1|WP_019292580.1|1166744_1167488_+|hypothetical-protein
MKKIILAFIPLLLLVGCGADKKENTANFAQDKQSSTHTSSSTSAPSSSQDTVASSEQPKSYPVALEQFSKGDYSNFHGLYKNSSNDILIITKDHIEYYSHTGKDIGSVIINESTFKSKTENQPFNQIYLFNQGQVEINFNATADKIEAIQITDNAGTSSDFTLAAQLDSNNFTKDTVLNYFKSYLSNPEDFYFDAVNTQDSFVIQVFSKEMRANGGSGTVGLYKVLPDGTIYLVTYDVATNTYPKAE
>NZ_CP045924.1|WP_019292335.1|1169127_1169478_-|YxeA-family-protein
MKKILFGFLGVLLILDIGFFWKNISYTQTIYFAHVQGKVNTKILKNTDGTLDGQYNYTVRGVSSRGDVRELHLKTDHQIHVGTYLEIHAANKKDANSWKTRQEYEIPRTALNKLEE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

267704 : 277450

Streptococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019291355.1\|267704_268094_+	single-stranded DNA-binding protein	A0A1X9I6R5	Streptococcus_phage	2.0e-23	42.0
WP_019291354.1\|268150_268681_+	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_019291353.1\|268798_269080_+	co-chaperone GroES	A0A221S386	uncultured_virus	2.7e-14	47.8
WP_003133890.1\|269109_270735_+	chaperonin GroEL	A0A219YK78	uncultured_virus	8.1e-159	58.0
WP_019291352.1\|270784_271597_-	MBL fold metallo-hydrolase	A0A2H4J3R0	uncultured_Caudovirales_phage	4.2e-31	36.5
WP_019291351.1\|271593_273012_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	4.8e-30	32.4
WP_003133894.1\|273004_273706_-	response regulator transcription factor	W8CYM9	Bacillus_phage	8.1e-39	38.8
WP_019291350.1\|273916_274546_+	dTMP kinase	M1PSC7	Streptococcus_phage	2.9e-72	64.6
WP_153924392.1\|274571_275435_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	1.1e-64	45.2
WP_019335957.1\|275447_276221_+	signal peptidase	NA	NA	NA	NA
WP_153924395.1\|276245_276587_+	DUF972 family protein	M1PFV3	Streptococcus_phage	2.2e-13	38.9
WP_019291347.1\|276583_277450_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.6e-103	66.2

DBSCAN-SWA_2

337864 : 347514

Bacillus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019292641.1\|337864_338701_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	4.4e-15	39.1
WP_153924429.1\|338687_339518_+	GDSL family lipase	NA	NA	NA	NA
WP_153924432.1\|339507_340092_+	DUF2140 family protein	NA	NA	NA	NA
WP_003133973.1\|340209_340485_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	5.4e-23	68.5
WP_153924434.1\|340701_341874_+	aminotransferase class V-fold PLP-dependent enzyme	H7BUW1	unidentified_phage	5.3e-19	31.7
WP_019292637.1\|341985_342906_-	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	2.7e-111	67.8
WP_019292636.1\|343090_344020_+	LysM peptidoglycan-binding domain-containing protein	Q5ILA5	Bacillus_phage	6.8e-09	34.0
WP_019292635.1\|344117_344744_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	1.2e-49	46.0
WP_019292634.1\|344747_346832_-	penicillin-binding protein	NA	NA	NA	NA
WP_019292633.1\|346863_347514_-	Holliday junction resolvase RecU	A0A1C8E9C3	Bacillus_phage	5.2e-24	36.0

DBSCAN-SWA_3

584607 : 595522

Streptococcus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019335674.1\|584607_584958_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	1.1e-28	54.9
WP_019335673.1\|584988_585849_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	5.0e-91	61.0
WP_153924603.1\|586078_588067_+\|tRNA	methionine--tRNA ligase	A0A1V0S905	Catovirus	5.2e-59	32.3
WP_019335671.1\|588099_588945_-	SDR family NAD(P)-dependent oxidoreductase	A0A0K0KVL6	Prochlorococcus_phage	5.4e-05	28.1
WP_004258747.1\|589087_589327_+	DUF2829 domain-containing protein	A8AT88	Listeria_phage	3.6e-07	37.0
WP_019335670.1\|589319_590039_+	3-oxoacyl-ACP reductase	A0A0N9R355	Chrysochromulina_ericina_virus	1.6e-13	26.1
WP_019293781.1\|590203_590713_+	QueT transporter family protein	E7DN70	Pneumococcus_phage	1.2e-07	30.5
WP_029343489.1\|590767_591544_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_019335669.1\|591704_592487_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_019293778.1\|592605_593031_+	universal stress protein	NA	NA	NA	NA
WP_019335668.1\|593158_595522_+	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	1.2e-83	49.9

DBSCAN-SWA_4

607292 : 615386

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019335659.1\|607292_607685_+	arsenate reductase ArsC	A0A2H4PQT9	Staphylococcus_phage	3.0e-11	34.4
WP_017368973.1\|607727_608813_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_019293765.1\|609015_610011_+	catabolite control protein A	C6ZCU4	Enterobacteria_phage	1.1e-20	28.2
WP_003135419.1\|610215_610416_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	5.5e-25	83.3
WP_019291981.1\|610778_611468_+	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	3.1e-51	49.1
WP_019291982.1\|611579_612875_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	5.9e-19	32.8
WP_019291983.1\|613016_613340_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_040086508.1\|613352_615386_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.0e-105	37.5

DBSCAN-SWA_5

721170 : 733521

Enterococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017369093.1\|721170_721863_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	1.8e-30	34.1
WP_019292481.1\|721855_722791_+	ABC transporter permease	NA	NA	NA	NA
WP_019292482.1\|722890_723877_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	9.4e-118	66.6
WP_019293703.1\|723891_726060_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.9e-249	59.0
WP_019292484.1\|726113_726533_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A2R3ZXT9	Staphylococcus_phage	1.1e-06	28.7
WP_019292485.1\|726529_726748_-	glutaredoxin-like protein NrdH	A0A1W6JHV4	Lactococcus_phage	2.0e-12	45.1
WP_019293702.1\|726856_727495_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_019292487.1\|727724_729662_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.4e-125	42.9
WP_019292488.1\|729685_730528_+	3'-5' exonuclease	A0A0K2SUJ2	Clostridium_phage	1.6e-20	34.9
WP_153924649.1\|730530_730992_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_153924652.1\|731037_733521_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	2.5e-98	33.7

DBSCAN-SWA_6

926142 : 931803

Lactococcus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100205815.1\|926142_926691_-	Ltp family lipoprotein	A0A0A1ERB0	Lactobacillus_phage	7.3e-11	61.5
WP_019292509.1\|927205_927745_-	PH domain-containing protein	A5GZ63	Lactococcus_phage	7.7e-74	76.0
WP_040086243.1\|927793_928384_-	hypothetical protein	A0A1X9IGD7	Lactococcus_phage	6.5e-98	88.8
WP_019292507.1\|928395_928740_-	XRE family transcriptional regulator	A0A182BQC8	Lactococcus_phage	1.3e-45	80.7
WP_019292506.1\|929135_929591_-	hypothetical protein	NA	NA	NA	NA
WP_153924777.1\|929746_929977_+	hypothetical protein	NA	NA	NA	NA
WP_153924780.1\|929989_930241_+	hypothetical protein	A0A1P8BMM2	Lactococcus_phage	3.3e-19	56.1
WP_017369912.1\|931602_931803_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	1.1e-30	98.5

DBSCAN-SWA_7

1133469 : 1211719

100

Lactococcus_phage(34.78%)

plate,capsid,portal,integrase,tail,holin,head,terminase

attL 1172486:1172503|attR 1208271:1208288

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153924907.1\|1133469_1134723_-\|integrase	tyrosine-type recombinase/integrase	A0A1S5S8R9	Streptococcus_phage	4.5e-32	31.0
WP_138491699.1\|1134801_1135050_-	DNA-binding protein	W6LM55	Streptococcus_phage	4.3e-11	42.5
WP_153924910.1\|1135107_1135965_-	hypothetical protein	NA	NA	NA	NA
WP_153924912.1\|1136090_1136891_-	hypothetical protein	NA	NA	NA	NA
WP_165719055.1\|1136880_1137306_-	hypothetical protein	NA	NA	NA	NA
WP_153924918.1\|1137536_1137716_-	hypothetical protein	NA	NA	NA	NA
WP_153924921.1\|1137747_1138179_-	hypothetical protein	NA	NA	NA	NA
WP_153924924.1\|1138344_1138776_+	hypothetical protein	NA	NA	NA	NA
WP_153924927.1\|1138823_1139609_+	hypothetical protein	NA	NA	NA	NA
WP_153924930.1\|1139676_1140258_-	hypothetical protein	NA	NA	NA	NA
WP_153924933.1\|1140254_1141976_-	hypothetical protein	Q6NE04	Leptospira_phage	3.7e-77	33.4
WP_153924936.1\|1142166_1143855_-	50S ribosome-binding GTPase	NA	NA	NA	NA
WP_153924939.1\|1143867_1145973_-	50S ribosome-binding GTPase	NA	NA	NA	NA
WP_019291727.1\|1148977_1149361_-	VOC family protein	NA	NA	NA	NA
WP_019291729.1\|1149706_1151158_+	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	7.8e-121	49.4
WP_004257029.1\|1151147_1151330_+	hypothetical protein	A0A182BQ76	Lactococcus_phage	2.2e-12	75.6
WP_019291730.1\|1151341_1151722_-	VOC family protein	NA	NA	NA	NA
WP_004257024.1\|1152017_1152416_+	phosphate-starvation-inducible PsiE family protein	NA	NA	NA	NA
WP_019291731.1\|1152456_1155075_-	pyruvate, phosphate dikinase	H8YJB7	Vibrio_phage	1.7e-89	40.6
WP_019291732.1\|1155275_1155908_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_019291733.1\|1155917_1156721_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_019335899.1\|1156834_1157431_+	hypothetical protein	NA	NA	NA	NA
WP_004257007.1\|1157505_1157985_-	VTT domain-containing protein	NA	NA	NA	NA
WP_017370516.1\|1158180_1158291_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_019291735.1\|1158289_1158610_+	hypothetical protein	NA	NA	NA	NA
WP_019291738.1\|1160188_1160416_+	hypothetical protein	NA	NA	NA	NA
WP_019291739.1\|1160524_1160842_+	hypothetical protein	NA	NA	NA	NA
WP_019291740.1\|1161346_1161526_+	hypothetical protein	NA	NA	NA	NA
WP_004256982.1\|1163113_1163548_-	universal stress protein	NA	NA	NA	NA
WP_153924942.1\|1163793_1164219_-	universal stress protein	NA	NA	NA	NA
WP_004256974.1\|1164385_1164595_+	hypothetical protein	NA	NA	NA	NA
WP_019292578.1\|1164780_1165218_+	DUF1398 family protein	NA	NA	NA	NA
WP_019292579.1\|1165652_1166528_-	cation transporter	NA	NA	NA	NA
WP_019292580.1\|1166744_1167488_+	hypothetical protein	NA	NA	NA	NA
WP_019292335.1\|1169127_1169478_-	YxeA family protein	NA	NA	NA	NA
WP_040087534.1\|1169922_1171476_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_019335905.1\|1171586_1172126_+	DUF1440 domain-containing protein	NA	NA	NA	NA
WP_165706996.1\|1172231_1172390_+	hypothetical protein	NA	NA	NA	NA
1172486:1172503	attL	NA	NA	NA	NA
WP_153924944.1\|1172562_1173018_-	type II toxin-antitoxin system HicB family antitoxin	F0PIL2	Enterococcus_phage	2.2e-45	65.0
WP_153924947.1\|1173054_1173240_-	type II toxin-antitoxin system HicA family toxin	F0PIL1	Enterococcus_phage	1.4e-19	75.4
WP_019335546.1\|1173523_1173706_+	hypothetical protein	A0A182BQ76	Lactococcus_phage	2.0e-26	95.0
WP_153924950.1\|1173738_1174419_-	hypothetical protein	NA	NA	NA	NA
WP_153924953.1\|1174509_1175364_-	peptidoglycan hydrolase	W6LMV8	Streptococcus_phage	6.1e-49	49.1
WP_153924954.1\|1175365_1175554_-	hypothetical protein	NA	NA	NA	NA
WP_153925519.1\|1175558_1175789_-\|holin	holin	A0A182BQ79	Lactococcus_phage	7.7e-23	76.3
WP_153924957.1\|1175800_1176022_-	hemolysin XhlA family protein	A0A182BQ80	Lactococcus_phage	5.1e-32	97.3
WP_153924960.1\|1176062_1177406_-\|plate	BppU family phage baseplate upper protein	A0A1G5SA76	Enterococcus_phage	4.0e-26	48.9
WP_153924963.1\|1177395_1179498_-\|tail	phage tail protein	D2IYX8	Enterococcus_phage	6.0e-154	45.4
WP_153924966.1\|1179494_1180340_-\|tail	phage tail family protein	D2IYX7	Enterococcus_phage	4.3e-71	46.6
WP_153924969.1\|1180340_1183040_-	tape measure protein	A0A191KBP6	Streptococcus_virus	8.0e-103	53.3
WP_153924972.1\|1183039_1183321_-	hypothetical protein	NA	NA	NA	NA
WP_019293259.1\|1183365_1183809_-	hypothetical protein	D2IZN3	Enterococcus_phage	3.0e-15	38.0
WP_019293260.1\|1183878_1184526_-\|tail	phage major tail protein, TP901-1 family	D2IYX2	Enterococcus_phage	3.7e-70	67.4
WP_153924975.1\|1184536_1184899_-	hypothetical protein	D2IYX1	Enterococcus_phage	2.1e-30	55.6
WP_019293262.1\|1184895_1185246_-	HK97 gp10 family phage protein	D2IYX0	Enterococcus_phage	1.7e-13	37.0
WP_153924978.1\|1185245_1185521_-	hypothetical protein	NA	NA	NA	NA
WP_019293264.1\|1185517_1185862_-\|head,tail	phage head-tail connector protein	K4I470	Lactobacillus_virus	2.4e-20	43.9
WP_153924980.1\|1185877_1186333_-	Ig-like domain-containing protein	A0A1D6Z291	Staphylococcus_phage	1.9e-17	45.4
WP_153924983.1\|1186410_1187277_-	hypothetical protein	Q6SED2	Lactobacillus_prophage	1.7e-110	67.2
WP_153924986.1\|1187287_1187857_-	DUF4355 domain-containing protein	A0A2H4J4U9	uncultured_Caudovirales_phage	8.1e-13	36.4
WP_153924989.1\|1187997_1188888_-\|capsid	minor capsid protein	D2IYW4	Enterococcus_phage	1.5e-61	43.2
WP_153924992.1\|1188874_1190467_-\|portal	phage portal protein	D2IZF6	Enterococcus_phage	1.3e-129	52.5
WP_153924995.1\|1190468_1191752_-\|terminase	PBSX family phage terminase large subunit	A0A097BYD0	Leuconostoc_phage	7.1e-150	62.0
WP_153924998.1\|1192276_1192765_-	QueT transporter family protein	NA	NA	NA	NA
WP_153925001.1\|1192761_1193595_-	hypothetical protein	NA	NA	NA	NA
WP_153925522.1\|1193594_1194101_-	ParB N-terminal domain-containing protein	Q938L7	Temperate_phage	1.2e-28	45.5
WP_153925004.1\|1194267_1194453_-	hypothetical protein	NA	NA	NA	NA
WP_153925006.1\|1194608_1195343_-	hypothetical protein	B5SP25	Lactococcus_phage	2.3e-20	35.6
WP_153925009.1\|1195373_1195550_-	hypothetical protein	NA	NA	NA	NA
WP_153925012.1\|1195707_1196133_-	transcriptional regulator	A0A1X9I5N8	Streptococcus_phage	3.8e-23	42.2
WP_153925015.1\|1196350_1197208_-	prohibitin family protein	A8E2Q9	Enterococcus_phage	2.3e-40	45.6
WP_167510342.1\|1197262_1197439_-	hypothetical protein	NA	NA	NA	NA
WP_153925017.1\|1197444_1197651_-	hypothetical protein	A0A1X9IGG2	Lactococcus_phage	2.3e-26	95.6
WP_153925021.1\|1197781_1198057_-	hypothetical protein	A0A1P8BLG4	Lactococcus_phage	2.6e-09	45.1
WP_153925525.1\|1198058_1198364_-	hypothetical protein	NA	NA	NA	NA
WP_017369946.1\|1198504_1198669_-	hypothetical protein	Q9AZZ8	Lactococcus_phage	1.1e-12	62.7
WP_153925024.1\|1198665_1199289_-	DUF1642 domain-containing protein	A0A1P8BMI2	Lactococcus_phage	2.2e-19	35.9
WP_153925027.1\|1199275_1199476_-	hypothetical protein	NA	NA	NA	NA
WP_153925030.1\|1199477_1199708_-	hypothetical protein	NA	NA	NA	NA
WP_153925033.1\|1199829_1200321_-	hypothetical protein	A0A1P8BKW0	Lactococcus_phage	1.1e-39	54.1
WP_153925036.1\|1200323_1200623_-	hypothetical protein	NA	NA	NA	NA
WP_153925039.1\|1200642_1200942_-	hypothetical protein	NA	NA	NA	NA
WP_153925042.1\|1200922_1201747_-	DnaD domain protein	Q9AYU4	Lactococcus_phage	7.2e-47	56.2
WP_153925045.1\|1201983_1202790_-	recombinase RecT	Q9AZQ0	Lactococcus_phage	8.3e-72	59.9
WP_153925049.1\|1202782_1203619_-	hypothetical protein	A0A1P8BKZ1	Lactococcus_phage	4.9e-67	56.9
WP_153925052.1\|1203634_1203850_-	helix-turn-helix domain-containing protein	A0A2H4JH10	uncultured_Caudovirales_phage	5.2e-05	41.1
WP_153925053.1\|1203852_1204215_-	hypothetical protein	NA	NA	NA	NA
WP_153925056.1\|1204293_1204467_-	hypothetical protein	NA	NA	NA	NA
WP_153925060.1\|1204482_1204818_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_153925063.1\|1204808_1204961_-	hypothetical protein	NA	NA	NA	NA
WP_153925528.1\|1205040_1205283_-	DUF739 family protein	A0A1P8BL13	Lactococcus_phage	2.9e-12	50.7
WP_153925066.1\|1205483_1206002_+	helix-turn-helix domain-containing protein	A0A068A299	Staphylococcus_phage	1.4e-19	38.1
WP_153925069.1\|1206004_1206430_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_153925072.1\|1206486_1206921_+	hypothetical protein	Q9T1Z1	Lactococcus_phage	2.2e-23	45.8
WP_153925075.1\|1207035_1208118_+\|integrase	tyrosine-type recombinase/integrase	A0A172LN96	Lactococcus_phage	5.6e-172	83.1
WP_019292338.1\|1208670_1209420_-	hypothetical protein	NA	NA	NA	NA
1208271:1208288	attR	NA	NA	NA	NA
WP_019292339.1\|1209416_1210304_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.9e-25	37.1
WP_017370945.1\|1210296_1210485_-	PLDc N-terminal domain-containing protein	NA	NA	NA	NA
WP_004256834.1\|1210509_1210845_-	putative DNA-binding protein	NA	NA	NA	NA
WP_004256833.1\|1211020_1211719_+	response regulator transcription factor	Q6XM27	Feldmannia_irregularis_virus	9.9e-05	24.8

DBSCAN-SWA_8

1235626 : 1245919

Prochlorococcus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019292359.1\|1235626_1237177_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.9e-73	46.7
WP_019335504.1\|1237217_1237760_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	1.7e-15	32.9
WP_153925094.1\|1237756_1238770_-	phosphoribosylformylglycinamidine cyclo-ligase	M4QRQ6	Synechococcus_phage	7.0e-60	40.8
WP_040087550.1\|1238762_1240178_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.8e-53	32.3
WP_153925098.1\|1240162_1242379_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	5.3e-153	41.4
WP_019292364.1\|1242375_1243056_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_019292365.1\|1243055_1243298_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_019292366.1\|1243353_1244070_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SEW9	Cyanophage	2.0e-45	44.5
WP_019292367.1\|1244174_1244600_-	ASCH domain-containing protein	NA	NA	NA	NA
WP_153925101.1\|1244616_1245078_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_019292369.1\|1245079_1245919_-	thymidylate synthase	A0A249XZR6	Enterococcus_phage	4.7e-86	58.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage