CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP045537	Bacillaceae bacterium C05 chromosome, complete genome	3 crisprs	cas3,csa3,WYL,DinG,RT,DEDDh,c2c9_V-U4	4	26	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045537_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045537_1

1271264-1271498

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP045537_1

>merge|NZ_CP045537|1|1271264-1271498|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGATTGTATGTTTACCTTCCGCATGAGAATAGGAGCCACCTGCTGTCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTTGCTTTTGTTTTTGATCCTTCTGCATGAGAGAAAGAACCTTTTGCATGTGTCAGAAGTCCTTCTGCATGTGAA

>NZ_CP045537|1|1|1271264-1271498|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGAT
TGTATGTTTACCTTCCGCATGAGAA	TAGGAGCCACCTGCTGTCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTTGCTTT
TGTTTTTGATCCTTCTGCATGAGAG	AAAGAACCTTTTGCATG
TGTCAGAAGTCCTTCTGCATGTGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045537.1\|WP_000043379.1\|1266498_1266897_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP045537.1\|WP_000872720.1\|1272202_1272943_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP045537.1\|WP_001004740.1\|1275262_1276021_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP045537.1\|WP_000427737.1\|1274320_1275256_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NZ_CP045537.1\|WP_000191110.1\|1267077_1267656_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP045537.1\|WP_001087862.1\|1279430_1280120_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|372616
NZ_CP045537.1\|WP_001180003.1\|1267802_1268174_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045537.1\|WP_000655329.1\|1273017_1274178_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP045537.1\|WP_000654997.1\|1280815_1281496_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP045537.1\|WP_000003390.1\|1263258_1265085_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP045537.1\|WP_001081482.1\|1268204_1268843_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP045537.1\|WP_001079095.1\|1269674_1270568_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP045537.1\|WP_000673184.1\|1268861_1269659_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP045537.1\|WP_000069694.1\|1277125_1278013_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999
NZ_CP045537.1\|WP_000799204.1\|1260338_1261883_+\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP045537.1\|WP_000360652.1\|1265605_1266499_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP045537.1\|WP_000932900.1\|1278178_1279279_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP045537.1\|WP_001272381.1\|1280116_1280803_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP045537.1\|WP_000428846.1\|1276157_1277003_-\|macrocin-O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP045537.1\|WP_000612264.1\|1261963_1263208_+\|competence-protein	unknown	unknown	gnl\|CDD\|226875

Protein	Function_ID	Function_description	E-value
NZ_CP045537.1\|WP_000043379.1\|1266498_1266897_-\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	2.09549e-70
NZ_CP045537.1\|WP_000872720.1\|1272202_1272943_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP045537.1\|WP_001004740.1\|1275262_1276021_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	4.45158e-20
NZ_CP045537.1\|WP_000427737.1\|1274320_1275256_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.2148e-22
NZ_CP045537.1\|WP_000191110.1\|1267077_1267656_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.78128e-83
NZ_CP045537.1\|WP_001087862.1\|1279430_1280120_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|372616	pfam13489, Methyltransf_23, Methyltransferase domain. This family appears to be a methyltransferase domain.	3.95233e-18
NZ_CP045537.1\|WP_000612264.1\|1261963_1263208_+\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	8.19935e-58
NZ_CP045537.1\|WP_000655329.1\|1273017_1274178_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	1.11727e-100
NZ_CP045537.1\|WP_000654997.1\|1280815_1281496_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	7.49705e-107
NZ_CP045537.1\|WP_000003390.1\|1263258_1265085_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP045537.1\|WP_001081482.1\|1268204_1268843_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NZ_CP045537.1\|WP_001079095.1\|1269674_1270568_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	6.99204e-99
NZ_CP045537.1\|WP_000673184.1\|1268861_1269659_+\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP045537.1\|WP_000069694.1\|1277125_1278013_-\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	1.15219e-17
NZ_CP045537.1\|WP_000799204.1\|1260338_1261883_+\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	0
NZ_CP045537.1\|WP_000360652.1\|1265605_1266499_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	2.84958e-93
NZ_CP045537.1\|WP_000932900.1\|1278178_1279279_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	6.83297e-53
NZ_CP045537.1\|WP_001272381.1\|1280116_1280803_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.7405e-109
NZ_CP045537.1\|WP_000428846.1\|1276157_1277003_-\|macrocin-O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	2.61854e-149

>NZ_CP045537.1|WP_001079095.1|1269674_1270568_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIDSAEEGTLVREFLKTKGISKAALTDIKFHGGSIEVNGQHASVRHQLQAGEELRVFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPAGSVANALLSHYDKRHLTSTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSVNHKTHVSLELDTGRTHQIRVHMAYIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFTTPIPSDMQAVLRHT
>NZ_CP045537.1|WP_000673184.1|1268861_1269659_+|NAD-kinase
MKFTIMSKGDQSSDALASTMKEYLLDFGFIMDEKEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYVNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP045537.1|WP_001081482.1|1268204_1268843_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP045537.1|WP_001180003.1|1267802_1268174_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKELSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP045537.1|WP_000191110.1|1267077_1267656_-|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFNTLCKSFSIEGFTKQVNHYFETPSFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVITADEARLMMETNTIIQGAVVDQLHTLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEEAGKAAFIHLLKQHDIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP045537.1|WP_000043379.1|1266498_1266897_-|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVDGHIREFVFERLALTAQHMVNTPDETGEI
>NZ_CP045537.1|WP_000360652.1|1265605_1266499_-|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLQGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSNIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP045537.1|WP_000003390.1|1263258_1265085_+|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDAEWEQEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLVQSVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP045537.1|WP_000612264.1|1261963_1263208_+|competence-protein
MIPIFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKEVLMRLGKQKRWHFAHKKVDSCLAFYEAESTYHMYGKELLYRWFKRQKVHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLCKRTYSYWKAGIQVIWIIGGNQLKKHSAYWMKFSSIMAFSLQSYPQPLLIFFCSKQKSFMKCTFITSFSTSVAFSHIIYLPIETTTFEMLFSPVPFQREVLNREWKKRKDYFRQNALPILNYNDKSLLRLLYQCKCTPANFPSEIGVPLPSSFAFQTNSFIWQAFLYMKCIGELAVGDCISLKYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYVGVLQRVGTYKYRKIRGISMLKTEEEVMKYDERSLAYALSLFEAKYNMREGKADIIKTDREGIT
>NZ_CP045537.1|WP_000799204.1|1260338_1261883_+|cardiolipin-synthase
MKNTLKLIFFVLLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLYDAVGSFKLSKSYIEELNDAGVEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGGLNIGDEYLGKDKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGEAVLAPEYLQAKAVEGEHWGGVQLVAGGPDNKWETIKHLYFAMIASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAGVKIYEYEKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKDDLEESSEIHVDRFHKRRLHRRIVESTYRLLSPLL
>NZ_CP045537.1|WP_000872720.1|1272202_1272943_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGKLTGLRYPEMEIVSVPSSLPFVPEKFRPIS
>NZ_CP045537.1|WP_000655329.1|1273017_1274178_-|rod-shape-determining-protein-RodA
MKDSNSQYQIDYVLLFILFAIGIVSCFAIASAQASLPSFLQHVNFVLKQIQWYFIGFIAIGIIMIIDFDRYQKIAWYLYSFALVLLIGLEFQVPGAVTIKGATAWYRLPGIGNFQPSEIMKLFLIIVIGRIIANHNEKYFYRTIQDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLASGIFAAGVTLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIIALFFLLIFRMIHIAIESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP045537.1|WP_000427737.1|1274320_1275256_-|glycosyltransferase-family-2-protein
MENIKNVPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIVGDDSTNNETEKLIYRDYLHKHKHITYIRNPSTLGQFHNALMLLEQSNGEYINFLMDDDIFYNNKIEKMMFYFQKDLDQNLALITSYRTWINDDGEIIEQHPSMNRLYDEDTLLNGKDLGNHMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLHSKKYGFLQETDYYKTSLLKACEWYKNATTFYQLYPELIPTTDTHTRLSHCLNIVTKELHAI
>NZ_CP045537.1|WP_001004740.1|1275262_1276021_-|class-I-SAM-dependent-methyltransferase
MNENEKKITLIPPPELVQYVGGHFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYFSDDGNYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVREIARVLKKDGRCFITFFLINPESSYYLNAGLSPLGFYHQIDNCYVLNKDIPNFAVAYLEEDIRTLLNKYGLEMQTPPHYGSWCGRTEHTSYQDIILTQKISER
>NZ_CP045537.1|WP_000428846.1|1276157_1277003_-|macrocin-O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYIENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVKENIEGDFIETGVWRGGSCIFMNGFLQANNIKDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPIEKIAIARLDGDMYESTMDSLVNLYDKVSIGGFIIIDDYGLITCAEAVTDFRSERNIKTPMTQIDDFGIFWRKE
>NZ_CP045537.1|WP_000069694.1|1277125_1278013_-|hypothetical-protein
MSNNNYSDGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTGPTVPTGPTGSTGPTGPTGSTGPTGPTGPTGDTGATGPTGPTGTTGPTGPTGDTGTTGPTGPTGDTGATGPTGPTGPTGPTGPTGPSGLGLPAGLYAFNSAGISLDLGLNAPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIVYTAALSVLGGLTIQVNGVSVPGTGATLISVGAPIVVQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKIA
>NZ_CP045537.1|WP_000932900.1|1278178_1279279_+|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEDTIGRCLDAVEKIVDEIIIVDTGSIDRTKEIVAQYTSNIYDFPWINDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKRELDPKIDAVSMPYHLALDSSGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGETFSSNVAITHKKEKKVTNRNLKIFQNAVAAGEELSPRDLFYYANESMDNQKYDDAVMLYETFLNQDEGWYEEKIYACGKLGDCYAKLGSWEKAIESCVKSFRYDVPRGENCTRIGYIYMEQQKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSKLGDQDKAYYYNELAAAYVPNNAAIEYNRKYFRSVFDKQYKSL
>NZ_CP045537.1|WP_001087862.1|1279430_1280120_+|class-I-SAM-dependent-methyltransferase
MNSPKNSLYEEKSGHYYNAVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMDMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKENGVILASIPNVAHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKVYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
>NZ_CP045537.1|WP_001272381.1|1280116_1280803_+|streptomycin-biosynthesis-protein-StrF
MSAGEKTILFVTCINDRKMYAQCVRHILRLAVPPGYIVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNVAFLYGLLQLFNEHEHLGMIGMIGAQYVPPNGIWNEGKGVVGKVIGYMNDLFYMATQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYDKYRKIFVENYMSDVNQDE
>NZ_CP045537.1|WP_000654997.1|1280815_1281496_+|streptomycin-biosynthesis-protein-StrF
MKDRTILVVVCVNNEELFEQCERQIRNLFVPPDYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTYLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRRNYQLLNLDQGFYGSQSFMSVQAIDGLFMATQYDIPWREDLFQGFHFYDVSQSLEFQRAGYLIGIPNQSNLWCIHYNGDEFDADTYEKDRKVFVEQYKDILSPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP045537_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045537_2

1492136-1493062

Orphan

Consensus_repeat	Method
CNCCTNNAGGTCCTTGAG	CRT

17 spacers

The CRISPR arrays of NZ_CP045537_2

>merge|NZ_CP045537|2|1492136-1493062|CRT
CGCCTGCCGGTCCTTGAGCACCAGTAGCGCCAGTAGCCCCTGCAGGCCCTTGAACACCTTGAGGCCCAGTAGCACCGGTAGCCCCTGCTGGTCCTTGAACGCCTTGAGGTCCTTGAGCACCAGTAGCCCCTGTTGCGCCTGCTGGTCCTTGAGGCCCAGTAGCCCCCGCTGGCCCTTGAACGCCTTGAGGTCCTTGAGCACCAGTAGCCCCTGCAGGCCCTTGAGCACCAGTAGCGCCAGTAGCCCCTGCAGGCCCTTGAACACCTTGAGGTCCTTGAGCACCAGTAGCACCAGTAGCGCCAGTAGCCCCTGCCGGCCCTTGAACACCTTGAGGTCCTTGAGCACCAGTAGCCCCCGCTGGCCCTTGAACGCCTTGAGGTCCTTGAGCACCAGTAGCCCCTGCAGGCCCTTGAACACCTTGAGGTCCTTGAGGCCCAGTAGCCCCCGCTGGCCCTTGAACACCTTGAGGTCCTTGAGCACCAGTAGCCCCTGTTGCGCCTGCTGGTCCTTGAGGCCCAGTAGCCCCCGCTGGCCCTTGAACACCTTGAGGTCCTTGAGCACCAGTAGCGCCAGTAGCACCTGCAGGCCCTTGAACGCCTTGAGCACCAGTAGCGCCAGTAGCCCCTGCAGGCCCTTGAACACCTTGAGGTCCTTGAGCACCAGTAGCGCCAGTAGCCCCTGCAGGCCCTTGAACGCCTTGAGCACCAGTAGCGCCAGTAGCCCCTGCTGGTCCTTGAACACCTTGAGCACCAGTAGCACCGGTAGCCCCTGCAGGTCCTTGAATACCTTGAGGCCCTTGAGGTCCAGTAGCGCCTTGAACACCTGCAGGTCCTTGAGCGCCTTGAGGTCCTTGAGGTCCAGTGGCACCTTGAGCGCCCGCTGGTCCTTGAGGCCCAGTAGCACCCGTAGCCCCCGCCGGTCCTTGAG

>NZ_CP045537|2|1|1492136-1493062|CRT
CGCCTGCCGGTCCTTGAG	CACCAGTAGCGCCAGTAGCCCCTGCAGGCCCTTGAACACCTTGAGGCCCAGTAGCACCGGTAGCCCCTGCTGGTCCTTGAA
CGCCTTGAGGTCCTTGAG	CACCAGTAGCCCCTGTTGCGCCTGCTGGTCCTTGAGGCCCAGTAGCCCCCGCTGGCCCTTGAA
CGCCTTGAGGTCCTTGAG	CACCAGTAGCCCCTGCAGGCCCTTGAGCACCAGTAGCGCCAGTAGCCCCTGCAGGCCCTTGAA
CACCTTGAGGTCCTTGAG	CACCAGTAGCACCAGTAGCGCCAGTAGCCCCTGCCGGCCCTTGAA
CACCTTGAGGTCCTTGAG	CACCAGTAGCCCCCGCTGGCCCTTGAA
CGCCTTGAGGTCCTTGAG	CACCAGTAGCCCCTGCAGGCCCTTGAA
CACCTTGAGGTCCTTGAG	GCCCAGTAGCCCCCGCTGGCCCTTGAA
CACCTTGAGGTCCTTGAG	CACCAGTAGCCCCTGTTG
CGCCTGCTGGTCCTTGAG	GCCCAGTAGCCCCCGCTGGCCCTTGAA
CACCTTGAGGTCCTTGAG	CACCAGTAGCGCCAGTAG
CACCTGCAGGCCCTTGAA	CGCCTTGAGCACCAGTAGCGCCAGTAG
CCCCTGCAGGCCCTTGAA	CACCTTGAGGTCCTTGAGCACCAGTAGCGCCAGTAG
CCCCTGCAGGCCCTTGAA	CGCCTTGAGCACCAGTAGCGCCAGTAG
CCCCTGCTGGTCCTTGAA	CACCTTGAGCACCAGTAGCACCGGTAG
CCCCTGCAGGTCCTTGAA	TACCTTGAGGCCCTTGAGGTCCAGTAGCGCCTTGAA
CACCTGCAGGTCCTTGAG	CGCCTTGAGGTCCTTGAGGTCCAGTGGCACCTTGAG
CGCCCGCTGGTCCTTGAG	GCCCAGTAGCACCCGTAG
CCCCCGCCGGTCCTTGAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045537.1\|WP_000769281.1\|1488936_1490979_+\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP045537.1\|WP_000735215.1\|1482948_1483467_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045537.1\|WP_000455755.1\|1486075_1486876_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP045537.1\|WP_001094859.1\|1496511_1496706_-\|DUF3924-domain-containing-protein	unknown	unknown	gnl\|CDD\|289807
NZ_CP045537.1\|WP_000797491.1\|1497463_1499275_-\|HAMP-domain-containing-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|274368
NZ_CP045537.1\|WP_000600590.1\|1484871_1485384_-\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_CP045537.1\|WP_000380271.1\|1486993_1487992_-\|inorganic-phosphate-transporter	unknown	unknown	gnl\|CDD\|376541
NZ_CP045537.1\|WP_000882907.1\|1485553_1485781_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045537.1\|WP_001265566.1\|1491074_1491503_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045537.1\|WP_000947712.1\|1483630_1484839_+\|NO-inducible-flavohemoprotein	unknown	unknown	gnl\|CDD\|237337
NZ_CP045537.1\|WP_000067567.1\|1504291_1504783_+\|DUF3907-family-protein	unknown	unknown	gnl\|CDD\|379028
NZ_CP045537.1\|WP_000110707.1\|1499431_1500139_-\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|180275
NZ_CP045537.1\|WP_000794508.1\|1481736_1482834_+\|site-2-protease-family-protein	unknown	unknown	gnl\|CDD\|100081
NZ_CP045537.1\|WP_000231448.1\|1488003_1488624_-\|DUF47-domain-containing-protein	unknown	unknown	gnl\|CDD\|224310
NZ_CP045537.1\|WP_000010861.1\|1501108_1503694_-\|bifunctional-lysylphosphatidylglycerol-flippase/synthetase-MprF	unknown	unknown	gnl\|CDD\|225451
NZ_CP045537.1\|WP_000232625.1\|1500315_1501104_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045537.1\|WP_000897343.1\|1495233_1496079_+\|DUF72-domain-containing-protein	unknown	unknown	gnl\|CDD\|224714
NZ_CP045537.1\|WP_000937008.1\|1493801_1495073_-\|PAS-domain-containing-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|236901
NZ_CP045537.1\|WP_000583786.1\|1503880_1504270_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045537.1\|WP_000806236.1\|1496825_1497356_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271192

Protein	Function_ID	Function_description	E-value
NZ_CP045537.1\|WP_000769281.1\|1488936_1490979_+\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP045537.1\|WP_001094859.1\|1496511_1496706_-\|DUF3924-domain-containing-protein	gnl\|CDD\|289807	pfam13062, DUF3924, Protein of unknown function (DUF3924). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length.	3.38461e-24
NZ_CP045537.1\|WP_000455755.1\|1486075_1486876_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	1.39624e-36
NZ_CP045537.1\|WP_000797491.1\|1497463_1499275_-\|HAMP-domain-containing-sensor-histidine-kinase	gnl\|CDD\|274368	TIGR02966, Phosphate_regulon_sensor_protein_PhoR, phosphate regulon sensor kinase PhoR. Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems].	2.68677e-61
NZ_CP045537.1\|WP_000600590.1\|1484871_1485384_-\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	1.19355e-21
NZ_CP045537.1\|WP_000380271.1\|1486993_1487992_-\|inorganic-phosphate-transporter	gnl\|CDD\|376541	pfam01384, PHO4, Phosphate transporter family. This family includes PHO-4 from Neurospora crassa which is a is a Na(+)-phosphate symporter. This family also contains the leukaemia virus receptor.	1.59802e-105
NZ_CP045537.1\|WP_000110707.1\|1499431_1500139_-\|purine-nucleoside-phosphorylase	gnl\|CDD\|180275	PRK05819, deoD, DeoD-type purine-nucleoside phosphorylase.	1.77954e-168
NZ_CP045537.1\|WP_000806236.1\|1496825_1497356_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	2.9028e-41
NZ_CP045537.1\|WP_000947712.1\|1483630_1484839_+\|NO-inducible-flavohemoprotein	gnl\|CDD\|237337	PRK13289, PRK13289, NO-inducible flavohemoprotein.	0
NZ_CP045537.1\|WP_000067567.1\|1504291_1504783_+\|DUF3907-family-protein	gnl\|CDD\|379028	pfam13047, DUF3907, Protein of unknown function (DUF3907). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 160 amino acids in length. There is a conserved AYTG sequence motif.	5.90717e-78
NZ_CP045537.1\|WP_000794508.1\|1481736_1482834_+\|site-2-protease-family-protein	gnl\|CDD\|100081	cd06160, S2P-M50_like_2, Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.	4.91946e-42
NZ_CP045537.1\|WP_000231448.1\|1488003_1488624_-\|DUF47-domain-containing-protein	gnl\|CDD\|224310	COG1392, COG1392, Phosphate transport regulator (distant homolog of PhoU) [Inorganic ion transport and metabolism].	6.30259e-51
NZ_CP045537.1\|WP_000010861.1\|1501108_1503694_-\|bifunctional-lysylphosphatidylglycerol-flippase/synthetase-MprF	gnl\|CDD\|225451	COG2898, COG2898, Uncharacterized conserved protein [Function unknown].	2.53664e-138
NZ_CP045537.1\|WP_000897343.1\|1495233_1496079_+\|DUF72-domain-containing-protein	gnl\|CDD\|224714	COG1801, COG1801, Uncharacterized conserved protein [Function unknown].	5.12551e-75
NZ_CP045537.1\|WP_000937008.1\|1493801_1495073_-\|PAS-domain-containing-sensor-histidine-kinase	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	1.11213e-65

>NZ_CP045537.1|WP_001265566.1|1491074_1491503_-|hypothetical-protein
MRVMSLIRIWFALMVCIILCVGFFLTLKYSTISKAERKTAPYKLLYTKQSNIPYSNSTNNEKRVIKGMLITKASSSEALLQIAETIKNQYTNKKIDEITLSIHNENNGNYEEELPYEPISKGRISVTYDSESYGSTNIILNE
>NZ_CP045537.1|WP_000769281.1|1488936_1490979_+|PBP1A-family-penicillin-binding-protein
MKLKNTHLKKMQEWFNKRKKLRNSLIVLGSLLATLFIAINIIISIQDISELKQAVPQPTLIYDANNEVATKLASSKTEGVKKKDIPDIMVQAIVAVEDKEFFNHHGIYYSGIISAVFKNITAGEVVAGGSTITQQLAKNVFLTQDRTYSRKIKEYFLTKKIERTYTKDEIIEMYMNQIYFGEGAWGIKRAAKSYFDKDVKDLTISEAATIAGLIKAPSAYSPYKNFNKSIERRNVVLSLMKEQGYISDEQYNKEKESGLVLKRGVDDKYKGKYSQYVDYIVREAMDKYELTQNEILAGGYRIYTELDPKKQQAVEDVVNNDSYFKDSGSDQLMQTGVVLMNPKTGGIPALVGGRGPYQFLQFNHATQLKRQPGSTLKPLAVYVPALEQGYEVYDILKDEPFNIKEYKPQNSDHTFHGDVTMYEAVAKSYNVSAVWLLEQIGLDKGLKSLERFGIPLVPEDRTYPIALGGMHVGTSPFVMAQAYSTFANDGVQVEAHAIREIQNAEGETLGKWYKKETRVTSEKVSQKMTYLLKGVVEKGTGEKAKVNNVDTAGKTGTTQIVNGPSTGAKDSWFVGYTPDLVGAIWVGYDKTDSDHYVPGGSQITTTMFRDIMKKANANPAQKAFQLSLISEADYKKQLTTIEEEKRRKEEEKRRKEEEQQRKQEQQEWLDKVKEWIPSFW
>NZ_CP045537.1|WP_000231448.1|1488003_1488624_-|DUF47-domain-containing-protein
MVFKSKKDKFSEMLMNVSENLKEGAQFFVEYKIKNASDLKEFSMRMKEYESKGDSFIHEIIMELNKAFITPIEREDILQLAMSMDDVLDGLDHSAGLFEMYSITEADEYMIKFVEAINQCAIEIANSVELMSNKKLVDIRTNAIKIKDYESQCDDIRRHAIKHLFSREKDPIKIIQYKEIYEELEEVADSCQSVANVLETIIMKNA
>NZ_CP045537.1|WP_000380271.1|1486993_1487992_-|inorganic-phosphate-transporter
MDTLLILTVLVVICALAFDFINGFHDTANAIATAVSTKALKPRHAIIMAAIMNFLGAMTFTGVAKTITKDIVDPFALQNGSLVILAALLAAIAWNLITWYYGIPSSSSHAIIGSIAGAAIAAAGFSSLNFKGFIKIIEALIISPIIAFVIGYIVYSIFKVVFKNFNLTKTNKNFRIFQIFTAALQAYTHGTNDAQKAMGIITMALMANSYHTSSDIPFWVQLSCAIAMGLGTSVGGWKIIKTVGGQIMKIRPVNGVAADLSSSLVIFGATFIHLPVSTTHVISSSILGVGASHRVKGVKWGTAKRMLITWVITLPISASLAALFYSLLHLIF
>NZ_CP045537.1|WP_000455755.1|1486075_1486876_-|sulfite-exporter-TauE/SafE-family-protein
MEYIMLLFIGLIAGTVGSLVGLGGGIIIVPLLIGLHSLSPQLAVGTSMVTVVFTGLSSTLTYMKHKRVDYKSGLILFIGSGPGGIIGSWANKFLKQDTFSLYFGIFLIFVSILLMLRDKLKPLSLSNMTVIKRSFTDNEGNTVHYQFPPLLAIFIAFIVGFISGLFGIGGGALLVPAMMLLFAFPAHIAVATSMFIVFLSAIVSSATHISLGNVSWIYALILIPGAWIGGKIGAYINTKLSGNAVINLLRITLIILGTRLIITSFL
>NZ_CP045537.1|WP_000882907.1|1485553_1485781_+|hypothetical-protein
MLDAIKMTDMRIPANAIIHVEEMKGGVVLSVEVDGQIIYTMAYDEETDSYAELYDRNDKRACQVHEDFMGWSLLH
>NZ_CP045537.1|WP_000600590.1|1484871_1485384_-|Crp/Fnr-family-transcriptional-regulator
MILHKGDVLFRQGEDGPLYFIKTGLLKVVRLEENGTPFLFNIIVPGETIPHHSLISPKEYHGTAIALMKTEVEPIMSNEWYDQLQADPASYANIAMQLQSKLRMMQQRIDQLTTVSPKERLHRLQEWFTLYLGDIPIYEILTQTEIGQLIGIRRETVNRLLREQIKNEVK
>NZ_CP045537.1|WP_000947712.1|1483630_1484839_+|NO-inducible-flavohemoprotein
MLSEKTIEIVKSTVPLLQEKGVEITTRFYEILFSEHPELLNIFNHTNQKKGRQQQALANAVYAAATYIDNLEAIIPVVKQIGHKHRSLGIKAEHYPIVGTCLLRAIKEVAGAPDEVLNAWGEAYGVIADAFISIEAEMYEEAAHKEGGWKDFRNFVVVKKVKESDVITSFYLKPEDGGKVSSFIPGQYVTVQINIEGETYTHNRQYSLSDAPGKEYYRISVKKEKGVDTPDGKVSNYLHEHVKEGDMLPVSAPAGDFVLNMDSTLPVVLISGGVGITPMMSMLNTLIEQDSKRNVCFVHAAINSNTHAMKEHVEAVDNEYEQVKAYTCYSAPTEKDLEMKNFDKEGFVEREWLQTIIPTTEAEFYFCGPIPFMKHINAVLTDLGVKQEHIHYEFFGPAASLQ
>NZ_CP045537.1|WP_000735215.1|1482948_1483467_+|hypothetical-protein
MKKLLNVFVIIIVMIIASYSLMKVLLHYANKPAEISTTAEIEDVQEETKVLDFIRMTHESYNNFLNYGKAENYTEGDWNQFKQWFQQQESSLKNIHTDIKNEKIKRDVNRSYEIVKKGVELQNIEYVVYAHRVYHDLDIIVNKYRGETNIWGYTEVGDGKDIRVIEQAIQSK
>NZ_CP045537.1|WP_000794508.1|1481736_1482834_+|site-2-protease-family-protein
MKNNKKGLWGILVAIGLFLLSKLKWVFAIFKLAKFSTVFSMFLSLGAYAVIYGWKFGVALIYLLFIHEMGHLWAAKRKGIPTSPAIFIPFMGALIGMKEMPKNAKDEAYIAYMGPLFGLLSFLPAIPLYMITKEPFWALIILLGSMINFFNLIPVSPLDGGRIISVVSTKIWGAGLVLLLGYSIYFKSILGGFIVIIGCMELYRVIKRDEPIKELGYKIDGMKEYVARLEEELKETGAVHRNIYMMQHEINVLRQKEREKELKTGEFQKIEVLEYLLPKFEPLDYVPYEDEKETHTIHIREAFEMSERKLEEWDAEKRQQENYYKVDTKTKWTVFACYIGLMAILGYVAYEGYIVLQEHLPTRNV
>NZ_CP045537.1|WP_000937008.1|1493801_1495073_-|PAS-domain-containing-sensor-histidine-kinase
MLPKDDIVSHEKRIDELENKVRFYEELVNQLPHHFTYKNPQIGLQIKKTRSTHSIQNIQKENKEADFQLTCDSLFLFKQLETYFVHIFDAFSHHVTFVDNKGNITLCNQAAADDFGVVRNDIIGKPIQQLLKLPEEKIKALETLRTGTEIYNEEVLDKNYGILNNRIIRDYNGEIFRVISVFHYLNTERDAEKFSLAGRIAAGIAHEVRNPLTTVRGYLQFLQETVSPSNKELFKNLLIPELDRANSIITKFLSISKTREFTREPFPINTFLREYIQQLLASEVFLHNISINYNFSTELDDILVHIDRHELVQVFLNLFQNAVDAQGEKKLSIQITSYRLDNFVRITFTDNGTGIPSAIQEYIFDPFFSTKDSGTGLGLAVTKKIIQNHNGTLKMTSNEDGTTFTISIPILPKTALERLNQDK
>NZ_CP045537.1|WP_000897343.1|1495233_1496079_+|DUF72-domain-containing-protein
MLFIGVTGWGDHDSLYIDPYENRNKLRTYSEYFPIVEVDSSFYAMQPARNYTKWAMETPKDFSFIVKAYQGMTGHMKGEVPFSTFDEMFDVYKQSILPLIEAGKLKTILFQYPPWFDCKKKNVDFLRYTKEKMEGLPCAIEFRNQTWFYPEMRDKTLQFLEQEKWIHTICDEPQAGMGSVPLVLEVTNAEMVLIRFHGRNVHGWLDKGENWRAVRCLYRYNNKELEEWVERLEQLKKQTKDIYVLFNNNSGGDAADNAKQLMKMMNITYGEPKPEQLNLFE
>NZ_CP045537.1|WP_001094859.1|1496511_1496706_-|DUF3924-domain-containing-protein
MNTLTIELPKETAEKLDLLKQAYEKKTGASISESTLVQTLISKEFIQAITPFDLQQFITSKEQH
>NZ_CP045537.1|WP_000806236.1|1496825_1497356_-|tyrosine-type-recombinase/integrase
MKQAGQPIQNEKQLETIKNILLQSSKRDGLLFVLAVNSGLKVSEILQLKVSDVIDENENVRHSILFYNEKVKKHKWFAVNEDLQHAIEDYMKERKTWKRNEPLLKSQKGTKSITRQHAWYILNKAAKEVGLEGISSHTLRKTWGYCAYKSGVDIAFLQHFFDHSTPSKTLKYIGIA
>NZ_CP045537.1|WP_000797491.1|1497463_1499275_-|HAMP-domain-containing-sensor-histidine-kinase
MKNRSIVFKLFLLTSTLFTIIFLLFFLGQSLFLEKFYINKKVKTVQTAFEDFVDTYEKSGKSYEEIRKLKQEFHDKTNADMQFLSPEGIIKSDNNYYIDVINPKNSEAYSIPLNNLLTPEEYKKFENLGLKKDDMINVVGWVRGKIITPLELTTSYNRWQNERINSDFSSINGNPSKNRITSRYKPVTQIEFTGIVSKLQLPSKADVRLANDFETLQAVQYFADIIRNGTANSHQLSYFLLDSEENIKNSIFVKPIMENGKITEYAFAIASLQPVNEAMLVLKDYYVYALIIVFLVIILLSFYYSKIIVKPLIKMNRVTKKMANFDFSEKLPVTADDEIGGLSGSINTLSVNLKDRIDRLNVANTKLQQDIERERQLEKTRKEFISGVSHELKTPLSVIRSFAEGIKDGVSKDTTYYTDVILEETENMNRLIVEMLELAKLESGTYKLDMTTFSIGELIQQVYTKLLFSMEEKHLQVNIDVDPSIFVKANRSRIEQVVVNLLSNAIRYTPDGEKIQVSVIEMEDTVKVEIENTGNPIPEDSLEKIWDRFYRLDASRSRHTGGTGLGLSIVKNILDLHHAEYGVYNTTNSVVFYFNLQKVKEVK
>NZ_CP045537.1|WP_000110707.1|1499431_1500139_-|purine-nucleoside-phosphorylase
MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQQ
>NZ_CP045537.1|WP_000232625.1|1500315_1501104_+|hypothetical-protein
MVGDVLKNLVIGLVALLFVVVGGFYIKKYQETTETVGDVQEVKWDVSNGKGNEKADILFQLLNNKNSEVRGVNDQIRAVIVDGQLKHVQQMKPAFAGNGSYKVSSKIAKDEGYTIFLYEDKNKSVQSFAKKDFGKEIEEKNKKKVKFPIDSVLTKKIGEYEVSLLFGALHPNEPVTLTFQFQAKKGEKLKLHAERGEVEALYIVDETRENFLYAIPVDTEGQLQYRITFPVEGTYKIWGDFYINGKKYEKEFIVQVQKRKNS
>NZ_CP045537.1|WP_000010861.1|1501108_1503694_-|bifunctional-lysylphosphatidylglycerol-flippase/synthetase-MprF
MSFSWKRFLQIGKIIFPFVVLTIVFFQAKKELAGISFLEAINTIKNIPTGGVFLAITLGAFAVSTMFFYDYVMLRYLKADIPVQKIFRISWIANTLNGFIGFGGLVGAGVRTMLYRPYIKENGKLIKSIAWMTTAFINGLAILSFLGLIGILDTSFILHEKPWLWPVLIFFALFVPIYIGFSKLKNRKPKQTEGQDEREEEKNPTVLYSLVSLVEWVSAGIVMYVILILFGIDIEFQKFLGVYVIAALAGVVSLVPGGLGSFDLVFLTGLGQYGIDTGVLLPAMLLYRLVYYILPFCLGLIFAAFEMTGVAIKKFEDKPFIAPALETTGVIWTLQRDFLGKLGSWASAALTVFAGLMVILSTILPTSINRAHALHILAPKHLIQFSFSLSLTFGILLLILSRGIYYGTKRSYYMTIISLIGAAIFNTLKGIDIEETFILLIVLAVLYMLRKRFVREKMEVSLSDIVKVFIFLLITLYLYKNLGILFAGAKEAFKPDFVVRNITQVKRSALAAAFFVPTFLLIGSLIANRYRNEFPGQPANDKRLQNFLDEHGGNVLSHLGFLGDKQFFFSSDGKALLLFSITGKRLVVLGDPIGDPSSYRTVLQEFLAEADRFGYICVFYQIESKWMSLYHDFGYNFFKLGEEAVVDLNTFTITGKKRAGMRATFNRFEREGYTFSIHQPPFSDELFEELKKVSDAWLGGKKEKSFSLGYFDREYISRAPIATLSDTDGKIIAFTTFMPVYQDGSLSVDLMRYYPDAPSGIMDAIFIHLFQWAKENEYHSFNIGMAPLSNVGLSTQSFWSERVAAAIFNNVRYTYSFSGLRHFKEKYKPTWSGKYLAFRKNHSLPITMLSVTKLIGKRKNS
>NZ_CP045537.1|WP_000583786.1|1503880_1504270_+|hypothetical-protein
MIIIGYAGYELEKAKPNTSEDFFNRSEVTYILNDKERTFSVLYVRYFEEVVQEITPFEGNPVCKVENQDIYLRDIVAICCLLKENELRMQKRLYLNNIEEFQQYFDEEIVVKVQEILAELHKNKRVEIE
>NZ_CP045537.1|WP_000067567.1|1504291_1504783_+|DUF3907-family-protein
MSNLMVENQTEQVSMFLEDVIHLITNYVNYHTLPSLLEETPAGNEQYYKGLLASIRRLLVFCEEGHDACFVLLNSQPFRKTAAEKILYKIYHQVIAEFFSPKSDHWYENSRSAYTGKNSIVFQQTPPASVEEVMKSLEGKFQLMREELEYYETDYQTKMLHKY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP045537_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045537_3

1608658-1611749

Orphan

Consensus_repeat	Method
CCNGTAGNTCCNGTNNNNCCNGT	CRT

46 spacers

The CRISPR arrays of NZ_CP045537_3

>merge|NZ_CP045537|3|1608658-1611749|CRT
CCCGTAGGTCCAGTGCTGCCGGTAGGTCCGGTGTTGCCAGTAGTCCCCGTTCTACCAGTGGGTCCAGTGCTGCCGGAAGGTCCAGTAGCTCCCGTAGGTCCAGTAATCCCAGTAGCTCCCGTAGGTCCGGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGGTCCAGTGATACCAGTAGGTCCGGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGAGCCAGTGTTGCCAGTAGGTCCGGTGTTGCCAGTAGGTCCGGTGTTACCAATAGCTCCAGTGTTCCCAGCAGGTCCGGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGAGCCAGTGTTGCCAGTAGGTCCGGTGTTGCCAGTAGGTCCGGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGGTCCAGTGATACCAGTAGGTCCGGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGCGCCAGTGTTCCCGGTAGGTCCAGTAGAGCCAGTGTTCCCAGTGTTCCCAGTGTTGCCGGTAGCGCCAGTAGTCCCAGTAACTCCAGTAGGTCCAGTGTTGCCGGTAGCGCCAGTAGGTCCGGTGATACCAGTGTTTCCGGTAGGTCCAGTGTCGCCGGTAGAGCCAGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGCGCCAGTGATACCAGTAGGTCCGGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGGTCCAGTGATACCAGTAGGTCCGGTAGCGCCAGTAGGTCCAGTGTCGCCGGTAGGTCCAGTGATACCAGTAGGTCCGGTGATACCAGTAGGTCCAGTAGGTCCAGTGTCGCCGGTAGGTCCAGTGATACCAGTAGGTCCGGTGATACCAGTAGGTCCAGTAGTCCCAGTAACTCCAGTAGGTCCAGTGTTGCCGGTGTTCCCAGTAGCTCCGGTAGGTCCGGTAGCGCCAGTAGGTCCAGTGTCGCCGGTAGGTCCGGTGATACCAGTAGGTCCAGTAGTCCCAGTAACTCCAGTAGGTCCAGTGTTGCCGGTGTTCCCAGTAGCTCCGGTAGGTCCGGTAGCGCCAGTAGGTCCAGAGTTTCCGGAAGGTCCGGTGATACCAGTAGGTCCAGTAACTCCAGTAGAGCCAGTGTTGCCGGTAGCTCCGGTAGGTCCGGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGGTCCAGTGATACCAGTAGGTCCGGTGTTACCAATAGCTCCAGTGTTCCCAGCAGGTCCGGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGAGCCAGTGTTCCCAGTAGGTCCGGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGGTCCAGTGATACCAGTAGGTCCGGTGTTTCCGGAAGGTCCGGTGTTTCCGGAAGGTCCGGTGTTTCCGGAAGGTCCAGTAGTCCCAGTAACTCCAGTAGGTCCAGTGTTCCCGGTAGGTCCAGTAGATCCAGTAGGTCCGGTGTTTCCGGAAGGTCCAGTAGATCCAGTAGAGCCAGTGTCGCCCGTAGGTCCGGTGTTGCCAGTAGGTCCAGTAGTCCCAGTAACTCCAGTAGGTCCAGTGTTGCCGGTGTTTCCGGAAGGTCCGGTGTTTCCGGAAGGTCCGGTGTTTCCGGAAGGTCCGGTGTTTCCGGAAGGTCCAGTAGTCCCAGTAACTCCAGTAGGTCCAGTGTTCCCGGTAGGTCCAGTAGATCCAGTAGGTCCGGTGTTTCCGGAAGGTCCAGTAGTCCCAGTAACTCCAGTAGAGCCAGTGTCGCCCGTAGGTCCGGTGATCCCAGTATCGCCAGTAGGTCCAGTGTCGCCGGTAGCTCCGGTGTTGCCGGTAGGTCCAGTAGTCCCAGTAACTCCAGTAGGTCCAGTGTTGCCGGTAGGTCCAGTAGATCCAGTAGAGCCAGTGTTGCCCGTAGGTCCGGTGTTCCCAGTAGGTCCAGTAGTCCCAGTAGGTCCAGTAGTCCCAGTAACTCCAGTAGAGCCAGTGTTGCCGGTAGGTCCAGTAGGTCCAGTGTCGCCGGTAGCTCCAGTGATCCCAGTAGGTCCGGTGATCCCAGTAGGTCCAGTAGTCCCAGTAGAGCCAGTGTTGCCGGTAGGTCCGGTGTTGCCGGTAGGTCCAGTAGTCCCAGTAACTCCAGTAGGTCCAGTGTTGCCGGTAGGTCCAGTAGATCCAGTAGGTCCGGTGTTCCCGGTAGGTCCAGTAATCCCAGTAACTCCAGTAGGTCCAGTGTTGCCAGTAGGTCCAGTAGATCCAGTAGAGCCAGTGTCGCCCGTAGGTCCGGTGTTCCCAGTATCGCCAGTAGGTCCAGTGTCGCCGGTAGCTCCAGTGTTCCCAGTAGGTCCGGTGTTGCCGGTAGGTCCGGTGTTGCCGGTAGGTCCGGTGTTCCCAGTAGGTCCAGTGTCGCCGGTAGCTCCAGTGATCCCAGTAGGTCCAGTAGTCCCAGTAGTCCCAGTAACTCCAGTAGGTCCAGTGTTCCCGGTAGGTCCAGTAGTCCCAGTAACTCCAGTAGAGCCAGTGTCGCCCGTAGGTCCGGTGTTCCCAGTAGGTCCAGTGTCGCCGGTAGCTCCAGTGATCCCAGTAGGTCCGGTGATCCCAGTAGGTCCAGTAGTCCCAGTAACTCCAGTAGGTCCGGTGTTTCCGGTAGGTCCGGTGTTTCCGGAAGGTCCAGTAGTCCCAGTAGATCCAGTAGGTCCAGTGTCGCCGGTAGCTCCAGTGATACCAGTAGGTCCGGTGATCCCAGTAGGTCCAGTAGTCCCAGTAACTCCAGTAGAGCCAGTGTTGCCGGTAGCTCCGGTAGGTCCGGTAGCGCCAGTAGGTCCAGAGTTTCCGGAAGGTCCGGTGATCCCAGTAGGTCCAGTAACTCCAGTAGAGCCAGTGTTGCCGGTAGCTCCGGTAGGTCCGGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGCTCCAGTATCGCCAGTAGGTCCGGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGCTCCAGTGATACCAGTAGGTCCGGTGTTGCCAGTAGGTCCAGTGTTGCCGGTAGCTCCGGTAGGTCCGGTGTTGCCAGTAGGTCCGGTGTTACCAATAGCTCCAGTGTTGCCAGTAGGTCCGGT

>NZ_CP045537|3|2|1608658-1611749|CRT
CCCGTAGGTCCAGTGCTGCCGGT	AGGTCCGGTGTTGCCAGTAGTCCCCGTTCTA
CCAGTGGGTCCAGTGCTGCCGGA	AGGTCCAGTAGCTCCCGTAGGTCCAGTAATCCCAGTAGCT
CCCGTAGGTCCGGTGTTGCCAGT	AGGTCCAGTGTCGCCGGTAGGTCCAGTGATA
CCAGTAGGTCCGGTGTTGCCAGT	AGGTCCAGTGTCGCCGGTAGAGCCAGTGTTG
CCAGTAGGTCCGGTGTTGCCAGT	AGGTCCGGTGTTACCAATAGCTCCAGTGTTC
CCAGCAGGTCCGGTGTTGCCAGT	AGGTCCAGTGTCGCCGGTAGAGCCAGTGTTG
CCAGTAGGTCCGGTGTTGCCAGT	AGGTCCGGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGGTCCAGTGATA
CCAGTAGGTCCGGTGTTGCCAGT	AGGTCCAGTGTCGCCGGTAGCGCCAGTGTTCCCGGTAGGT
CCAGTAGAGCCAGTGTTCCCAGT	GTTCCCAGTGTTGCCGGTAGCGCCAGTAGTCCCAGTAACTCCAGTAGGTCCAGTGTTGCCGGTAGCG
CCAGTAGGTCCGGTGATACCAGT	GTTTCCGGTAGGTCCAGTGTCGCCGGTAGAGCCAGTGTTGCCAGTAGGTCCAGTGTCG
CCGGTAGCGCCAGTGATACCAGT	AGGTCCGGTGTTGCCAGTAGGTCCAGTGTCG
CCGGTAGGTCCAGTGATACCAGT	AGGTCCGGTAGCGCCAGTAGGTCCAGTGTCG
CCGGTAGGTCCAGTGATACCAGT	AGGTCCGGTGATACCAGTAGGTCCAGTAGGTCCAGTGTCG
CCGGTAGGTCCAGTGATACCAGT	AGGTCCGGTGATACCAGTAGGTCCAGTAGTCCCAGTAACT
CCAGTAGGTCCAGTGTTGCCGGT	GTTCCCAGTAGCTCCGGTAGGTCCGGTAGCG
CCAGTAGGTCCAGTGTCGCCGGT	AGGTCCGGTGATACCAGTAGGTCCAGTAGTCCCAGTAACT
CCAGTAGGTCCAGTGTTGCCGGT	GTTCCCAGTAGCTCCGGTAGGTCCGGTAGCG
CCAGTAGGTCCAGAGTTTCCGGA	AGGTCCGGTGATACCAGTAGGTCCAGTAACT
CCAGTAGAGCCAGTGTTGCCGGT	AGCTCCGGTAGGTCCGGTGTTG
CCAGTAGGTCCAGTGTCGCCGGT	AGGTCCAGTGATACCAGTAGGTCCGGTGTTACCAATAGCTCCAGTGTTC
CCAGCAGGTCCGGTGTTGCCAGT	AGGTCCAGTGTCGCCGGTAGAGCCAGTGTTC
CCAGTAGGTCCGGTGTTGCCAGT	AGGTCCAGTGTCGCCGGTAGGTCCAGTGATA
CCAGTAGGTCCGGTGTTTCCGGA	AGGTCCGGTGTTTCCGGAAGGTCCGGTGTTTCCGGAAGGTCCAGTAGTCCCAGTAACT
CCAGTAGGTCCAGTGTTCCCGGT	AGGTCCAGTAGATCCAGTAGGTCCGGTGTTTCCGGAAGGTCCAGTAGATCCAGTAGAGCCAGTGTCG
CCCGTAGGTCCGGTGTTGCCAGT	AGGTCCAGTAGTCCCAGTAACTCCAGTAGGTCCAGTGTTGCCGGTGTTT
CCGGAAGGTCCGGTGTTTCCGGA	AGGTCCGGTGTTTCCGGAAGGTCCGGTGTTTCCGGAAGGTCCAGTAGTCCCAGTAACT
CCAGTAGGTCCAGTGTTCCCGGT	AGGTCCAGTAGATCCAGTAGGTCCGGTGTTTCCGGAAGGTCCAGTAGTCCCAGTAACTCCAGTAGAGCCAGTGTCG
CCCGTAGGTCCGGTGATCCCAGT	ATCGCCAGTAGGTCCAGTGTCGCCGGTAGCTCCGGTGTTG
CCGGTAGGTCCAGTAGTCCCAGT	AACTCCAGTAGGTCCAGTGTTGCCGGTAGGTCCAGTAGATCCAGTAGAGCCAGTGTTGCCCGTAGGTCCGGTGTTC
CCAGTAGGTCCAGTAGTCCCAGT	AGGTCCAGTAGTCCCAGTAACTCCAGTAGAGCCAGTGTTG
CCGGTAGGTCCAGTAGGTCCAGT	GTCGCCGGTAGCTCCAGTGATCCCAGTAGGTCCGGTGATC
CCAGTAGGTCCAGTAGTCCCAGT	AGAGCCAGTGTTGCCGGTAGGTCCGGTGTTG
CCGGTAGGTCCAGTAGTCCCAGT	AACTCCAGTAGGTCCAGTGTTGCCGGTAGGTCCAGTAGATCCAGTAGGTCCGGTGTTC
CCGGTAGGTCCAGTAATCCCAGT	AACTCCAGTAGGTCCAGTGTTG
CCAGTAGGTCCAGTAGATCCAGT	AGAGCCAGTGTCGCCCGTAGGTCCGGTGTTC
CCAGTATCGCCAGTAGGTCCAGT	GTCGCCGGTAGCTCCAGTGTTCCCAGTAGGT
CCGGTGTTGCCGGTAGGTCCGGT	GTTGCCGGTAGGTCCGGTGTTCCCAGTAGGT
CCAGTGTCGCCGGTAGCTCCAGT	GATCCCAGTAGGTCCAGTAGTCCCAGTAGTCCCAGTAACTCCAGTAGGT
CCAGTGTTCCCGGTAGGTCCAGT	AGTCCCAGTAACTCCAGTAGAGCCAGTGTCGCCCGTAGGT
CCGGTGTTCCCAGTAGGTCCAGT	GTCGCCGGTAGCTCCAGTGATCCCAGTAGGT
CCGGTGATCCCAGTAGGTCCAGT	AGTCCCAGTAACTCCAGTAGGT
CCGGTGTTTCCGGTAGGTCCGGT	GTTTCCGGAAGGTCCAGTAGTCCCAGTAGATCCAGTAGGT
CCAGTGTCGCCGGTAGCTCCAGT	GATACCAGTAGGTCCGGTGATCCCAGTAGGTCCAGTAGTCCCAGTAACTCCAGTAGAG
CCAGTGTTGCCGGTAGCTCCGGT	AGGTCCGGTAGCGCCAGTAGGTCCAGAGTTTCCGGAAGGTCCGGTGATCCCAGTAGGTCCAGTAACTCCAGTAGAG
CCAGTGTTGCCGGTAGCTCCGGT	AGGTCCGGTGTTGCCAGTAGGTCCAGTGTCGCCGGTAGCTCCAGTATCGCCAGTAGGTCCGGTGTTGCCAGTAGGT
CCAGTGTCGCCGGTAGCTCCAGT	GATACCAGTAGGTCCGGTGTTGCCAGTAGGTCCAGTGTTGCCGGTAGCTCCGGTAGGTCCGGTGTTGCCAGTAGGTCCGGTGTTACCAATAGCT
CCAGTGTTGCCAGTAGGTCCGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045537.1\|WP_000358801.1\|1633413_1633590_+\|zinc-finger-domain-containing-protein	unknown	unknown	gnl\|CDD\|378493
NZ_CP045537.1\|WP_000451811.1\|1601007_1601280_+\|YpbS-family-protein	unknown	unknown	gnl\|CDD\|313867
NZ_CP045537.1\|WP_000806353.1\|1628667_1629228_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496
NZ_CP045537.1\|WP_001026467.1\|1632104_1632590_+\|QueT-transporter-family-protein	unknown	unknown	gnl\|CDD\|377623
NZ_CP045537.1\|WP_000961781.1\|1601282_1602116_+\|sulfurtransferase	unknown	unknown	gnl\|CDD\|225450
NZ_CP045537.1\|WP_000573873.1\|1630591_1630978_-\|reverse-transcriptase-like-protein	unknown	unknown	gnl\|CDD\|139967
NZ_CP045537.1\|WP_001228040.1\|1607738_1607879_+\|FbpB-family-small-basic-protein	unknown	unknown	gnl\|CDD\|379027
NZ_CP045537.1\|WP_000570996.1\|1627772_1628633_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|380091
NZ_CP045537.1\|WP_000169020.1\|1603207_1603519_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045537.1\|WP_001195212.1\|1629409_1629670_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045537.1\|WP_000219276.1\|1600518_1600977_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP045537.1\|WP_000127427.1\|1631048_1631921_-\|aldose-1-epimerase-family-protein	unknown	unknown	gnl\|CDD\|185701
NZ_CP045537.1\|WP_000875518.1\|1632741_1633401_+\|reverse-transcriptase-like-protein	unknown	unknown	gnl\|CDD\|181088
NZ_CP045537.1\|WP_000757057.1\|1606688_1607555_+\|5'-3'-exonuclease	unknown	unknown	gnl\|CDD\|214682
NZ_CP045537.1\|WP_000084959.1\|1603522_1604761_+\|glutathionylspermidine-synthase	unknown	unknown	gnl\|CDD\|367631
NZ_CP045537.1\|WP_000606860.1\|1604753_1605140_+\|DUF350-domain-containing-protein	unknown	unknown	gnl\|CDD\|226289
NZ_CP045537.1\|WP_000711147.1\|1629672_1630578_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP045537.1\|WP_000964970.1\|1605832_1606558_+\|magnesium-transporter	unknown	unknown	gnl\|CDD\|319772
NZ_CP045537.1\|WP_154981882.1\|1612628_1627661_-\|DUF11-domain-containing-protein	unknown	unknown	gnl\|CDD\|273634
NZ_CP045537.1\|WP_001235528.1\|1602674_1603124_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP045537.1\|WP_000358801.1\|1633413_1633590_+\|zinc-finger-domain-containing-protein	gnl\|CDD\|378493	pfam10782, zf-C2HCIx2C, Zinc-finger. This bacterial family of proteins is a zinc-finger domain of the C2HC type with an additional cysteine.	3.60744e-25
NZ_CP045537.1\|WP_000451811.1\|1601007_1601280_+\|YpbS-family-protein	gnl\|CDD\|313867	pfam10752, DUF2533, Protein of unknown function (DUF2533). This family of proteins with unknown function appears to be restricted to Bacillus spp.	1.15058e-37
NZ_CP045537.1\|WP_000806353.1\|1628667_1629228_-\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	2.6776e-46
NZ_CP045537.1\|WP_001026467.1\|1632104_1632590_+\|QueT-transporter-family-protein	gnl\|CDD\|377623	pfam06177, QueT, QueT transporter. This family includes the queT gene encoding a hypothetical integral membrane protein with 5 predicted transmembrane regions. The queT genes in Firmicutes are often preceded by the PreQ1 (7-aminomethyl-7-deazaguanine) riboswitches of two distinct classes, suggesting involvement of the QueT transporters in uptake of a queuosine biosynthetic intermediate.	1.68104e-29
NZ_CP045537.1\|WP_000961781.1\|1601282_1602116_+\|sulfurtransferase	gnl\|CDD\|225450	COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism].	5.10825e-96
NZ_CP045537.1\|WP_001228040.1\|1607738_1607879_+\|FbpB-family-small-basic-protein	gnl\|CDD\|379027	pfam13040, Fur_reg_FbpB, Fur-regulated basic protein B. This family of proteins is regulated by the ferric uptake regulator protein Fur. This family represses expression of the lutABC operon encoding iron sulfur-containing enzymes necessary for growth on lactate.	3.47945e-05
NZ_CP045537.1\|WP_000570996.1\|1627772_1628633_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|380091	pfam18014, Acetyltransf_18, Acetyltransferase (GNAT) domain. This entry represents a likely acetyltransferase enzyme that is related to pfam06852.	1.47074e-45
NZ_CP045537.1\|WP_000757057.1\|1606688_1607555_+\|5'-3'-exonuclease	gnl\|CDD\|214682	smart00475, 53EXOc, 5'-3' exonuclease.	6.23868e-107
NZ_CP045537.1\|WP_000573873.1\|1630591_1630978_-\|reverse-transcriptase-like-protein	gnl\|CDD\|139967	PRK13907, rnhA, ribonuclease H; Provisional.	5.90582e-90
NZ_CP045537.1\|WP_000219276.1\|1600518_1600977_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.40728e-16
NZ_CP045537.1\|WP_000127427.1\|1631048_1631921_-\|aldose-1-epimerase-family-protein	gnl\|CDD\|185701	cd09024, Aldose_epim_lacX, Aldose 1-epimerase, similar to Lactococcus lactis lacX. Proteins similar to Lactococcus lactis lacX are uncharacterized members of aldose-1-epimerase superfamily. Aldose 1-epimerases or mutarotases are key enzymes of carbohydrate metabolism, catalyzing the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose. This interconversion is an important step that allows anomer specific metabolic conversion of sugars. Studies of the catalytic mechanism of the best known member of the family, galactose mutarotase, have shown a glutamate and a histidine residue to be critical for catalysis; the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen.	5.88349e-155
NZ_CP045537.1\|WP_000875518.1\|1632741_1633401_+\|reverse-transcriptase-like-protein	gnl\|CDD\|181088	PRK07708, PRK07708, hypothetical protein; Validated.	2.21317e-132
NZ_CP045537.1\|WP_000084959.1\|1603522_1604761_+\|glutathionylspermidine-synthase	gnl\|CDD\|367631	pfam03738, GSP_synth, Glutathionylspermidine synthase preATP-grasp. This region contains the Glutathionylspermidine synthase enzymatic activity EC:6.3.1.8. This is the C-terminal region in bi-enzymes. Glutathionylspermidine (GSP) synthetases of Trypanosomatidae and Escherichia coli couple hydrolysis of ATP (to ADP and Pi) with formation of an amide bond between spermidine and the glycine carboxylate of glutathione (gamma-Glu-Cys-Gly). In the pathogenic trypanosomatids, this reaction is the penultimate step in the biosynthesis of the antioxidant metabolite, trypanothione (N1,N8-bis-(glutathionyl)spermidine), and is a target for drug design. This region, the pre-ATP grasp region, probably carries the substrate-binding site.	4.44931e-63
NZ_CP045537.1\|WP_000606860.1\|1604753_1605140_+\|DUF350-domain-containing-protein	gnl\|CDD\|226289	COG3766, COG3766, Predicted membrane protein [Function unknown].	1.63885e-25
NZ_CP045537.1\|WP_000711147.1\|1629672_1630578_-\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	7.55239e-13
NZ_CP045537.1\|WP_000964970.1\|1605832_1606558_+\|magnesium-transporter	gnl\|CDD\|319772	cd02077, P-type_ATPase_Mg, magnesium transporting ATPase (MgtA), similar to Escherichia coli MgtA and Salmonella typhimurium MgtA. MgtA is a membrane protein which actively transports Mg(2+) into the cytosol with its electro-chemical gradient rather than against the gradient as other cation transporters do. It may act both as a transporter and as a sensor for Mg(2+). In Salmonella typhimurium and Escherichia coli, the two-component system PhoQ/PhoP regulates the transcription of the mgtA gene by sensing Mg(2+) concentrations in the periplasm. MgtA is activated by cardiolipin and it highly sensitive to free magnesium in vitro. It consists of a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	3.35244e-35
NZ_CP045537.1\|WP_154981882.1\|1612628_1627661_-\|DUF11-domain-containing-protein	gnl\|CDD\|273634	TIGR01451, unnamed_protein_product, conserved repeat domain. This model represents the conserved region of about 53 amino acids shared between regions, usually repeated, of proteins from a small number of phylogenetically distant prokaryotes. Examples include a 132-residue region found repeated in three of the five longest proteins of Bacillus anthracis, a 131-residue repeat in a cell wall-anchored protein of Enterococcus faecalis, and a 120-residue repeat in Methanobacterium thermoautotrophicum. A similar region is found in some Chlamydial outer membrane proteins.	1.10822e-09

>NZ_CP045537.1|WP_001228040.1|1607738_1607879_+|FbpB-family-small-basic-protein
MRKKVRKSFKQLLIENKQLLLSNKENMKEIEERIEKRHVAYGVGNN
>NZ_CP045537.1|WP_000757057.1|1606688_1607555_+|5'-3'-exonuclease
MKKVLLVDGMALLFRAFYATSVYGQFMKRQDGTPTNGIHGYMKHLLTAMQAIEPTHIVTCWDMGSTTFRTESFSNYKANRAAPPEELIPQFDLVQEMTVKLSVPVIGMKGYEADDCIGTLAKQYCNEAEVYILTGDTDLLQLVDKNVTVMLLRKGIGNYEYYTPEKIMEEKGVEPWQIVHAKAFMGDTSDNYPGVKGIGEKTAYKLIQEHGTVATVLENVAALTKAQRTKIESDLENLNISLQLAQIHCEVPISCSLEEGLHTIDEEKLRFVCEEMNWGRPEILINML
>NZ_CP045537.1|WP_000964970.1|1605832_1606558_+|magnesium-transporter
MLYANKTVGNTSYKLSKKSMKEQTMLQKNKDLLIEIATRDVKSVFAYFKTTRDGLSMKEAQKRIQVYGRNELTSKRARIAEVMMKLGGMIPGFSKQHVRDGLQCEKITVSRVECSSVTGLNGELKMMDLPVQELVPGDMIFLSEGDTVPADVRIIYANDLLVNESVLTGNDASVEKFESCYHLERKRFIPLKRMKDYNPLELENVCFKGTYIVSGNAKAVVVSTGKNTYTGILHTCCSKTS
>NZ_CP045537.1|WP_000606860.1|1604753_1605140_+|DUF350-domain-containing-protein
MINFLLYLAVTLGLLCIGLFLMEVTTKVKEFKLMAQGNKAVSYVLGGRLLGLAIVLYSTAANSISLLDMVSWGAVGILAQIIVFYLAEWLTPRFNINKSLEEDNQAVGLFLMFLSLSIGIVIAGCITY
>NZ_CP045537.1|WP_000084959.1|1603522_1604761_+|glutathionylspermidine-synthase
MSQYIRDRKEFYSKYQDFWSDLYECEYSLFHVFPITNETMKQLQVATERMGKIFFKTARLLRNLSDEQLLELGFPPASLSFIRMKGLYPESVISRFDFVLTGDNQIKMLEFNSDTPTFIMECFQMNGEVCKKLGYDDPNLGQERLLSSGVTKAVMEATKGIDNPNVVFTAHHEHIEDWNTTMYLSQLCRVENKVVPMSELRITKDSLVDRDGVQIDVLYRQTYPIEDLIEDQDPETGDLVGVELLQLVKAGKLFIINPLSAFLLQPKSVQCLIWGLAEEEVFYTNEERQWIKEYMLPTYLEPDLFLGKGSFVRKPSFGREGDTITIRDKDENIMIQNAHQTYKASLPIFQKYTELPVVTLETEKGMEKLSYVFGSFLIAGKASSIGIRAGEKITGNESYYLPVGINKEEVYD
>NZ_CP045537.1|WP_000169020.1|1603207_1603519_+|hypothetical-protein
MTKTKWLVGGVVTSLMTGTLFGCAQDLPPKPNDKSCADWDWDDELGVWQCDDSSSGYRGHYFYGGRYYQNKSTFKNSSAFKSYQSSAEFKGGIGSGSKGGFGG
>NZ_CP045537.1|WP_001235528.1|1602674_1603124_-|hypothetical-protein
MRLEYRLNDETKGYPALWNYANISNSETIARMTCEYFIKDKNTYVVTATSVDPDGTAVIYIQQETFSNDPSDPTYFHIGFEIRELKDTSSNLIESKDVWNYEEILPYLHSDIIYIQQDGMHMEFTLDSREIDEDRKCYIYYGNFTGESR
>NZ_CP045537.1|WP_000961781.1|1601282_1602116_+|sulfurtransferase
MLVTVEWLREHIEDENVRIIDCRFDLANPNWGREKYEEEHIPHALYFDLNVDLSSPITEHGGRHPLPNIEEFADKLSRAGIDEHTTVIAYDSEAGANASRLWWLLNYVGHEKVYILDGGFPAWKENGLPVTTEISVAKRKAFKANVQNHMLVTMETVRENIYAGADVTLIDSREPKRYAGVEELVDPKAGHIPTAVNYFWKDGMLQSGQFKNEAQQQERFQNLSKDKETIVYCGSGVTACPNIVALKLAGFQNVKLYAGSWSDWISYPENQIAKEED
>NZ_CP045537.1|WP_000451811.1|1601007_1601280_+|YpbS-family-protein
MEVHKAITAHSRKQNESVKACLQLDAQREAAIEAAVSLASNGKEFSVDVINVVTKQINALAKNGVTLERKYVTKEMVMEYVSRLKEKEGR
>NZ_CP045537.1|WP_000219276.1|1600518_1600977_+|GNAT-family-N-acetyltransferase
MTVVIERISKEAIPKSLLLLADPSEQQVATYVQRGVTYVAKQEDNVIGVYVILETRPKTMEIMNIAVVEHLQGKGIGKKLLSHAIETAKGYGMSKLEVGTGNSSVSQLAFYQKCGFRIFSIDFDYFSKHYEEEIIENGIVCRDMIRLAMELN
>NZ_CP045537.1|WP_154981882.1|1612628_1627661_-|DUF11-domain-containing-protein
MPITNRFSTTTNGALAITGNTLGLSKISNQNRAGTIGAIGAFITTNTALQVTSFPAGTTLNYTQNSSTALLNIPAGSTILYAELVWGGNYLSRDQNITNVLGNPVSFTTPVSTYSITPSAVTASNQTFVSGSITFGFYTRSADVTSLIQAGGSGSYTTGSVPGLVDPIDASNGTINSAGWTLIVAYQNGTLPARNLTIYVAGNRVSAETGSADVSVSGFLTPSGGPVSGRLFLSSTEGDADLIGDQALFGPNFSSLNALSGPNNAVNNFFGSQINNAAGNLDTTGTFGTRNQSASTGTNISAGRQGWDITSIDISPYLTNSQVSAAIRLTTNGDAYMLNTVGLQININSPNIQATKSVNKSVAAIGDVLTYTVTIPNTGLLPANNVIFTDILPNGTSFIPGTVTVDNVPQTNANPAAGISLGTINNSASRTVTFQATVVSFPNQNPISNTANITFQYTPIAGGTTFNGLATSNSAGTQVNLADINGTKSVNKLFTDIGETLTYSIALANIGNIAATNVIYTDPIPSGTTFVPGSVTVNGITQAGANPANGISIGSIAANSTTTISFQVSVPSIPQTNPILNSGTTTYQYIPVPNQPAVSGTDTTNIVSTQVNNATVTMTKAVDKNFADIGDTLTYTVSFTGTGNTSANNVMFTDAIPTGTTFVLNSLTIDGTTQVGANPANGVNIGAIPTGTTKNVSFQVVVNTIPALNVVSNGSSASYQYTVNPSQSPVTKNISSNLVSTQINNANLALTKSTNKQFATIGETISYTILITNNGNTAATNVQLTDPLPNGTILTPGSVTLNGILQNVDSLVALPIGTIPGGATFTLSFQVTVINITAQNPIINNAFASYLYTVNPSLPPNSKTANSNSVTSTIRLANLQATKSVDKTFAEVGDILTYTFALTNNGNVTANNVLLSDSIANGTSFVPNSVIVNGVNQPGATPASINIGSINANTTITASFQVLITSIPNPNPISNSASISYNFIVDPNASPVSKNTTSTTTFTQVNDANVISAKTVDKGFATVGDVLTYTVVLTNAGSVSADSPTFVDTNPDGTTFIQNTFLINGVLQNNADPNVGVPLPSIPANGSLTVSYQVTVTSLPTQNPTINSSSTQYSFILNPGDPPTIETSLSNTVSTQINVANVVIVKQVDVTIADVGQPITYTIALANPGNTPANNVVVTDILPSGTTLVPNSTFIGGALQLGADPSTGLQVGTIPAGGFTTIVFQISASSLPTQNPIQNSAALQYNFIADPNLPAVVRNATSNIVTTQINTANIVATKLTSTNFADVGDVITYATILTNNGNIPASNVTFTDIIPAGTIFLPNTVTINGVPIANANPANGILIGTIGANSSRTVSFQVSVPTIPSPNPITNQSSTTFQYTYDASKPVVTQMLASNTVQTTINNATIAAVKSADKQFANVNDMITYTTTLTNNGNTLASNVIFTDVIPNGTSFIPNSVTVNGNTLPNTNPASGIAIDPINPNTSATISFQIIVNSIPSPNPIPNQSNTAYQYVIDPNLPPASANALSNVITTQINNATIVATKSVNTPTAAIGDIVTYTIAVTNTGNIPASATVLTDGLGAGASFVQNSVTINNIPQPGLDPSLGIHLADIPPGDTVFITFQAQILAIPPSGTLTNNALVNYEYTVNPNQSPAVNSTITNTTVTPIIDATLVLNKNASTTFATIGDTITFTSSVTNTGNTTANNIVFTDSIPNGTAFVPNSFKINGVTVPNANPQNGINIGNLNANASITLSFQVNITTLPNPNPIPNKSSLQYSFIVDINEPPVSRTVQSNKTFTQVNTASVIATKTASSAFAAVGDTITYTTTLTNSGNTTANTPVFIDILPPELSFVPDSVQINSIPQLGFRPDSGISLDSIPVGGTITISFQAIVSSIPATNPTLNQSSTTYSIIVDPTQPPVTETATSNPTLVQINEAIIQATKSVDRLFSDIAPGNSFLTYTVLLENIGNTTATNIIFTDPTPNNTIFIEDSVRVGGVLLPGVNPANGIPIGDIIAGDFINVTFRVQVVSIPNPIFTIGPGGPNSPVVNGASIDYQFMTGPNLPLVSRNTTSNSVSTQINSGEIVAIKSVDKTFATIGDTISYTITLSNPGNVTSQNIIFTDTLPDGTAFISGTLTNDSGTQQIGNPSNGIQIGNINPNGTAVITLNVLVTNIPSINPISNFSSVQFAHVVDPSQPAVTQTNVSNSVSTTINSAILTTQKSVDKSIISVGDTITYTTTITNTGNTTATNITFTSAIPANTTFIPNSVKINGVQQSGAQPALGVTIPNIAPGETVTVTFQATVLSVPPSSSIMGSDTILYSYTVDPNGTPITTSTSTNIVTNPVLDAMITMVKSVDQTIVTLGDTITYTTLLTNIGNTNATNITFTDLIPNGTTFITDSVTIGGITQIGLNPNTGITIGSIAPNSSISIAFQVTATSTPAQNPIANSATASYTFIADPNAPIVSRNVTSNTTFTTINTATILSSKQVDKAFSHIGDTLTYTVTLTNNGNSSAQNVIFTDTMPSGTTFIANTFSINGVPQSGANPVNGVNIGPITAGATVNVSFQVNVTSLPTENPIVNFSSTSYQLVSPPDTETSISNPVSTQIKEAILSMTKNESASFADIGQTAFYTTSISNIGNTDATNIVFTDVLPSGLTFVPNTLTVDGVLQPNANPNTGVLLAALPPNEIYSIVFQVTVSSIPPINPAPNIASTTYEFTVDPVNPPVSSSATSNTTLLQINNANIISTKTADLTFADVSNTITFTLNLPNTGNVAATDVTVIDILDSNLSFVPNSFTVNGQTIPNADLSTGVNIGSINGGNTAIVTFQATVTTLPTLNPISNSASITYHYVVDPSQPSITTSNQSNTTTTQINSAILTAQKNSNVSTVDIGQDIVYSVTITNSGNVSATNVIFTDLIPDGTSFEPNSFTLNGTSIPTADIVTGVPIGDIAPNQSVIVAFNIIAHEIPPINPITNQASVNFQHIVNPKNPPVSKNITSNNVTTKIESAILNTIKIGDKAFATIGDTITYTTTITNTGNIPANNVVFSDPLPSWAQLVAGSVVVDGTSLPSASITSGIGINTVNPDQTVTIIFQVQIVSNPTTFTPELQNLAFVNFQYNVGSALQAQPGNVETNVFVTSIHSAILSAVKTASTAFANIGDTITYTVLIQNSGNTNATNVNFSDLIPAGTTFVENSFTVNGNTIPGANPNSGVTIGTVSAGSSLTVTFQVIVTSTPPSNPITNVASIQYEFIVDPASPPVTGTITSNSASTQINNATVTTLLEANRTIVSIGDIITYTATLTNTGNFPANSVLLINGVPEGALFVPNSVTLNGISLPDTSPTLGIPVGIIAPGDSATITFQFLANSIPPQGAIINQALTSYTYIVDPSQPPVTSTSSSNTVSTAVVDASLSVIKNTDSLVQSTNGTITYTVVVQNNGNTTANTVTLTDLVPEGTAFIPDSVTINGVSAPGADPNVGIPLNSIAPSDIITITFQVIVQSIPSVNPISNIARIAYTFIADPTAPIISRTITSNPAVTQISDANVLSLKAVNAQQATTGDILTYTIALENTGNIPATNLIFSDTISEETTFIENSFTLNGTAILGANPNAGVTLPNLAANATHLISFQILINDPFSQQSITNQSNTTYTIQPDPGKPPITETSTSNIVITNFVQAQLTITKTSNPTTVDIGGTILYISEVKNIGNVDAINIIFTDSIPAGTTFVPDSVTINGVLQPDTNPENGISIGTIPSNSSKTILFQVQTNNPPTETEIVNQSSATYQYVSIPTAPPVNRSATSNIVTTSLQNANIISVKQADVTFVSIGQNITYTNTLQNIGTVPANNTLFIDNIPEGTIFIEDSLSINNVIQPGANPENGITLSTIQPNETVTISFQVQLTNIPEGNTVTNISDTSYEYQIDSSSPIIQRRSLSNAVTTEVRTANVSALKSANRSITRIGQIITYTVAVTNAGTVPITNTLLIDAISAGTTFIPNSILVDGIPRSNENPSTGITLNIILPNNTIIVTFQVNVVSIPPQNNINNIAVIHYEYQPDPSLPPISETTSSNTTNIQFIDAILIATKSANTILANIDETIEYTVLIQNNGSTTTNSIFFTDTIEDGTVFIPGSVIVNNTVLPAADPNIGFSIPNIASSQATTITFQVSVTNLPAVNPTPNTANLVYDFIFNPDFAPIQKSTTSNTTFVQINDADIVSLKTVDLTSVTIGDILTYTTTLTNTGNTDATAVVFTDNIPGGTTFIDGSVLVNNIPQLNANPSTGILVGTIAPNISIPVTFSVTVIALPASGHVQNQSTSRYTINGAEQISTSNITFTEVIIATIVATKTTPIQYADLQTIIPYTISITNNSNIQVENINVTDIIPANTSFIENSVIVNGNARPNDNPLSGIQIDNIPPNTTATILFQVRVTSIPQTNPISNTSTIEYQYTLPDRPPITETIISSAAVTEINHATLNSNKAVDLAFATVGDTLTYTIILNQTGNVAANDVVIQDMIPQGTTFIENSVIVNGETLPGVNPVSGIPIGTIIVGGDAITSFQVTVTSIPIQNELTNQAITTFNYIVNPNNIPVTNTTTTNTVTTTVQNDNVIAIKAVDFTSALPGQTLTYTITITNSGNITIEDLLLVDTAPVDTTFVIGSVTINGINQPNENPENGITLGTLAPSESVIITFQITISSSTLQPTINNDASVSYTVIIDPTKPPITITKQTNIVTTTVIDPMVRIEKTADKSIVVIGDIITFTLAVFNHSPIPTINTSVIDTIPAGTTFIENSVTINGILVPTVRPDTGMNIGALPAGSVATITFQVLVTSIPSKNTIINSATVTAAFQLTPQDPIITFVVNSNIVRIPVQFVTATVTKNASVSSAYLNQYFDYTVRITNTSEISLLNISLQDTIPVGLQFMSGTVSINGERSPLANPNIGFLVATNLEPSETIIVLFTVQVISPPVTNEFKNTANISLQLQASPTDPPITVTVTSNENIVTFVPENPDKTLPNFNCFFDGERFIRITPRNVGNYLWTWIWWN
>NZ_CP045537.1|WP_000570996.1|1627772_1628633_+|GNAT-family-N-acetyltransferase
MIELEFSVERLKEEQIGDIVALSSYIGWDYNREEVETIFNSGIVYGVWNERKELIASAAIILYGEALASIGMVIVHPDYKGRGIGKMITNSCMNSVSAQTPFMLIATDEGKPLYEKLGFRAVSYVSKYICNSYNANDYCVRNEDYVMNYEEGELEKIIKIDEYAFGTNRKEFLKKRIMQSEQCTVVRDKEQKVLGYGLSIQTPENKIIGPVVAKNDEMAMRIVHDLAKGHNGKLRIDVLEGKKDFMKVLEITGFKKVNTPPIMMKNSGQLLKRNNELYSIAAQIFG
>NZ_CP045537.1|WP_000806353.1|1628667_1629228_-|cysteine-hydrolase
MKQALLIIDAQQELMDGNEQESEVFRKTELLSTLNTAVQKAIDANALIVFVRDIDVASGSGEGFEVHNQIQVPQSAILINKAATNSFYGTSLLELLKEEKINHIVIGGCKTEHCIDTAVRTATVQGFDVTLIKNGHSTTDSDVLTAEQIISHHNKILHGHYNVDHFSMVRDIEEDLFQPTHDQYRD
>NZ_CP045537.1|WP_001195212.1|1629409_1629670_+|hypothetical-protein
MQTVEDYLSFLHTKGFKLSEEAQGFIMFGQGYTGASDGIVNAAIEATIKHQLQFDGSYFVALLERLKEEEITDKKSAKAFMRKLQA
>NZ_CP045537.1|WP_000711147.1|1629672_1630578_-|DMT-family-transporter
MKKDWIAPLALLFVSFIWGATFVVVQNAMSFVGPFTFNGIRFLFAGIILLFVQLIFSKKTSKQHIKQSSLAGLTVGFFLCVGYVLQTFGLLYTTSSKAGFLTGLSIVMVPILSFIFLKQKATIFIVIGIAVATAGLYLLTAGDSFQLNIGDILVLGCAVAFAAHILVNGFFSKKISPLLLSTSQVLAVGMFSSICAFLFEDWEKLFSVALWTNSSFLFALFLTSLFATSIAFFIQTSAQKHTSPTRVAIIFAMEPVFAALTGVLVANEQLSISAIIGCLCIFLGMVFVELPSKTKKEAQAA
>NZ_CP045537.1|WP_000573873.1|1630591_1630978_-|reverse-transcriptase-like-protein
MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSLPLGTMSNHEAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKEYAKNKMFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN
>NZ_CP045537.1|WP_000127427.1|1631048_1631921_-|aldose-1-epimerase-family-protein
MTATIQNEKVIVTISDKGAELQSVLLKEDNTEYLWQGDATYWGRRAPILFPIVGRLVDNTYYVDGKPYSLTQHGFARDLTFSVEEQSETKITYIVTSNEETLKKYPYEFELLVSYELDGQTVHVTYEVNNPASKEMFFSIGAHPGFNFPLLEGESFTDYHLSFNGSERLETSVLEGPYLSNKKQLIAESTNELPLTYDLFKNDALIFENMNTDEISIRSHKHNKFVKVEFDGFPFVGVWTPGENAPFLCIEPWYGIADEVNPAKDFKEKKGIQSLQANETFTCRYSITIG
>NZ_CP045537.1|WP_001026467.1|1632104_1632590_+|QueT-transporter-family-protein
MNIRTLVGNGILAALYIAVSMLIQPFGFTNVQFRISEMFNHLVVFNKKAIYGIVLGVFLTNLFFSPMIAYDLVFGVGQSILALVATIISMRFIKGVWARMIFNTVIFTITMFMIAIELHLAFDLPFMLTWLTCAIGEFVVMAIGMPVMYWINKRVQFERFM
>NZ_CP045537.1|WP_000875518.1|1632741_1633401_+|reverse-transcriptase-like-protein
MKYKIHWLYKTKRGFQTELTTDYMNIEEALQFAEDFEKTGRVKELLFYDEMDAEWSLKEMKKLSKQVEEEPQEILVYFDGGYDVQTKEAGIGICVYYKKGNTKYRIRRNAYIEGIYDNNEAEYASLLYSMNILEELGIKYEAVTLRGDSQVVLQQLAGEWPCYDEHLNHYLDQIEQKAKQMKLKLVCEPISRKQNKEAHQLATQALEGTVIDSHKEITE
>NZ_CP045537.1|WP_000358801.1|1633413_1633590_+|zinc-finger-domain-containing-protein
MDKKQLITEVNDLLETYCEGCFLREHNRKTNSKYYAHSFCIRQCTVGETLKKYGEQLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP045537_3	3.11\|1609320\|31\|NZ_CP045537\|CRT	1609320-1609350	31	NZ_CP045537.1	1611741-1611771	0	1.0
NZ_CP045537_1	1.3\|1271457\|17\|NZ_CP045537\|CRISPRCasFinder	1271457-1271473	17	NZ_CP045537.1	2081001-2081017	1	0.941
NZ_CP045537_2	2.8\|1492613\|18\|NZ_CP045537\|CRT	1492613-1492630	18	NZ_CP045537.1	1492118-1492135	1	0.944
NZ_CP045537_3	3.37\|1611003\|31\|NZ_CP045537\|CRT	1611003-1611033	31	NZ_CP045537.1	1611732-1611762	2	0.935

1. spacer 3.11|1609320|31|NZ_CP045537|CRT matches to position: 1611741-1611771, mismatch: 0, identity: 1.0

aggtccggtgttgccagtaggtccagtgtcg	CRISPR spacer
aggtccggtgttgccagtaggtccagtgtcg	Protospacer
*******************************

2. spacer 1.3|1271457|17|NZ_CP045537|CRISPRCasFinder matches to position: 2081001-2081017, mismatch: 1, identity: 0.941

aaagaaccttttgcatg	CRISPR spacer
aaaggaccttttgcatg	Protospacer
****.************

3. spacer 2.8|1492613|18|NZ_CP045537|CRT matches to position: 1492118-1492135, mismatch: 1, identity: 0.944

caccagtagcccctgttg	CRISPR spacer
caccagtagcacctgttg	Protospacer
********** *******

4. spacer 3.37|1611003|31|NZ_CP045537|CRT matches to position: 1611732-1611762, mismatch: 2, identity: 0.935

gttgccggtaggtccggtgttcccagtaggt	CRISPR spacer
gttgccagtaggtccggtgttgccagtaggt	Protospacer
******.************** *********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP045537_3	3.34\|1610850\|22\|NZ_CP045537\|CRT	1610850-1610871	22	NZ_CP015256	Bacillus thuringiensis Bt18247 plasmid p12509, complete sequence	6149-6170	2	0.909
NZ_CP045537_3	3.34\|1610850\|22\|NZ_CP045537\|CRT	1610850-1610871	22	NZ_CP015256	Bacillus thuringiensis Bt18247 plasmid p12509, complete sequence	12403-12424	2	0.909
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	MN163280	Klebsiella phage KpGranit, complete genome	86377-86403	3	0.889
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15069-15095	3	0.889
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	180959-180985	3	0.889
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181055-181081	3	0.889
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15072-15098	3	0.889
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15069-15095	3	0.889
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182060-182086	3	0.889
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182156-182182	3	0.889
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	MN163280	Klebsiella phage KpGranit, complete genome	86377-86403	3	0.889
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15069-15095	3	0.889
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	180959-180985	3	0.889
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181055-181081	3	0.889
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15072-15098	3	0.889
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15069-15095	3	0.889
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182060-182086	3	0.889
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182156-182182	3	0.889
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MN163280	Klebsiella phage KpGranit, complete genome	86314-86340	3	0.889
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	81553-81579	3	0.889
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	86058-86084	3	0.889
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71429-71455	3	0.889
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14775-14801	3	0.889
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	16623-16649	3	0.889
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14778-14804	3	0.889
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14775-14801	3	0.889
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452540-452570	3	0.903
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94345-94375	3	0.903
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	KY963370	Bacillus phage Negev_SA, complete genome	34915-34945	3	0.903
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452540-452570	3	0.903
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94345-94375	3	0.903
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	KY963370	Bacillus phage Negev_SA, complete genome	34915-34945	3	0.903
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	NZ_CP046295	Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence	154919-154945	4	0.852
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17105-17131	4	0.852
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14775-14801	4	0.852
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	16623-16649	4	0.852
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14705-14731	4	0.852
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14778-14804	4	0.852
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14775-14801	4	0.852
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9397-9423	4	0.852
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9227-9253	4	0.852
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9999-10025	4	0.852
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	86987-87013	4	0.852
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4696-4722	4	0.852
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71429-71455	4	0.852
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	NZ_CP046295	Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence	154919-154945	4	0.852
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17105-17131	4	0.852
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14775-14801	4	0.852
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	16623-16649	4	0.852
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14705-14731	4	0.852
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14778-14804	4	0.852
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14775-14801	4	0.852
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9397-9423	4	0.852
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9227-9253	4	0.852
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9999-10025	4	0.852
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	86987-87013	4	0.852
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4696-4722	4	0.852
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71429-71455	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MN163280	Klebsiella phage KpGranit, complete genome	86377-86403	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MN497953	Mycobacterium phage GtownJaz, complete genome	2465-2491	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MH020238	Mycobacterium phage Lilith, complete genome	2466-2492	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MH077583	Mycobacterium phage PGHhamlin, complete genome	2465-2491	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MH727554	Mycobacterium phage MuchMore, complete genome	2465-2491	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MH338240	Mycobacterium phage Sabia, complete genome	2466-2492	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KM233455	Mycobacterium phage Farber, complete genome	2466-2492	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KX664448	Mycobacterium phage Watson, complete genome	2465-2491	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KX507362	Mycobacterium phage Aglet, complete genome	2465-2491	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MH576949	Mycobacterium phage BreSam8, complete genome	2466-2492	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MN585969	Mycobacterium phage Dieselweasel, complete genome	2465-2491	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MH536813	Mycobacterium phage AugsMagnumOpus, complete genome	2465-2491	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MF185733	Mycobacterium phage StepMih, complete genome	2466-2492	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MF185732	Mycobacterium phage Stagni, complete genome	2466-2492	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MK494096	Mycobacterium phage Mainiac, complete genome	2466-2492	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KU984914	Mycobacterium phage Malinsilva, complete genome	2465-2491	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	JF704101	Mycobacterium virus Microwolf, complete genome	2465-2491	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KT359365	Mycobacterium phage DaHudson, complete genome	2465-2491	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MH651179	Mycobacterium phage MadMarie, complete genome	2466-2492	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MN101228	Klebsiella phage KPN4, complete genome	25994-26020	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	NC_028798	Mycobacterium phage MarQuardt, complete genome	2465-2491	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17105-17131	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9397-9423	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9227-9253	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9999-10025	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13197-13223	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14705-14731	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4696-4722	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13200-13226	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14826-14852	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13197-13223	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14823-14849	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MK448703	Streptococcus phage Javan207, complete genome	37479-37505	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	NC_041891	Propionibacterium phage B22, complete genome	36818-36844	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	NC_041894	Propionibacterium phage E6, complete genome	37666-37692	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KX620754	Propionibacterium phage G4, complete genome	38154-38180	4	0.852
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KX160207	Lactococcus phage 53801, complete genome	33293-33319	4	0.852
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452558-452588	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452468-452498	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452486-452516	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94327-94357	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94399-94429	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94417-94447	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	KY963370	Bacillus phage Negev_SA, complete genome	34630-34660	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	KY963370	Bacillus phage Negev_SA, complete genome	34666-34696	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	535864-535894	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_020385	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence	272022-272052	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114801-114831	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114891-114921	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114909-114939	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114963-114993	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	115017-115047	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	115035-115065	4	0.871
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	166927-166957	4	0.871
NZ_CP045537_3	3.11\|1609320\|31\|NZ_CP045537\|CRT	1609320-1609350	31	KY963370	Bacillus phage Negev_SA, complete genome	34897-34927	4	0.871
NZ_CP045537_3	3.11\|1609320\|31\|NZ_CP045537\|CRT	1609320-1609350	31	KY963370	Bacillus phage Negev_SA, complete genome	34933-34963	4	0.871
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192320-192350	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452558-452588	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452468-452498	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452486-452516	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94327-94357	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94399-94429	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94417-94447	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	KY963370	Bacillus phage Negev_SA, complete genome	34630-34660	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	KY963370	Bacillus phage Negev_SA, complete genome	34666-34696	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	535864-535894	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_020385	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence	272022-272052	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114801-114831	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114891-114921	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114909-114939	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114963-114993	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	115017-115047	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	115035-115065	4	0.871
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	166927-166957	4	0.871
NZ_CP045537_3	3.35\|1610895\|31\|NZ_CP045537\|CRT	1610895-1610925	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114801-114831	4	0.871
NZ_CP045537_3	3.37\|1611003\|31\|NZ_CP045537\|CRT	1611003-1611033	31	NC_004821	Bacillus prophage phBC6A52, complete genome	12120-12150	4	0.871
NZ_CP045537_3	3.37\|1611003\|31\|NZ_CP045537\|CRT	1611003-1611033	31	NC_004821	Bacillus prophage phBC6A52, complete genome	12156-12186	4	0.871
NZ_CP045537_3	3.37\|1611003\|31\|NZ_CP045537\|CRT	1611003-1611033	31	NC_004821	Bacillus prophage phBC6A52, complete genome	12228-12258	4	0.871
NZ_CP045537_3	3.37\|1611003\|31\|NZ_CP045537\|CRT	1611003-1611033	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452495-452525	4	0.871
NZ_CP045537_3	3.37\|1611003\|31\|NZ_CP045537\|CRT	1611003-1611033	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94390-94420	4	0.871
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	KY963370	Bacillus phage Negev_SA, complete genome	34924-34954	4	0.871
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52361-52391	4	0.871
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52451-52481	4	0.871
NZ_CP045537_2	2.6\|1492523\|27\|NZ_CP045537\|CRT	1492523-1492549	27	NC_019387	Thermus oshimai JL-2 plasmid pTHEOS01, complete sequence	211293-211319	5	0.815
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	KY984068	Erwinia phage vB_EamM_Y3, complete genome	74475-74501	5	0.815
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	18170-18196	5	0.815
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	15770-15796	5	0.815
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14826-14852	5	0.815
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14823-14849	5	0.815
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	NZ_CP032678	Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence	383807-383833	5	0.815
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	8162-8188	5	0.815
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	3631-3657	5	0.815
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21755-21781	5	0.815
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	KX534340	Phage Wrath, partial genome	4431-4457	5	0.815
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	KY984068	Erwinia phage vB_EamM_Y3, complete genome	74475-74501	5	0.815
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	18170-18196	5	0.815
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	15770-15796	5	0.815
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14826-14852	5	0.815
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14823-14849	5	0.815
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	NZ_CP032678	Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence	383807-383833	5	0.815
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	8162-8188	5	0.815
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	3631-3657	5	0.815
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21755-21781	5	0.815
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	KX534340	Phage Wrath, partial genome	4431-4457	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78592-78618	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83097-83123	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MN101228	Klebsiella phage KPN4, complete genome	25940-25966	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	AP014498	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S34-C64, * SEQUENCING IN PROGRESS *, 4 ordered pieces	16167-16193	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	AP014498	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S34-C64, * SEQUENCING IN PROGRESS *, 4 ordered pieces	14254-14280	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15099-15125	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181142-181168	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	708-734	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15102-15128	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179824-179850	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15099-15125	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182243-182269	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	NZ_CP018231	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed3	328506-328532	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	NZ_CP016292	Rhizobium leguminosarum strain Vaf10 plasmid unnamed4, complete sequence	68233-68259	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	86987-87013	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	NC_028998	Phormidium phage MIS-PhV1B, complete genome	7240-7266	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	AP013524	Uncultured Mediterranean phage uvMED DNA, complete genome, group G3, isolate: uvMED-CGR-C7-MedDCM-OCT-S39-C15	37226-37252	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	MG592476	Vibrio phage 1.104.O._10N.286.49.A12, partial genome	43336-43362	5	0.815
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	KU886222	Erwinia phage vB_EamM_Special G, complete genome	255604-255630	5	0.815
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285693-285723	5	0.839
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286377-286407	5	0.839
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	287709-287739	5	0.839
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23645-23675	5	0.839
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27867-27897	5	0.839
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28011-28041	5	0.839
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538312-538342	5	0.839
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538456-538486	5	0.839
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177375-177405	5	0.839
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177519-177549	5	0.839
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282088-282118	5	0.839
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282232-282262	5	0.839
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155417-155447	5	0.839
NZ_CP045537_3	3.11\|1609320\|31\|NZ_CP045537\|CRT	1609320-1609350	31	KY963370	Bacillus phage Negev_SA, complete genome	34987-35017	5	0.839
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9942-9972	5	0.839
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10968-10998	5	0.839
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22121-22151	5	0.839
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	23147-23177	5	0.839
NZ_CP045537_3	3.18\|1609725\|31\|NZ_CP045537\|CRT	1609725-1609755	31	KY963370	Bacillus phage Negev_SA, complete genome	34897-34927	5	0.839
NZ_CP045537_3	3.18\|1609725\|31\|NZ_CP045537\|CRT	1609725-1609755	31	KY963370	Bacillus phage Negev_SA, complete genome	34933-34963	5	0.839
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285693-285723	5	0.839
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286377-286407	5	0.839
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	287709-287739	5	0.839
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23645-23675	5	0.839
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27867-27897	5	0.839
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28011-28041	5	0.839
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538312-538342	5	0.839
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538456-538486	5	0.839
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177375-177405	5	0.839
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177519-177549	5	0.839
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282088-282118	5	0.839
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282232-282262	5	0.839
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155417-155447	5	0.839
NZ_CP045537_3	3.35\|1610895\|31\|NZ_CP045537\|CRT	1610895-1610925	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114891-114921	5	0.839
NZ_CP045537_3	3.35\|1610895\|31\|NZ_CP045537\|CRT	1610895-1610925	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	115017-115047	5	0.839
NZ_CP045537_3	3.36\|1610949\|31\|NZ_CP045537\|CRT	1610949-1610979	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52361-52391	5	0.839
NZ_CP045537_3	3.36\|1610949\|31\|NZ_CP045537\|CRT	1610949-1610979	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52451-52481	5	0.839
NZ_CP045537_3	3.37\|1611003\|31\|NZ_CP045537\|CRT	1611003-1611033	31	NC_004821	Bacillus prophage phBC6A52, complete genome	12192-12222	5	0.839
NZ_CP045537_3	3.37\|1611003\|31\|NZ_CP045537\|CRT	1611003-1611033	31	NC_004821	Bacillus prophage phBC6A52, complete genome	12264-12294	5	0.839
NZ_CP045537_3	3.37\|1611003\|31\|NZ_CP045537\|CRT	1611003-1611033	31	NC_004821	Bacillus prophage phBC6A52, complete genome	12300-12330	5	0.839
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	KY963370	Bacillus phage Negev_SA, complete genome	34888-34918	5	0.839
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	51416-51446	5	0.839
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52901-52931	5	0.839
NZ_CP045537_2	2.6\|1492523\|27\|NZ_CP045537\|CRT	1492523-1492549	27	MF140397	Arthrobacter phage Abidatro, complete genome	33492-33518	6	0.778
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78592-78618	6	0.778
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83097-83123	6	0.778
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	MK496823	Capybara microvirus Cap3_SP_645, complete genome	1028-1054	6	0.778
NZ_CP045537_2	2.11\|1492730\|27\|NZ_CP045537\|CRT	1492730-1492756	27	NC_028998	Phormidium phage MIS-PhV1B, complete genome	7240-7266	6	0.778
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78592-78618	6	0.778
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83097-83123	6	0.778
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	MK496823	Capybara microvirus Cap3_SP_645, complete genome	1028-1054	6	0.778
NZ_CP045537_2	2.13\|1492829\|27\|NZ_CP045537\|CRT	1492829-1492855	27	NC_028998	Phormidium phage MIS-PhV1B, complete genome	7240-7266	6	0.778
NZ_CP045537_2	2.14\|1492874\|27\|NZ_CP045537\|CRT	1492874-1492900	27	NZ_CP010864	Marinovum algicola DG 898 plasmid pMaD9, complete sequence	48125-48151	6	0.778
NZ_CP045537_2	2.16\|1492973\|36\|NZ_CP045537\|CRT	1492973-1493008	36	NZ_CP032531	Bacillus megaterium NCT-2 plasmid pNCT2_3, complete sequence	110535-110570	6	0.833
NZ_CP045537_2	2.16\|1492973\|36\|NZ_CP045537\|CRT	1492973-1493008	36	MN693189	Marine virus AFVG_25M326, complete genome	18914-18949	6	0.833
NZ_CP045537_3	3.1\|1608681\|31\|NZ_CP045537\|CRT	1608681-1608711	31	KY984068	Erwinia phage vB_EamM_Y3, complete genome	66864-66894	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110875-110905	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110929-110959	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285675-285705	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285729-285759	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285783-285813	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285801-285831	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285819-285849	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285837-285867	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285855-285885	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285873-285903	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285891-285921	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285909-285939	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285927-285957	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285945-285975	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285963-285993	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285981-286011	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285999-286029	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286017-286047	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286035-286065	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286053-286083	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286071-286101	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286089-286119	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286107-286137	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286125-286155	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286143-286173	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286161-286191	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286179-286209	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286197-286227	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286215-286245	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286233-286263	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286251-286281	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286269-286299	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286287-286317	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286305-286335	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286323-286353	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286341-286371	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286359-286389	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23627-23657	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23681-23711	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23735-23765	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23753-23783	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23771-23801	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23789-23819	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23825-23855	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23843-23873	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23861-23891	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27849-27879	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27903-27933	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27957-27987	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27975-28005	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27993-28023	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28065-28095	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28083-28113	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538330-538360	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538348-538378	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538366-538396	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538420-538450	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538474-538504	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177393-177423	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177411-177441	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177429-177459	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177483-177513	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177537-177567	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282070-282100	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282124-282154	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282178-282208	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282196-282226	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282214-282244	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155183-155213	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155201-155231	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155219-155249	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155237-155267	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155255-155285	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155273-155303	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155291-155321	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155309-155339	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155327-155357	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155381-155411	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155435-155465	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116841-116871	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116877-116907	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	191-221	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	317-347	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	695-725	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1352-1382	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733093-733123	6	0.806
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	194188-194218	6	0.806
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	122735-122765	6	0.806
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2009-2039	6	0.806
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	30100-30130	6	0.806
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	156285-156315	6	0.806
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190567-190597	6	0.806
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	124019-124049	6	0.806
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP017574	Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence	343235-343265	6	0.806
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	194206-194236	6	0.806
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	119-149	6	0.806
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1757-1787	6	0.806
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1838-1868	6	0.806
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733192-733222	6	0.806
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733390-733420	6	0.806
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733417-733447	6	0.806
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110785-110815	6	0.806
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	30100-30130	6	0.806
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	156285-156315	6	0.806
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190567-190597	6	0.806
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	124019-124049	6	0.806
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP017574	Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence	343235-343265	6	0.806
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	194206-194236	6	0.806
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	119-149	6	0.806
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1757-1787	6	0.806
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1838-1868	6	0.806
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733192-733222	6	0.806
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733390-733420	6	0.806
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733417-733447	6	0.806
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110785-110815	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110875-110905	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110929-110959	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285675-285705	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285729-285759	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285783-285813	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285801-285831	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285819-285849	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285837-285867	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285855-285885	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285873-285903	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285891-285921	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285909-285939	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285927-285957	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285945-285975	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285963-285993	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285981-286011	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285999-286029	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286017-286047	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286035-286065	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286053-286083	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286071-286101	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286089-286119	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286107-286137	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286125-286155	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286143-286173	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286161-286191	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286179-286209	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286197-286227	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286215-286245	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286233-286263	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286251-286281	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286269-286299	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286287-286317	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286305-286335	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286323-286353	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286341-286371	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286359-286389	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23627-23657	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23681-23711	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23735-23765	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23753-23783	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23771-23801	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23789-23819	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23825-23855	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23843-23873	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23861-23891	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27849-27879	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27903-27933	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27957-27987	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27975-28005	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27993-28023	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28065-28095	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28083-28113	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538330-538360	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538348-538378	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538366-538396	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538420-538450	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538474-538504	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177393-177423	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177411-177441	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177429-177459	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177483-177513	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177537-177567	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282070-282100	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282124-282154	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282178-282208	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282196-282226	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282214-282244	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155183-155213	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155201-155231	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155219-155249	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155237-155267	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155255-155285	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155273-155303	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155291-155321	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155309-155339	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155327-155357	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155381-155411	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155435-155465	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116841-116871	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116877-116907	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	191-221	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	317-347	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	695-725	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1352-1382	6	0.806
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733093-733123	6	0.806
NZ_CP045537_3	3.32\|1610715\|31\|NZ_CP045537\|CRT	1610715-1610745	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452486-452516	6	0.806
NZ_CP045537_3	3.32\|1610715\|31\|NZ_CP045537\|CRT	1610715-1610745	31	KY963370	Bacillus phage Negev_SA, complete genome	34843-34873	6	0.806
NZ_CP045537_3	3.32\|1610715\|31\|NZ_CP045537\|CRT	1610715-1610745	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94399-94429	6	0.806
NZ_CP045537_3	3.35\|1610895\|31\|NZ_CP045537\|CRT	1610895-1610925	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	115125-115155	6	0.806
NZ_CP045537_3	3.35\|1610895\|31\|NZ_CP045537\|CRT	1610895-1610925	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114783-114813	6	0.806
NZ_CP045537_3	3.35\|1610895\|31\|NZ_CP045537\|CRT	1610895-1610925	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	115089-115119	6	0.806
NZ_CP045537_3	3.35\|1610895\|31\|NZ_CP045537\|CRT	1610895-1610925	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94399-94429	6	0.806
NZ_CP045537_3	3.35\|1610895\|31\|NZ_CP045537\|CRT	1610895-1610925	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452486-452516	6	0.806
NZ_CP045537_3	3.36\|1610949\|31\|NZ_CP045537\|CRT	1610949-1610979	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	51416-51446	6	0.806
NZ_CP045537_3	3.37\|1611003\|31\|NZ_CP045537\|CRT	1611003-1611033	31	MF063068	Pseudomonas phage Noxifer, complete genome	273596-273626	6	0.806
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	51677-51707	6	0.806
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52343-52373	6	0.806
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52433-52463	6	0.806
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52811-52841	6	0.806
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110731-110761	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110767-110797	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110839-110869	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	115125-115155	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286431-286461	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538258-538288	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177321-177351	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282286-282316	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116769-116799	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	65-95	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	272-302	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	452-482	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1010-1040	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1145-1175	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1199-1229	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1784-1814	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	732958-732988	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	732985-733015	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733039-733069	7	0.774
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733219-733249	7	0.774
NZ_CP045537_3	3.11\|1609320\|31\|NZ_CP045537\|CRT	1609320-1609350	31	NC_011879	Pseudarthrobacter chlorophenolicus A6 plasmid pACHL01, complete sequence	289934-289964	7	0.774
NZ_CP045537_3	3.11\|1609320\|31\|NZ_CP045537\|CRT	1609320-1609350	31	KY984068	Erwinia phage vB_EamM_Y3, complete genome	66864-66894	7	0.774
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NZ_CP040335	Bacillus cereus strain DLOU-Changhai plasmid unnamed1, complete sequence	8643-8673	7	0.774
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52181-52211	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	30028-30058	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	30046-30076	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	30064-30094	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	30082-30112	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	156303-156333	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190810-190840	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190837-190867	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190864-190894	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190891-190921	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192311-192341	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP017574	Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence	343208-343238	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP017574	Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence	343325-343355	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193900-193930	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1982-2012	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2027-2057	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9924-9954	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9942-9972	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10950-10980	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10968-10998	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22103-22133	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22121-22151	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	23129-23159	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	23147-23177	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10725-10755	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	MN693092	Marine virus AFVG_25M37, complete genome	19084-19114	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110839-110869	7	0.774
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	414021-414051	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	30028-30058	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	30046-30076	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	30064-30094	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	30082-30112	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	156303-156333	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190810-190840	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190837-190867	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190864-190894	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190891-190921	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192311-192341	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP017574	Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence	343208-343238	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP017574	Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence	343325-343355	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193900-193930	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1982-2012	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2027-2057	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9924-9954	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9942-9972	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10950-10980	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10968-10998	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22103-22133	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22121-22151	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	23129-23159	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	23147-23177	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10725-10755	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	MN693092	Marine virus AFVG_25M37, complete genome	19084-19114	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110839-110869	7	0.774
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	414021-414051	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110731-110761	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110767-110797	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110839-110869	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	115125-115155	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286431-286461	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538258-538288	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177321-177351	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282286-282316	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116769-116799	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	65-95	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	272-302	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	452-482	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1010-1040	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1145-1175	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1199-1229	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1784-1814	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	732958-732988	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	732985-733015	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733039-733069	7	0.774
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733219-733249	7	0.774
NZ_CP045537_3	3.32\|1610715\|31\|NZ_CP045537\|CRT	1610715-1610745	31	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	97617-97647	7	0.774
NZ_CP045537_3	3.32\|1610715\|31\|NZ_CP045537\|CRT	1610715-1610745	31	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1688177-1688207	7	0.774
NZ_CP045537_3	3.36\|1610949\|31\|NZ_CP045537\|CRT	1610949-1610979	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	51677-51707	7	0.774
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	51875-51905	7	0.774
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52037-52067	7	0.774
NZ_CP045537_2	2.12\|1492775\|36\|NZ_CP045537\|CRT	1492775-1492810	36	AP014498	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S34-C64, * SEQUENCING IN PROGRESS *, 4 ordered pieces	16074-16109	8	0.778
NZ_CP045537_2	2.15\|1492919\|36\|NZ_CP045537\|CRT	1492919-1492954	36	MN693189	Marine virus AFVG_25M326, complete genome	18914-18949	8	0.778
NZ_CP045537_2	2.16\|1492973\|36\|NZ_CP045537\|CRT	1492973-1493008	36	NZ_CP032531	Bacillus megaterium NCT-2 plasmid pNCT2_3, complete sequence	110661-110696	8	0.778
NZ_CP045537_3	3.2\|1608735\|40\|NZ_CP045537\|CRT	1608735-1608774	40	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110893-110932	8	0.8
NZ_CP045537_3	3.2\|1608735\|40\|NZ_CP045537\|CRT	1608735-1608774	40	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110947-110986	8	0.8
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190504-190534	8	0.742
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	119-149	8	0.742
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	164-194	8	0.742
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	902-932	8	0.742
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1622-1652	8	0.742
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1757-1787	8	0.742
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1838-1868	8	0.742
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733165-733195	8	0.742
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733192-733222	8	0.742
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733318-733348	8	0.742
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733363-733393	8	0.742
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733390-733420	8	0.742
NZ_CP045537_3	3.11\|1609320\|31\|NZ_CP045537\|CRT	1609320-1609350	31	NZ_CP026221	Aeromonas sp. ASNIH4 plasmid pAER-f909, complete sequence	53220-53250	8	0.742
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190774-190804	8	0.742
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NZ_CP024036	Bacillus aryabhattai strain K13 plasmid unnamed1	71849-71879	8	0.742
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	803-833	8	0.742
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52298-52328	8	0.742
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52838-52868	8	0.742
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	53234-53264	8	0.742
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	29830-29860	8	0.742
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	156429-156459	8	0.742
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NZ_CP023318	Bacillus megaterium strain A plasmid p1, complete sequence	137938-137968	8	0.742
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	124145-124175	8	0.742
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	124307-124337	8	0.742
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	124883-124913	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	30010-30040	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	29560-29590	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	156321-156351	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192194-192224	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192716-192746	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192743-192773	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	124037-124067	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	124073-124103	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	124685-124715	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	125297-125327	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP017574	Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence	343334-343364	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193639-193669	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193648-193678	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193702-193732	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193891-193921	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193945-193975	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193972-194002	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193999-194029	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	194035-194065	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	8907-8937	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	8961-8991	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9015-9045	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9132-9162	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9231-9261	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9285-9315	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9384-9414	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9438-9468	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9465-9495	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9519-9549	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9573-9603	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10023-10053	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10077-10107	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10131-10161	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	11022-11052	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21086-21116	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21140-21170	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21194-21224	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21311-21341	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21410-21440	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21464-21494	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21563-21593	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21617-21647	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21644-21674	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21698-21728	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21752-21782	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22202-22232	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22256-22286	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22310-22340	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	23201-23231	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10320-10350	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10383-10413	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10428-10458	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10491-10521	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP015352	Bacillus thuringiensis strain MYBT18246 plasmid p142098, complete sequence	24504-24534	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP022605	Ochrobactrum quorumnocens strain A44 plasmid unnamed1, complete sequence	947316-947346	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_LR134403	Listeria monocytogenes strain NCTC7974 plasmid 6, complete sequence	93807-93837	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538276-538306	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538312-538342	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538330-538360	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538348-538378	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538366-538396	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538384-538414	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538438-538468	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177339-177369	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177375-177405	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177393-177423	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177411-177441	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177429-177459	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177447-177477	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177501-177531	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155201-155231	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155219-155249	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155237-155267	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155255-155285	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155273-155303	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155291-155321	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155309-155339	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155327-155357	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155345-155375	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155399-155429	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285711-285741	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285765-285795	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285783-285813	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285801-285831	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285819-285849	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285837-285867	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285855-285885	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285873-285903	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285891-285921	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285909-285939	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285927-285957	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285945-285975	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285963-285993	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285981-286011	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285999-286029	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286017-286047	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286035-286065	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286053-286083	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286071-286101	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286089-286119	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286107-286137	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286125-286155	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286143-286173	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286161-286191	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286179-286209	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286197-286227	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286215-286245	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286233-286263	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286251-286281	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286269-286299	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286287-286317	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286305-286335	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286323-286353	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286341-286371	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286359-286389	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286377-286407	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286413-286443	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23663-23693	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23717-23747	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23735-23765	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23753-23783	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23771-23801	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23807-23837	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23825-23855	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23843-23873	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27885-27915	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27939-27969	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27957-27987	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27975-28005	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27993-28023	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28011-28041	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28047-28077	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28065-28095	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116841-116871	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116877-116907	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282106-282136	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282160-282190	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282178-282208	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282196-282226	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282214-282244	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282232-282262	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282268-282298	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	124560-124590	8	0.742
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	124561-124591	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	30010-30040	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	29560-29590	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	156321-156351	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192194-192224	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192716-192746	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192743-192773	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	124037-124067	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	124073-124103	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	124685-124715	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	125297-125327	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP017574	Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence	343334-343364	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193639-193669	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193648-193678	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193702-193732	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193891-193921	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193945-193975	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193972-194002	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	193999-194029	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	194035-194065	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	8907-8937	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	8961-8991	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9015-9045	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9132-9162	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9231-9261	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9285-9315	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9384-9414	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9438-9468	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9465-9495	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9519-9549	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9573-9603	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10023-10053	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10077-10107	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10131-10161	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	11022-11052	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21086-21116	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21140-21170	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21194-21224	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21311-21341	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21410-21440	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21464-21494	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21563-21593	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21617-21647	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21644-21674	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21698-21728	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21752-21782	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22202-22232	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22256-22286	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22310-22340	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	23201-23231	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10320-10350	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10383-10413	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10428-10458	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10491-10521	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP015352	Bacillus thuringiensis strain MYBT18246 plasmid p142098, complete sequence	24504-24534	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP022605	Ochrobactrum quorumnocens strain A44 plasmid unnamed1, complete sequence	947316-947346	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_LR134403	Listeria monocytogenes strain NCTC7974 plasmid 6, complete sequence	93807-93837	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538276-538306	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538312-538342	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538330-538360	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538348-538378	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538366-538396	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538384-538414	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538438-538468	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177339-177369	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177375-177405	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177393-177423	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177411-177441	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177429-177459	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177447-177477	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177501-177531	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155201-155231	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155219-155249	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155237-155267	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155255-155285	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155273-155303	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155291-155321	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155309-155339	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155327-155357	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155345-155375	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155399-155429	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285711-285741	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285765-285795	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285783-285813	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285801-285831	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285819-285849	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285837-285867	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285855-285885	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285873-285903	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285891-285921	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285909-285939	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285927-285957	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285945-285975	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285963-285993	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285981-286011	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285999-286029	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286017-286047	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286035-286065	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286053-286083	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286071-286101	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286089-286119	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286107-286137	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286125-286155	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286143-286173	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286161-286191	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286179-286209	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286197-286227	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286215-286245	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286233-286263	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286251-286281	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286269-286299	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286287-286317	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286305-286335	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286323-286353	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286341-286371	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286359-286389	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286377-286407	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286413-286443	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23663-23693	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23717-23747	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23735-23765	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23753-23783	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23771-23801	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23807-23837	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23825-23855	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23843-23873	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27885-27915	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27939-27969	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27957-27987	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27975-28005	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27993-28023	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28011-28041	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28047-28077	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28065-28095	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116841-116871	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116877-116907	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282106-282136	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282160-282190	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282178-282208	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282196-282226	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282214-282244	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282232-282262	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282268-282298	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	124560-124590	8	0.742
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	124561-124591	8	0.742
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190504-190534	8	0.742
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	119-149	8	0.742
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	164-194	8	0.742
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	902-932	8	0.742
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1622-1652	8	0.742
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1757-1787	8	0.742
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1838-1868	8	0.742
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733165-733195	8	0.742
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733192-733222	8	0.742
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733318-733348	8	0.742
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733363-733393	8	0.742
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733390-733420	8	0.742
NZ_CP045537_3	3.32\|1610715\|31\|NZ_CP045537\|CRT	1610715-1610745	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192284-192314	8	0.742
NZ_CP045537_3	3.32\|1610715\|31\|NZ_CP045537\|CRT	1610715-1610745	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192365-192395	8	0.742
NZ_CP045537_3	3.32\|1610715\|31\|NZ_CP045537\|CRT	1610715-1610745	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192905-192935	8	0.742
NZ_CP045537_3	3.32\|1610715\|31\|NZ_CP045537\|CRT	1610715-1610745	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116769-116799	8	0.742
NZ_CP045537_3	3.32\|1610715\|31\|NZ_CP045537\|CRT	1610715-1610745	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110731-110761	8	0.742
NZ_CP045537_3	3.32\|1610715\|31\|NZ_CP045537\|CRT	1610715-1610745	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110839-110869	8	0.742
NZ_CP045537_3	3.32\|1610715\|31\|NZ_CP045537\|CRT	1610715-1610745	31	NZ_CP026221	Aeromonas sp. ASNIH4 plasmid pAER-f909, complete sequence	53220-53250	8	0.742
NZ_CP045537_3	3.32\|1610715\|31\|NZ_CP045537\|CRT	1610715-1610745	31	NC_019519	Agrobacterium phage 7-7-1, complete genome	31204-31234	8	0.742
NZ_CP045537_3	3.35\|1610895\|31\|NZ_CP045537\|CRT	1610895-1610925	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110839-110869	8	0.742
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	51839-51869	8	0.742
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52001-52031	8	0.742
NZ_CP045537_3	3.40\|1611192\|31\|NZ_CP045537\|CRT	1611192-1611222	31	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52595-52625	8	0.742
NZ_CP045537_3	3.2\|1608735\|40\|NZ_CP045537\|CRT	1608735-1608774	40	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10293-10332	9	0.775
NZ_CP045537_3	3.3\|1608798\|31\|NZ_CP045537\|CRT	1608798-1608828	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733463-733493	9	0.71
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190513-190543	9	0.71
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	178567-178597	9	0.71
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	177171-177201	9	0.71
NZ_CP045537_3	3.12\|1609374\|31\|NZ_CP045537\|CRT	1609374-1609404	31	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	179581-179611	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	156771-156801	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190477-190507	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190936-190966	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192185-192215	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192815-192845	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	65-95	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	272-302	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	452-482	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1010-1040	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1145-1175	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1199-1229	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1784-1814	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733039-733069	9	0.71
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	NZ_CP015352	Bacillus thuringiensis strain MYBT18246 plasmid p142098, complete sequence	24243-24273	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	156771-156801	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190477-190507	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190936-190966	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192185-192215	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192815-192845	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	65-95	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	272-302	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	452-482	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1010-1040	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1145-1175	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1199-1229	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1784-1814	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733039-733069	9	0.71
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	NZ_CP015352	Bacillus thuringiensis strain MYBT18246 plasmid p142098, complete sequence	24243-24273	9	0.71
NZ_CP045537_3	3.21\|1609896\|31\|NZ_CP045537\|CRT	1609896-1609926	31	NZ_CP020455	Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence	197504-197534	9	0.71
NZ_CP045537_3	3.22\|1609950\|31\|NZ_CP045537\|CRT	1609950-1609980	31	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733463-733493	9	0.71
NZ_CP045537_3	3.35\|1610895\|31\|NZ_CP045537\|CRT	1610895-1610925	31	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	305285-305315	9	0.71
NZ_CP045537_3	3.35\|1610895\|31\|NZ_CP045537\|CRT	1610895-1610925	31	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	97617-97647	9	0.71
NZ_CP045537_3	3.13\|1609428\|40\|NZ_CP045537\|CRT	1609428-1609467	40	KY963370	Bacillus phage Negev_SA, complete genome	34897-34936	10	0.75
NZ_CP045537_3	3.13\|1609428\|40\|NZ_CP045537\|CRT	1609428-1609467	40	KY963370	Bacillus phage Negev_SA, complete genome	34933-34972	10	0.75
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192266-192296	10	0.677
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3888-3918	10	0.677
NZ_CP045537_3	3.15\|1609554\|31\|NZ_CP045537\|CRT	1609554-1609584	31	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29587-29617	10	0.677
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	192266-192296	10	0.677
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3888-3918	10	0.677
NZ_CP045537_3	3.17\|1609671\|31\|NZ_CP045537\|CRT	1609671-1609701	31	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29587-29617	10	0.677
NZ_CP045537_3	3.28\|1610427\|40\|NZ_CP045537\|CRT	1610427-1610466	40	MN586053	Arthrobacter phage BeatusComedenti, complete genome	29797-29836	10	0.75
NZ_CP045537_3	3.28\|1610427\|40\|NZ_CP045537\|CRT	1610427-1610466	40	NC_031231	Arthrobacter phage KellEzio, complete genome	29799-29838	10	0.75
NZ_CP045537_3	3.42\|1611291\|40\|NZ_CP045537\|CRT	1611291-1611330	40	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	190441-190480	10	0.75

1. spacer 3.34|1610850|22|NZ_CP045537|CRT matches to NZ_CP015256 (Bacillus thuringiensis Bt18247 plasmid p12509, complete sequence) position: , mismatch: 2, identity: 0.909

aactccagtaggtccagtgttg	CRISPR spacer
aactccagtaggtcctgtgttt	Protospacer
*************** *****

2. spacer 3.34|1610850|22|NZ_CP045537|CRT matches to NZ_CP015256 (Bacillus thuringiensis Bt18247 plasmid p12509, complete sequence) position: , mismatch: 2, identity: 0.909

aactccagtaggtccagtgttg	CRISPR spacer
aactccagtaggtcctgtgttt	Protospacer
*************** *****

3. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
ggccttgagaaccagtagcaccagtag	Protospacer
 ******** *********.*******

4. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
*.******* *** *************

5. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

6. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

7. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
*.******* *** *************

8. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
*.******* *** *************

9. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

10. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

11. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
ggccttgagaaccagtagcaccagtag	Protospacer
 ******** *********.*******

12. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
*.******* *** *************

13. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

14. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

15. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
*.******* *** *************

16. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
*.******* *** *************

17. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

18. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

19. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgagcaccagttgcaccggtat	Protospacer
 *************** *********

20. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgagcaccagttgcaccggtat	Protospacer
 *************** *********

21. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgagcaccagttgcaccggtat	Protospacer
 *************** *********

22. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgaggaccagtagcaccagtag	Protospacer
 ******** ************.****

23. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
**********.***********.**.*

24. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
**********.***********.**.*

25. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
**********.***********.**.*

26. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
**********.***********.**.*

27. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.903

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcaccggtaggtccagtgtca	Protospacer
************.*************** .*

28. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.903

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcaccggtaggtccagtgtca	Protospacer
************.*************** .*

29. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 3, identity: 0.903

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtattgccggtaggtccagtgatg	Protospacer
*********.*.******************.

30. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.903

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcaccggtaggtccagtgtca	Protospacer
************.*************** .*

31. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.903

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcaccggtaggtccagtgtca	Protospacer
************.*************** .*

32. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 3, identity: 0.903

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtattgccggtaggtccagtgatg	Protospacer
*********.*.******************.

33. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to NZ_CP046295 (Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
tagcttgagcaccagtagcgccagcag	Protospacer
.. *********************.**

34. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

35. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

36. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

37. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

38. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

39. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

40. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

41. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

42. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

43. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
ggccttgagcaccagttgcaccagtat	Protospacer
 *************** **.******

44. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

45. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gaccttgaggaccagtagcaccagtag	Protospacer
 .******* *********.*******

46. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to NZ_CP046295 (Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
tagcttgagcaccagtagcgccagcag	Protospacer
.. *********************.**

47. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

48. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

49. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

50. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

51. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

52. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

53. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

54. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

55. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

56. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
ggccttgagcaccagttgcaccagtat	Protospacer
 *************** **.******

57. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

58. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gaccttgaggaccagtagcaccagtag	Protospacer
 .******* *********.*******

59. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagaaccagtagcaccagtag	Protospacer
 .******* ************.****

60. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MN497953 (Mycobacterium phage GtownJaz, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

61. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MH020238 (Mycobacterium phage Lilith, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

62. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MH077583 (Mycobacterium phage PGHhamlin, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

63. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MH727554 (Mycobacterium phage MuchMore, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

64. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MH338240 (Mycobacterium phage Sabia, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

65. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KM233455 (Mycobacterium phage Farber, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

66. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KX664448 (Mycobacterium phage Watson, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

67. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KX507362 (Mycobacterium phage Aglet, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

68. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MH576949 (Mycobacterium phage BreSam8, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

69. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MN585969 (Mycobacterium phage Dieselweasel, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

70. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MH536813 (Mycobacterium phage AugsMagnumOpus, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

71. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MF185733 (Mycobacterium phage StepMih, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

72. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MF185732 (Mycobacterium phage Stagni, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

73. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MK494096 (Mycobacterium phage Mainiac, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

74. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KU984914 (Mycobacterium phage Malinsilva, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

75. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to JF704101 (Mycobacterium virus Microwolf, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

76. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KT359365 (Mycobacterium phage DaHudson, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

77. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MH651179 (Mycobacterium phage MadMarie, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

78. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgagcaccagttgcaccggtgt	Protospacer
 *************** ********.

79. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to NC_028798 (Mycobacterium phage MarQuardt, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

80. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  *****************.***** *

81. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  *****************.***** *

82. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  *****************.***** *

83. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  *****************.***** *

84. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgaggaccagtagcaccaccag	Protospacer
********* ************. .**

85. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  *****************.***** *

86. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  *****************.***** *

87. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgaggaccagtagcaccaccag	Protospacer
********* ************. .**

88. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgaacaccagtagcaccagtgg	Protospacer
.*******.*************.**.*

89. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgaggaccagtagcaccaccag	Protospacer
********* ************. .**

90. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgaacaccagtagcaccagtgg	Protospacer
.*******.*************.**.*

91. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MK448703 (Streptococcus phage Javan207, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgagcaccagtagcacctttat	Protospacer
.*********************  **

92. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to NC_041891 (Propionibacterium phage B22, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccatgagcaccagtcgcaccggcac	Protospacer
**** *********** *******.*

93. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to NC_041894 (Propionibacterium phage E6, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccatgagcaccagtcgcaccggcac	Protospacer
**** *********** *******.*

94. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KX620754 (Propionibacterium phage G4, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccatgagcaccagtcgcaccggcac	Protospacer
**** *********** *******.*

95. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KX160207 (Lactococcus phage 53801, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
cacctttaggaccagtagcaccgttgg	Protospacer
****** ** ************* *.*

96. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcaccggtaggtccagtatca	Protospacer
************.**************. .*

97. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcaccggtaggtccagtgtca	Protospacer
***.********.*************** .*

98. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcaccggtaggtccggtgtca	Protospacer
************.***********.*** .*

99. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcaccggtaggtccagtatca	Protospacer
************.**************. .*

100. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcaccggtaggtccggtgtca	Protospacer
************.***********.*** .*

101. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcaccggtaggtccagtgtca	Protospacer
***.********.*************** .*

102. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgacgccggtcggtccagtgatg	Protospacer
.********* ******* ***********.

103. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgacgccggtcggtccagtgatg	Protospacer
.********* ******* ***********.

104. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcaccggtaggtccagtgtca	Protospacer
***.********.*************** .*

105. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_020385 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcaccggtaggtccagtgtca	Protospacer
***.********.*************** .*

106. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agatccagtgtcgcccgtaggtccagtgctt	Protospacer
**.************ ************ *

107. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcgcccgtaggtccagtgtca	Protospacer
***.*********** ************ .*

108. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcacctgtaggtccagtgctt	Protospacer
************.** ************ *

109. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcacctgtaggtccagtgctt	Protospacer
************.** ************ *

110. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcgcccgtaggtccagtgtca	Protospacer
***.*********** ************ .*

111. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcacctgtaggtccagtgctt	Protospacer
************.** ************ *

112. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcaccggtaggtccagtgtca	Protospacer
***.********.*************** .*

113. spacer 3.11|1609320|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 4, identity: 0.871

aggtccggtgttgccagtaggtccagtgtcg	CRISPR spacer
aggtccagtgatgccagtaggtccagtattg	Protospacer
******.*** ****************.*.*

114. spacer 3.11|1609320|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 4, identity: 0.871

aggtccggtgttgccagtaggtccagtgtcg	CRISPR spacer
aggtccagtgatgccagtaggtccagtattg	Protospacer
******.*** ****************.*.*

115. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
aggtccggtaggtccagtaggtccagtgttt	Protospacer
***********  ****************.

116. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcaccggtaggtccagtatca	Protospacer
************.**************. .*

117. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcaccggtaggtccagtgtca	Protospacer
***.********.*************** .*

118. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcaccggtaggtccggtgtca	Protospacer
************.***********.*** .*

119. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcaccggtaggtccagtatca	Protospacer
************.**************. .*

120. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcaccggtaggtccggtgtca	Protospacer
************.***********.*** .*

121. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcaccggtaggtccagtgtca	Protospacer
***.********.*************** .*

122. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgacgccggtcggtccagtgatg	Protospacer
.********* ******* ***********.

123. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgacgccggtcggtccagtgatg	Protospacer
.********* ******* ***********.

124. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcaccggtaggtccagtgtca	Protospacer
***.********.*************** .*

125. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_020385 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcaccggtaggtccagtgtca	Protospacer
***.********.*************** .*

126. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agatccagtgtcgcccgtaggtccagtgctt	Protospacer
**.************ ************ *

127. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcgcccgtaggtccagtgtca	Protospacer
***.*********** ************ .*

128. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcacctgtaggtccagtgctt	Protospacer
************.** ************ *

129. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcacctgtaggtccagtgctt	Protospacer
************.** ************ *

130. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcgcccgtaggtccagtgtca	Protospacer
***.*********** ************ .*

131. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtgtcacctgtaggtccagtgctt	Protospacer
************.** ************ *

132. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 4, identity: 0.871

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggcccagtgtcaccggtaggtccagtgtca	Protospacer
***.********.*************** .*

133. spacer 3.35|1610895|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

agagccagtgtcgcccgtaggtccggtgttc	CRISPR spacer
agatccagtgtcgcccgtaggtccagtgctt	Protospacer
*** ********************.***.*.

134. spacer 3.37|1611003|31|NZ_CP045537|CRT matches to NC_004821 (Bacillus prophage phBC6A52, complete genome) position: , mismatch: 4, identity: 0.871

gttgccggtaggtccggtgttcccagtaggt	CRISPR spacer
gcttccggtaggtccggtgtccccagtaggc	Protospacer
*.* ****************.*********.

135. spacer 3.37|1611003|31|NZ_CP045537|CRT matches to NC_004821 (Bacillus prophage phBC6A52, complete genome) position: , mismatch: 4, identity: 0.871

gttgccggtaggtccggtgttcccagtaggt	CRISPR spacer
gcttccggtaggtccggtgtccccagtaggc	Protospacer
*.* ****************.*********.

136. spacer 3.37|1611003|31|NZ_CP045537|CRT matches to NC_004821 (Bacillus prophage phBC6A52, complete genome) position: , mismatch: 4, identity: 0.871

gttgccggtaggtccggtgttcccagtaggt	CRISPR spacer
gcttccggtaggtccggtgtccccagtaggc	Protospacer
*.* ****************.*********.

137. spacer 3.37|1611003|31|NZ_CP045537|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.871

gttgccggtaggtccggtgttcccagtaggt	CRISPR spacer
gtcaccggtaggtccggtgtcaccagtaggt	Protospacer
**..****************. *********

138. spacer 3.37|1611003|31|NZ_CP045537|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.871

gttgccggtaggtccggtgttcccagtaggt	CRISPR spacer
gtcaccggtaggtccggtgtcaccagtaggt	Protospacer
**..****************. *********

139. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 4, identity: 0.871

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
attgccggtaggtccagtgatgccagtaggt	Protospacer
.*.******** ********* *********

140. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 4, identity: 0.871

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
gactccggtagctccagtgatcccggtagct	Protospacer
* * ********************.**** *

141. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 4, identity: 0.871

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
gactccggtagctccagtgatcccggtagct	Protospacer
* * ********************.**** *

142. spacer 2.6|1492523|27|NZ_CP045537|CRT matches to NC_019387 (Thermus oshimai JL-2 plasmid pTHEOS01, complete sequence) position: , mismatch: 5, identity: 0.815

caccagtagcccctgcaggcccttgaa	CRISPR spacer
caccagaagccccttcaggccctcggt	Protospacer
****** ******* ********.*.

143. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to KY984068 (Erwinia phage vB_EamM_Y3, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
ggccttgagcaccagtagcgccacgca	Protospacer
 **********************   .

144. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

145. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

146. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaacaccagtagcaccagtgg	Protospacer
..******.**********.*****.*

147. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaacaccagtagcaccagtgg	Protospacer
..******.**********.*****.*

148. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to NZ_CP032678 (Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
cgccttgagcaccagtagccccaccca	Protospacer
******************* *** . .

149. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

150. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

151. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gaccttgaggaccagtagctccagtat	Protospacer
 .******* ********* ******

152. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to KX534340 (Phage Wrath, partial genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
agccttcagcaccagtatcgccagaac	Protospacer
 ***** ********** ****** *

153. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to KY984068 (Erwinia phage vB_EamM_Y3, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
ggccttgagcaccagtagcgccacgca	Protospacer
 **********************   .

154. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

155. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

156. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaacaccagtagcaccagtgg	Protospacer
..******.**********.*****.*

157. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaacaccagtagcaccagtgg	Protospacer
..******.**********.*****.*

158. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to NZ_CP032678 (Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
cgccttgagcaccagtagccccaccca	Protospacer
******************* *** . .

159. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

160. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

161. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gaccttgaggaccagtagctccagtat	Protospacer
 .******* ********* ******

162. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to KX534340 (Phage Wrath, partial genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
agccttcagcaccagtatcgccagaac	Protospacer
 ***** ********** ****** *

163. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
.******** ************.**.

164. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
.******** ************.**.

165. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccctgagcaccagtagcacccgtgc	Protospacer
 ***.***************** **.

166. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to AP014498 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S34-C64, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgagcaccagtagcaccctgaa	Protospacer
.*********************   *.

167. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to AP014498 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S34-C64, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
aaccttgagcaccagtagaaccttgag	Protospacer
 ***************** ***   **

168. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgaggaccagtagcaccaccag	Protospacer
 ******** ************. .**

169. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgaggaccggtagcaccgatta	Protospacer
********* ***.*********.* .

170. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgagcaccagtagcaccttgtg	Protospacer
 *********************    *

171. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgaggaccagtagcaccaccag	Protospacer
 ******** ************. .**

172. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgaggaccggtagcaccgatta	Protospacer
********* ***.*********.* .

173. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgaggaccagtagcaccaccag	Protospacer
 ******** ************. .**

174. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgaggaccggtagcaccgatta	Protospacer
********* ***.*********.* .

175. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to NZ_CP018231 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed3) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgatcaccagcagcaccggcct	Protospacer
******** ******.********.

176. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to NZ_CP016292 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgatcaccagcagcaccggcct	Protospacer
******** ******.********.

177. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagttgcaccagtat	Protospacer
 .************** *****.***

178. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to NC_028998 (Phormidium phage MIS-PhV1B, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgagcaccagttgcaccagtta	Protospacer
.*************** *****.** .

179. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to AP013524 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G3, isolate: uvMED-CGR-C7-MedDCM-OCT-S39-C15) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcgccagtagcacctgttg	Protospacer
 .********.*********** ** *

180. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to MG592476 (Vibrio phage 1.104.O._10N.286.49.A12, partial genome) position: , mismatch: 5, identity: 0.815

caccttga----gcaccagtagcaccggtag	CRISPR spacer
----tcgaagcggcaccagtagcaccggtag	Protospacer
    *.**    *******************

181. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to KU886222 (Erwinia phage vB_EamM_Special G, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
cgccttttgcaccagtagcaccggtgt	Protospacer
*.****  *****************.

182. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

183. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
*********.** **************.*.

184. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

185. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

186. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

187. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
*********.** **************.*.

188. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
*********.** **************.*.

189. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

190. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
*********.** **************.*.

191. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

192. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

193. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
*********.** **************.*.

194. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

195. spacer 3.11|1609320|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 5, identity: 0.839

aggtccggtgttgccagtaggtccagtgtcg	CRISPR spacer
aggtccagtattgccagtaggtccagtgggc	Protospacer
******.**.******************

196. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
aggtccagtagctccagtaggtccagtagct	Protospacer
******.***** **************. *

197. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
aggtccagtagctccagtaggtccagtagct	Protospacer
******.***** **************. *

198. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
aggtccagtagctccagtaggtccagtagct	Protospacer
******.***** **************. *

199. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
aggtccagtagctccagtaggtccagtagct	Protospacer
******.***** **************. *

200. spacer 3.18|1609725|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 5, identity: 0.839

aggtccggtgataccagtaggtccagtaact	CRISPR spacer
aggtccagtgatgccagtaggtccagtattg	Protospacer
******.*****.*************** .

201. spacer 3.18|1609725|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 5, identity: 0.839

aggtccggtgataccagtaggtccagtaact	CRISPR spacer
aggtccagtgatgccagtaggtccagtattg	Protospacer
******.*****.*************** .

202. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

203. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
*********.** **************.*.

204. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

205. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

206. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

207. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
*********.** **************.*.

208. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
*********.** **************.*.

209. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

210. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
*********.** **************.*.

211. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

212. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

213. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
*********.** **************.*.

214. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 5, identity: 0.839

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtaact	Protospacer
*********.** **************.*.

215. spacer 3.35|1610895|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.839

agagccagtgtcgcccgtaggtccggtgttc	CRISPR spacer
aggcccagtgtcgcccgtaggtccagtgtca	Protospacer
**. ********************.****.

216. spacer 3.35|1610895|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.839

agagccagtgtcgcccgtaggtccggtgttc	CRISPR spacer
aggcccagtgtcgcccgtaggtccagtgtca	Protospacer
**. ********************.****.

217. spacer 3.36|1610949|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 5, identity: 0.839

gtcgccggtagctccagtgttcccagtaggt	CRISPR spacer
gactccggtagctccagtgatcccggtagct	Protospacer
* * *************** ****.**** *

218. spacer 3.36|1610949|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 5, identity: 0.839

gtcgccggtagctccagtgttcccagtaggt	CRISPR spacer
gactccggtagctccagtgatcccggtagct	Protospacer
* * *************** ****.**** *

219. spacer 3.37|1611003|31|NZ_CP045537|CRT matches to NC_004821 (Bacillus prophage phBC6A52, complete genome) position: , mismatch: 5, identity: 0.839

gttgccggtaggtccggtgttcccagtaggt	CRISPR spacer
gcttccagtaggtccggtgtccccagtaggc	Protospacer
*.* **.*************.*********.

220. spacer 3.37|1611003|31|NZ_CP045537|CRT matches to NC_004821 (Bacillus prophage phBC6A52, complete genome) position: , mismatch: 5, identity: 0.839

gttgccggtaggtccggtgttcccagtaggt	CRISPR spacer
gcttccagtaggtccggtgtccccagtaggc	Protospacer
*.* **.*************.*********.

221. spacer 3.37|1611003|31|NZ_CP045537|CRT matches to NC_004821 (Bacillus prophage phBC6A52, complete genome) position: , mismatch: 5, identity: 0.839

gttgccggtaggtccggtgttcccagtaggt	CRISPR spacer
gcttccagtaggtccggtgtccccagtaggc	Protospacer
*.* **.*************.*********.

222. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 5, identity: 0.839

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
attaccggtaggtccagtgatgccagtaggt	Protospacer
.*..******* ********* *********

223. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 5, identity: 0.839

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
gactccggtagctccagtgattccagtggct	Protospacer
* * *****************.*****.* *

224. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 5, identity: 0.839

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
gactccggtagctccagtgattccggtagct	Protospacer
* * *****************.**.**** *

225. spacer 2.6|1492523|27|NZ_CP045537|CRT matches to MF140397 (Arthrobacter phage Abidatro, complete genome) position: , mismatch: 6, identity: 0.778

caccagtagcccctgcaggcccttgaa	CRISPR spacer
ggcccgttgcccctgcaggcccttgcg	Protospacer
 .** ** ***************** .

226. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
..******* *********.*****.

227. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
..******* *********.*****.

228. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to MK496823 (Capybara microvirus Cap3_SP_645, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgagcaccagtacctccagttt	Protospacer
..*************** * *****

229. spacer 2.11|1492730|27|NZ_CP045537|CRT matches to NC_028998 (Phormidium phage MIS-PhV1B, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgagcaccagttgcaccagtta	Protospacer
..************** **.***** .

230. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
..******* *********.*****.

231. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
..******* *********.*****.

232. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to MK496823 (Capybara microvirus Cap3_SP_645, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgagcaccagtacctccagttt	Protospacer
..*************** * *****

233. spacer 2.13|1492829|27|NZ_CP045537|CRT matches to NC_028998 (Phormidium phage MIS-PhV1B, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgagcaccagttgcaccagtta	Protospacer
..************** **.***** .

234. spacer 2.14|1492874|27|NZ_CP045537|CRT matches to NZ_CP010864 (Marinovum algicola DG 898 plasmid pMaD9, complete sequence) position: , mismatch: 6, identity: 0.778

caccttgagcaccagtagcaccggtag	CRISPR spacer
atccttgagcaccagcagcacccgtgc	Protospacer
  *************.****** **.

235. spacer 2.16|1492973|36|NZ_CP045537|CRT matches to NZ_CP032531 (Bacillus megaterium NCT-2 plasmid pNCT2_3, complete sequence) position: , mismatch: 6, identity: 0.833

cgccttgagg-tccttgaggtccagtggcaccttgag	CRISPR spacer
-gtcctgtggctccttgaggtcctgtggctccttgag	Protospacer
 *.*.** ** ************ ***** *******

236. spacer 2.16|1492973|36|NZ_CP045537|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 6, identity: 0.833

cgccttgaggtccttgaggtccagtggcaccttgag	CRISPR spacer
ctcctgctggaccttgaggtccagtagcaccttgag	Protospacer
* ***   ** **************.**********

237. spacer 3.1|1608681|31|NZ_CP045537|CRT matches to KY984068 (Erwinia phage vB_EamM_Y3, complete genome) position: , mismatch: 6, identity: 0.806

aggtccggtgttgccagtagtccccgttcta	CRISPR spacer
aggtcctgtgttgccagtaggcccattacga	Protospacer
****** ************* ***  * * *

238. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgtctccggtaggtccagtatct	Protospacer
.*********** **************. .

239. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgtctccggtaggtccagtatct	Protospacer
.*********** **************. .

240. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

241. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

242. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

243. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

244. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

245. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

246. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

247. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

248. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

249. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

250. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

251. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

252. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

253. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

254. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

255. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

256. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

257. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

258. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

259. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

260. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

261. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

262. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

263. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

264. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

265. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

266. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

267. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

268. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

269. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

270. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

271. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

272. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

273. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

274. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

275. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

276. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

277. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

278. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

279. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

280. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagttgct	Protospacer
*********.** ************** ..

281. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

282. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

283. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagttgct	Protospacer
*********.** ************** ..

284. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

285. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

286. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

287. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

288. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

289. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

290. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagttgct	Protospacer
*********.** ************** ..

291. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

292. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

293. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

294. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

295. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

296. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

297. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

298. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

299. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

300. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

301. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

302. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

303. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

304. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

305. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

306. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagttgct	Protospacer
*********.** ************** ..

307. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

308. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

309. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

310. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

311. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

312. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

313. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

314. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

315. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

316. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

317. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgtctccggtaggtccggtattt	Protospacer
.*********** ***********.**. *

318. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgtctccggtaggtccggtattt	Protospacer
.*********** ***********.**. *

319. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtgtctccggtaggtccagtcgga	Protospacer
**  ******** ************** . *

320. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtgtctccggtaggtccagttgga	Protospacer
**  ******** ************** . *

321. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtgtctccggtaggtccagttgga	Protospacer
**  ******** ************** . *

322. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtgtctccggtaggtccagttgga	Protospacer
**  ******** ************** . *

323. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtgtctccggtaggtccagtcgga	Protospacer
**  ******** ************** . *

324. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
aggtccggtagatccagtaggtccagtaggt	Protospacer
***********  **************.

325. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
aggtccggttgctccagtaggtccagtaggc	Protospacer
********* ** **************.

326. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
agcaccggtagcgccggtaggtccagtagca	Protospacer
**  ***********.***********. *.

327. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtagctccggtaggtcctgtagct	Protospacer
. . ******************** *****

328. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtagctccggtaggtcctgtagct	Protospacer
. . ******************** *****

329. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtagatccggtaggtccggtaggc	Protospacer
.  ******** *****************

330. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtagctccggtaggtcctgtagct	Protospacer
. . ******************** *****

331. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP017574 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtagctccagtaggcccggtagct	Protospacer
.  ************.*****.********

332. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
tgtcccagtaggtccagtaggtccggtagat	Protospacer
  ********* ***.*************

333. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
. . ****** *************.******

334. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
. . ****** *************.******

335. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcaccagtatctccggtaggtccagtagcg	Protospacer
. . ****** *************.******

336. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
. . ****** *************.******

337. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
. . ****** *************.******

338. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtacctccggtaggtccagtagcg	Protospacer
. . ****** *************.******

339. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
gggtccagtatctccggtaggtccggtatct	Protospacer
*  .****** ***************** *

340. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtagctccggtaggtcctgtagct	Protospacer
. . ******************** *****

341. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtagctccggtaggtcctgtagct	Protospacer
. . ******************** *****

342. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtagatccggtaggtccggtaggc	Protospacer
.  ******** *****************

343. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtagctccggtaggtcctgtagct	Protospacer
. . ******************** *****

344. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP017574 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtagctccagtaggcccggtagct	Protospacer
.  ************.*****.********

345. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
tgtcccagtaggtccagtaggtccggtagat	Protospacer
  ********* ***.*************

346. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
. . ****** *************.******

347. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
. . ****** *************.******

348. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcaccagtatctccggtaggtccagtagcg	Protospacer
. . ****** *************.******

349. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
. . ****** *************.******

350. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
. . ****** *************.******

351. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtacctccggtaggtccagtagcg	Protospacer
. . ****** *************.******

352. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.806

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
gggtccagtatctccggtaggtccggtatct	Protospacer
*  .****** ***************** *

353. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgtctccggtaggtccagtatct	Protospacer
.*********** **************. .

354. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgtctccggtaggtccagtatct	Protospacer
.*********** **************. .

355. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

356. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

357. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

358. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

359. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

360. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

361. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

362. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

363. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

364. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

365. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

366. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

367. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

368. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

369. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

370. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

371. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

372. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

373. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

374. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

375. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

376. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

377. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

378. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

379. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

380. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

381. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

382. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

383. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

384. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

385. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

386. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

387. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

388. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

389. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

390. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

391. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

392. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

393. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

394. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

395. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagttgct	Protospacer
*********.** ************** ..

396. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

397. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

398. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagttgct	Protospacer
*********.** ************** ..

399. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

400. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

401. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

402. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

403. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

404. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

405. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagttgct	Protospacer
*********.** ************** ..

406. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

407. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

408. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

409. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

410. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

411. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

412. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

413. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

414. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

415. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

416. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

417. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

418. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

419. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

420. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

421. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagttgct	Protospacer
*********.** ************** ..

422. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

423. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

424. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

425. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

426. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

427. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

428. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

429. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
*********.** **************. .

430. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

431. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatccccggtaggtccagtatcc	Protospacer
*********.** **************. .

432. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgtctccggtaggtccggtattt	Protospacer
.*********** ***********.**. *

433. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgtctccggtaggtccggtattt	Protospacer
.*********** ***********.**. *

434. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtgtctccggtaggtccagtcgga	Protospacer
**  ******** ************** . *

435. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtgtctccggtaggtccagttgga	Protospacer
**  ******** ************** . *

436. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtgtctccggtaggtccagttgga	Protospacer
**  ******** ************** . *

437. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtgtctccggtaggtccagttgga	Protospacer
**  ******** ************** . *

438. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtgtctccggtaggtccagtcgga	Protospacer
**  ******** ************** . *

439. spacer 3.32|1610715|31|NZ_CP045537|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 6, identity: 0.806

agagccagtgttgccggtaggtccggtgttg	CRISPR spacer
aggtccagtgtcaccggtaggtccggtgtca	Protospacer
**. *******..****************..

440. spacer 3.32|1610715|31|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 6, identity: 0.806

agagccagtgttgccggtaggtccggtgttg	CRISPR spacer
aggcccagtgttaccagtaggtccggtgtca	Protospacer
**. ********.**.*************..

441. spacer 3.32|1610715|31|NZ_CP045537|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 6, identity: 0.806

agagccagtgttgccggtaggtccggtgttg	CRISPR spacer
aggtccagtgtcaccggtaggtccggtgtca	Protospacer
**. *******..****************..

442. spacer 3.35|1610895|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.806

agagccagtgtcgcccgtaggtccggtgttc	CRISPR spacer
agacccagtgtcgcccgtaggtccagtaggt	Protospacer
*** ********************.**.  .

443. spacer 3.35|1610895|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.806

agagccagtgtcgcccgtaggtccggtgttc	CRISPR spacer
aggcccagtgtcgcccgtagatccagtgtcg	Protospacer
**. ****************.***.****.

444. spacer 3.35|1610895|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.806

agagccagtgtcgcccgtaggtccggtgttc	CRISPR spacer
aggcccagtgtcgcccataggtccagtgctt	Protospacer
**. ************.*******.***.*.

445. spacer 3.35|1610895|31|NZ_CP045537|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 6, identity: 0.806

agagccagtgtcgcccgtaggtccggtgttc	CRISPR spacer
aggtccagtgtcaccggtaggtccggtgtca	Protospacer
**. ********.** *************.

446. spacer 3.35|1610895|31|NZ_CP045537|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 6, identity: 0.806

agagccagtgtcgcccgtaggtccggtgttc	CRISPR spacer
aggtccagtgtcaccggtaggtccggtgtca	Protospacer
**. ********.** *************.

447. spacer 3.36|1610949|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 6, identity: 0.806

gtcgccggtagctccagtgttcccagtaggt	CRISPR spacer
gactccggtagctccagtgattccagtggct	Protospacer
* * *************** *.*****.* *

448. spacer 3.37|1611003|31|NZ_CP045537|CRT matches to MF063068 (Pseudomonas phage Noxifer, complete genome) position: , mismatch: 6, identity: 0.806

gttgccggtaggtccggtgttcccagtaggt	CRISPR spacer
gcgtcaggtaggtcgggtgttcccagtgggt	Protospacer
*.  * ******** ************.***

449. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 6, identity: 0.806

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
aactccggtagctccagtgattccagtggct	Protospacer
. * *****************.*****.* *

450. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 6, identity: 0.806

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
gatcccggtagctccagtgattccggtagct	Protospacer
* . *****************.**.**** *

451. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 6, identity: 0.806

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
gatcccggtagctccagtgattccggtagct	Protospacer
* . *****************.**.**** *

452. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 6, identity: 0.806

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
gattccggtagctccagtgattccggtagct	Protospacer
* . *****************.**.**** *

453. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
cggtccagtgtttccggtaggtccagtatct	Protospacer
 **********. **************. .

454. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgtctccggtgggtccagtatct	Protospacer
.*********** *****.********. .

455. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgtctccggtaggtccggtatct	Protospacer
.*********** ***********.**. .

456. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agacccagtgtcgcccgtaggtccagtaggt	Protospacer
**..*********** ***********..

457. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccaggatct	Protospacer
*********.** ************* . .

458. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccaggatct	Protospacer
*********.** ************* . .

459. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccaggatct	Protospacer
*********.** ************* . .

460. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccaggatct	Protospacer
*********.** ************* . .

461. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
cggtccagtgtttccggtaggtccagtatct	Protospacer
 **********. **************. .

462. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

463. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagtcgga	Protospacer
**  *****.** ************** . *

464. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

465. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

466. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

467. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

468. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

469. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagca	Protospacer
**  **.***** **************...*

470. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcaccagtgtctccggtaggaccagtcgga	Protospacer
**  ******** ******** ***** . *

471. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

472. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtcgga	Protospacer
**  **.***** ************** . *

473. spacer 3.11|1609320|31|NZ_CP045537|CRT matches to NC_011879 (Pseudarthrobacter chlorophenolicus A6 plasmid pACHL01, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccggtgttgccagtaggtccagtgtcg	CRISPR spacer
tctccccgtgttgccagtgggtccagtgttg	Protospacer
   .** ***********.**********.*

474. spacer 3.11|1609320|31|NZ_CP045537|CRT matches to KY984068 (Erwinia phage vB_EamM_Y3, complete genome) position: , mismatch: 7, identity: 0.774

aggtccggtgttgccagtaggtccagtgtcg	CRISPR spacer
aggtcctgtgttgccagtaggcccattacga	Protospacer
****** **************.*** *.. .

475. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NZ_CP040335 (Bacillus cereus strain DLOU-Changhai plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
aggtccggtagctccagtaggtcccgaaggt	Protospacer
************ *********** * .

476. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
aattccggtagctccagtagctccagtgatt	Protospacer
*. ********* ******* ******* .

477. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtagct	Protospacer
.  .** ***************** *****

478. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtagct	Protospacer
.  .** ***************** *****

479. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtagct	Protospacer
.  .** ***************** *****

480. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtagct	Protospacer
.  .** ***************** *****

481. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtagct	Protospacer
.  .** ***************** *****

482. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtcgatccggtaggtccggtaggc	Protospacer
.  ****** * *****************

483. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtcgatccggtaggtccggtaggc	Protospacer
.  ****** * *****************

484. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtcgatccggtaggtccggtaggc	Protospacer
.  ****** * *****************

485. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtcgatccggtaggtccggtaggc	Protospacer
.  ****** * *****************

486. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtaggtccggtaggtccagtaggt	Protospacer
.  ******** ************.****

487. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP017574 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agctccagtagctccggtagttccagtagct	Protospacer
. ..**************** ***.*****

488. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP017574 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agctccagtagctccggtagttccagtagct	Protospacer
. ..**************** ***.*****

489. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agttccagtaggtccagtaggtccggtagat	Protospacer
. *.******* ***.*************

490. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtagcaccggtaggtccagtagca	Protospacer
. . ******** ***********.*****.

491. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagcaccggtaggtccagtagca	Protospacer
.  .******** ***********.*****.

492. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtagct	Protospacer
.  .*********** ********.*****

493. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctccagtaggtccagtagct	Protospacer
.  .***********.********.*****

494. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtagct	Protospacer
.  .*********** ********.*****

495. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctccagtaggtccagtagct	Protospacer
.  .***********.********.*****

496. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtagct	Protospacer
.  .*********** ********.*****

497. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctccagtaggtccagtagct	Protospacer
.  .***********.********.*****

498. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtagct	Protospacer
.  .*********** ********.*****

499. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctccagtaggtccagtagct	Protospacer
.  .***********.********.*****

500. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtagct	Protospacer
.  .*********** ********.*****

501. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
tgccccagtagctccggtagctccggttgat	Protospacer
  .***************** ****** *

502. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
gggtccagtgtctccggtaggtccggtatct	Protospacer
*  .*****. ***************** *

503. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
ggtaatagtagcgccggtagggccggtagcc	Protospacer
* *  .****** ******** ********

504. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtagct	Protospacer
.  .** ***************** *****

505. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtagct	Protospacer
.  .** ***************** *****

506. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtagct	Protospacer
.  .** ***************** *****

507. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtagct	Protospacer
.  .** ***************** *****

508. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtagct	Protospacer
.  .** ***************** *****

509. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtcgatccggtaggtccggtaggc	Protospacer
.  ****** * *****************

510. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtcgatccggtaggtccggtaggc	Protospacer
.  ****** * *****************

511. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtcgatccggtaggtccggtaggc	Protospacer
.  ****** * *****************

512. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtcgatccggtaggtccggtaggc	Protospacer
.  ****** * *****************

513. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggcccagtaggtccggtaggtccagtaggt	Protospacer
.  ******** ************.****

514. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP017574 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agctccagtagctccggtagttccagtagct	Protospacer
. ..**************** ***.*****

515. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP017574 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agctccagtagctccggtagttccagtagct	Protospacer
. ..**************** ***.*****

516. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agttccagtaggtccagtaggtccggtagat	Protospacer
. *.******* ***.*************

517. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtagcaccggtaggtccagtagca	Protospacer
. . ******** ***********.*****.

518. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagcaccggtaggtccagtagca	Protospacer
.  .******** ***********.*****.

519. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtagct	Protospacer
.  .*********** ********.*****

520. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctccagtaggtccagtagct	Protospacer
.  .***********.********.*****

521. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtagct	Protospacer
.  .*********** ********.*****

522. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctccagtaggtccagtagct	Protospacer
.  .***********.********.*****

523. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtagct	Protospacer
.  .*********** ********.*****

524. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctccagtaggtccagtagct	Protospacer
.  .***********.********.*****

525. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtagct	Protospacer
.  .*********** ********.*****

526. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctccagtaggtccagtagct	Protospacer
.  .***********.********.*****

527. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtagct	Protospacer
.  .*********** ********.*****

528. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
tgccccagtagctccggtagctccggttgat	Protospacer
  .***************** ****** *

529. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
gggtccagtgtctccggtaggtccggtatct	Protospacer
*  .*****. ***************** *

530. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 7, identity: 0.774

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
ggtaatagtagcgccggtagggccggtagcc	Protospacer
* *  .****** ******** ********

531. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
cggtccagtgtttccggtaggtccagtatct	Protospacer
 **********. **************. .

532. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgtctccggtgggtccagtatct	Protospacer
.*********** *****.********. .

533. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
gggtccagtgtctccggtaggtccggtatct	Protospacer
.*********** ***********.**. .

534. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agacccagtgtcgcccgtaggtccagtaggt	Protospacer
**..*********** ***********..

535. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccaggatct	Protospacer
*********.** ************* . .

536. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccaggatct	Protospacer
*********.** ************* . .

537. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccaggatct	Protospacer
*********.** ************* . .

538. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
aggtccagtatctccggtaggtccaggatct	Protospacer
*********.** ************* . .

539. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
cggtccagtgtttccggtaggtccagtatct	Protospacer
 **********. **************. .

540. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

541. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagtcgga	Protospacer
**  *****.** ************** . *

542. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

543. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

544. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

545. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

546. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

547. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagca	Protospacer
**  **.***** **************...*

548. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcaccagtgtctccggtaggaccagtcgga	Protospacer
**  ******** ******** ***** . *

549. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
**  *****.** ************** . *

550. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtcgga	Protospacer
**  **.***** ************** . *

551. spacer 3.32|1610715|31|NZ_CP045537|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

agagccagtgttgccggtaggtccggtgttg	CRISPR spacer
tggcccagtgttgccagtaggtccggtagcg	Protospacer
 *. ***********.***********. .*

552. spacer 3.32|1610715|31|NZ_CP045537|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

agagccagtgttgccggtaggtccggtgttg-	CRISPR spacer
gcagccagtgctgccggtacgtcc-gtgccgc	Protospacer
. ********.******** **** ***..*

553. spacer 3.36|1610949|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 7, identity: 0.774

gtcgccggtagctccagtgttcccagtaggt	CRISPR spacer
aactccggtagctccagtgattccagtggct	Protospacer
. * *************** *.*****.* *

554. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 7, identity: 0.774

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
gactccggtagctccagtgattcccgtcact	Protospacer
* * *****************.** ** . *

555. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 7, identity: 0.774

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
gactccggtagctccagtgattcccgtcact	Protospacer
* * *****************.** ** . *

556. spacer 2.12|1492775|36|NZ_CP045537|CRT matches to AP014498 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S34-C64, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 8, identity: 0.778

caccttgaggtccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgagttccttgagtaccagtagaaccttgag	Protospacer
.******** ********.******** .**   **

557. spacer 2.15|1492919|36|NZ_CP045537|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 8, identity: 0.778

taccttgaggcccttgaggtccagtagcgccttgaa	CRISPR spacer
ctcctgctggaccttgaggtccagtagcaccttgag	Protospacer
. ***   ** *****************.******.

558. spacer 2.16|1492973|36|NZ_CP045537|CRT matches to NZ_CP032531 (Bacillus megaterium NCT-2 plasmid pNCT2_3, complete sequence) position: , mismatch: 8, identity: 0.778

cgccttgaggtccttgaggtccagtggcaccttgag	CRISPR spacer
gaagtggtggtccttgaggtcccgtggctccttgag	Protospacer
 .  * * ************** ***** *******

559. spacer 3.2|1608735|40|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 8, identity: 0.8

aggtccagtagctcccgtaggtccagtaatcccagtagct	CRISPR spacer
aggtccagtatctcccgtgggtccagtatctcccgtgggt	Protospacer
********** *******.********* ..** **.* *

560. spacer 3.2|1608735|40|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 8, identity: 0.8

aggtccagtagctcccgtaggtccagtaatcccagtagct	CRISPR spacer
aggtccagtatctcccgtgggtccagtatctcccgtgggt	Protospacer
********** *******.********* ..** **.* *

561. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
cgatccagtgtttccggtaggtccagtaggt	Protospacer
 *.********. **************..

562. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
**  *****.** **************....

563. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagcg	Protospacer
**  **.***** **************....

564. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagcg	Protospacer
**  **.***** **************....

565. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagcg	Protospacer
**  **.***** **************....

566. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
**  *****.** **************....

567. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcaccagtatctccggtaggtccagtagcg	Protospacer
**  *****.** **************....

568. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagcg	Protospacer
**  **.***** **************....

569. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
**  *****.** **************....

570. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagcg	Protospacer
**  **.***** **************....

571. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagcg	Protospacer
**  **.***** **************....

572. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
**  *****.** **************....

573. spacer 3.11|1609320|31|NZ_CP045537|CRT matches to NZ_CP026221 (Aeromonas sp. ASNIH4 plasmid pAER-f909, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccggtgttgccagtaggtccagtgtcg	CRISPR spacer
tgggatggtgttgccggtcggtccagtgttc	Protospacer
 **  .*********.** **********.

574. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
cgatccggtaggcccagtaggtccagtcgat	Protospacer
 *.********  **************

575. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NZ_CP024036 (Bacillus aryabhattai strain K13 plasmid unnamed1) position: , mismatch: 8, identity: 0.742

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
aggtcccgtagctccagtaggtcctgcagaa	Protospacer
****** ***** *********** *..  .

576. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
agcgccggtatctccagtaggtccagtcgga	Protospacer
**  ****** * **************   .

577. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
gattccggtagctccagtagctccagtgatt	Protospacer
.. ********* ******* ******* .

578. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
gattccggtagctccagtagctccagtgatt	Protospacer
.. ********* ******* ******* .

579. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
gattccggtagctccagtagctccagtagct	Protospacer
.. ********* ******* ******. *

580. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
tgttccggtagctccagtaggtcctgtaatt	Protospacer
 * ********* *********** **. .

581. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
tgttccggtagctccagtaggtcctgtaatt	Protospacer
 * ********* *********** **. .

582. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NZ_CP023318 (Bacillus megaterium strain A plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
aggtcccgtagctccagtaggtcctgcagaa	Protospacer
****** ***** *********** *..  .

583. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
tgttccggtagctccagtaggtcctgtaatt	Protospacer
 * ********* *********** **. .

584. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
tgttccggtagctccagtaggtcctgtaatt	Protospacer
 * ********* *********** **. .

585. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
tgttccggtagctccagtaggtcctgtaatt	Protospacer
 * ********* *********** **. .

586. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtaact	Protospacer
.  .** ***************** ***.*

587. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
gggaccagtagctccggtcggaccggtcggt	Protospacer
*   ************** ** ***** *

588. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtaact	Protospacer
.  .** ***************** ***.*

589. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaggtccggtagatccggtagat	Protospacer
.  .******* ********.********

590. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagatccggtagatccggtagat	Protospacer
.  .******* ********.********

591. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccggtagatccggtaggtccggtaggc	Protospacer
.  .**.**** *****************

592. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtaact	Protospacer
.  .** ***************** ***.*

593. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggaccagtagctcccgtaggtcctgtaact	Protospacer
.   *********** ******** ***.*

594. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggaccagtagctcccgtaggtcctgtaact	Protospacer
.   *********** ******** ***.*

595. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
gggaccagtagctccggtcggaccggtcggt	Protospacer
*   ************** ** ***** *

596. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP017574 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agctccagtagctccagtagctccggtagtt	Protospacer
. ..***********.**** ********.

597. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtaggtccggtagatccggtaggt	Protospacer
.  .******* ********.********

598. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagatccagtaggtccggtagat	Protospacer
.  .******* ***.*************

599. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagatccggtaggtccagtaggt	Protospacer
.  .******* ************.****

600. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaggtccggtagatccggtagat	Protospacer
.  .******* ********.********

601. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagatccggtagatccggtaggt	Protospacer
.  .******* ********.********

602. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaggtccagtaggtccggtagat	Protospacer
.  .******* ***.*************

603. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagatccggtaggtccagtaggt	Protospacer
.  .******* ************.****

604. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagatccagtaggtccggtagat	Protospacer
.  .******* ***.*************

605. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

606. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

607. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

608. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctcctgtaggtccagtagat	Protospacer
.  .*********** ********.****

609. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

610. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

611. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

612. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

613. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtaggt	Protospacer
.  .***********.********.****

614. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

615. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

616. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

617. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

618. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

619. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

620. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

621. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

622. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

623. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctcctgtaggtccagtagat	Protospacer
.  .*********** ********.****

624. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

625. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

626. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

627. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

628. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtaggt	Protospacer
.  .***********.********.****

629. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

630. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

631. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

632. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

633. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

634. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

635. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agctccagtagctccagtaggtccagtagat	Protospacer
. ..***********.********.****

636. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtaggt	Protospacer
.  .***********.********.****

637. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

638. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

639. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP015352 (Bacillus thuringiensis strain MYBT18246 plasmid p142098, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agaaccagtagatccggtagatccggtagat	Protospacer
.   ******* ********.********

640. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP022605 (Ochrobactrum quorumnocens strain A44 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
tggtccggtaggtccggtaggtccggtaggt	Protospacer
   .**.**** *****************

641. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_LR134403 (Listeria monocytogenes strain NCTC7974 plasmid 6, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
cactccagtagatccggtagatccggtagat	Protospacer
  ..******* ********.********

642. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

643. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
.  .****** *************.***.*

644. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

645. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

646. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

647. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

648. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

649. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

650. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
.  .****** *************.***.*

651. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

652. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

653. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

654. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

655. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

656. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

657. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

658. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

659. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

660. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

661. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

662. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

663. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

664. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

665. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

666. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

667. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

668. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

669. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

670. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

671. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

672. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

673. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

674. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

675. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

676. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

677. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

678. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

679. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

680. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

681. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

682. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

683. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

684. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

685. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

686. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

687. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

688. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

689. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

690. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

691. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

692. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

693. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

694. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

695. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

696. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

697. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

698. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

699. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

700. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

701. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
.  .****** *************.***.*

702. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

703. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

704. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

705. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

706. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

707. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

708. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

709. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

710. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

711. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

712. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

713. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

714. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

715. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

716. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
.  .****** *************.***.*

717. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

718. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

719. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
gggtccagtgtctccggtaggtccggtattt	Protospacer
*  .*****. ***************** .

720. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
gggtccagtgtctccggtaggtccggtattt	Protospacer
*  .*****. ***************** .

721. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

722. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

723. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

724. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

725. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

726. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
.  .****** *************.***.*

727. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

728. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
ggctccagtagctccggcagctccggtggtt	Protospacer
* ..*************.** ******.*.

729. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
ggctccagtagctccggcagctccggtggtt	Protospacer
* ..*************.** ******.*.

730. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtaact	Protospacer
.  .** ***************** ***.*

731. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
gggaccagtagctccggtcggaccggtcggt	Protospacer
*   ************** ** ***** *

732. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtaact	Protospacer
.  .** ***************** ***.*

733. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaggtccggtagatccggtagat	Protospacer
.  .******* ********.********

734. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagatccggtagatccggtagat	Protospacer
.  .******* ********.********

735. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccggtagatccggtaggtccggtaggc	Protospacer
.  .**.**** *****************

736. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcctgtagctccggtaggtcctgtaact	Protospacer
.  .** ***************** ***.*

737. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggaccagtagctcccgtaggtcctgtaact	Protospacer
.   *********** ******** ***.*

738. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggaccagtagctcccgtaggtcctgtaact	Protospacer
.   *********** ******** ***.*

739. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
gggaccagtagctccggtcggaccggtcggt	Protospacer
*   ************** ** ***** *

740. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP017574 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agctccagtagctccagtagctccggtagtt	Protospacer
. ..***********.**** ********.

741. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtaggtccggtagatccggtaggt	Protospacer
.  .******* ********.********

742. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagatccagtaggtccggtagat	Protospacer
.  .******* ***.*************

743. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagatccggtaggtccagtaggt	Protospacer
.  .******* ************.****

744. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaggtccggtagatccggtagat	Protospacer
.  .******* ********.********

745. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagatccggtagatccggtaggt	Protospacer
.  .******* ********.********

746. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaggtccagtaggtccggtagat	Protospacer
.  .******* ***.*************

747. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagatccggtaggtccagtaggt	Protospacer
.  .******* ************.****

748. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagatccagtaggtccggtagat	Protospacer
.  .******* ***.*************

749. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

750. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

751. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

752. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctcctgtaggtccagtagat	Protospacer
.  .*********** ********.****

753. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

754. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

755. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

756. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

757. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtaggt	Protospacer
.  .***********.********.****

758. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

759. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

760. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

761. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

762. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

763. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

764. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

765. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

766. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

767. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctcctgtaggtccagtagat	Protospacer
.  .*********** ********.****

768. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

769. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

770. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

771. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

772. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtaggt	Protospacer
.  .***********.********.****

773. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

774. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

775. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

776. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

777. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

778. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtagat	Protospacer
.  .***********.********.****

779. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agctccagtagctccagtaggtccagtagat	Protospacer
. ..***********.********.****

780. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctccagtaggtccagtaggt	Protospacer
.  .***********.********.****

781. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

782. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtagctcctgtaggtccagtaggt	Protospacer
.  .*********** ********.****

783. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP015352 (Bacillus thuringiensis strain MYBT18246 plasmid p142098, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agaaccagtagatccggtagatccggtagat	Protospacer
.   ******* ********.********

784. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP022605 (Ochrobactrum quorumnocens strain A44 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
tggtccggtaggtccggtaggtccggtaggt	Protospacer
   .**.**** *****************

785. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_LR134403 (Listeria monocytogenes strain NCTC7974 plasmid 6, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
cactccagtagatccggtagatccggtagat	Protospacer
  ..******* ********.********

786. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

787. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
.  .****** *************.***.*

788. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

789. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

790. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

791. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

792. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

793. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

794. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
.  .****** *************.***.*

795. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

796. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

797. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

798. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

799. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

800. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

801. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

802. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

803. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

804. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

805. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

806. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

807. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

808. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

809. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

810. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

811. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

812. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

813. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

814. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

815. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

816. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

817. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

818. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

819. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

820. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

821. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

822. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

823. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

824. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

825. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

826. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

827. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

828. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

829. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

830. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

831. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

832. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

833. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

834. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

835. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

836. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

837. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

838. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

839. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

840. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

841. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

842. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

843. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

844. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

845. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
.  .****** *************.***.*

846. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

847. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

848. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

849. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

850. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

851. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

852. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

853. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

854. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

855. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

856. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

857. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

858. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

859. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

860. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
.  .****** *************.***.*

861. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

862. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

863. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
gggtccagtgtctccggtaggtccggtattt	Protospacer
*  .*****. ***************** .

864. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
gggtccagtgtctccggtaggtccggtattt	Protospacer
*  .*****. ***************** .

865. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtaactccggtaggtccagtatcc	Protospacer
.  .******.*************.*** *

866. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

867. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

868. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

869. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtatct	Protospacer
.  .****** *************.*** *

870. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtatctccggtaggtccagtaact	Protospacer
.  .****** *************.***.*

871. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagttgctccggtaggtccagtatct	Protospacer
.  .***** **************.*** *

872. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
ggctccagtagctccggcagctccggtggtt	Protospacer
* ..*************.** ******.*.

873. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 8, identity: 0.742

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
ggctccagtagctccggcagctccggtggtt	Protospacer
* ..*************.** ******.*.

874. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
cgatccagtgtttccggtaggtccagtaggt	Protospacer
 *.********. **************..

875. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
**  *****.** **************....

876. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagcg	Protospacer
**  **.***** **************....

877. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagcg	Protospacer
**  **.***** **************....

878. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagcg	Protospacer
**  **.***** **************....

879. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
**  *****.** **************....

880. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcaccagtatctccggtaggtccagtagcg	Protospacer
**  *****.** **************....

881. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagcg	Protospacer
**  **.***** **************....

882. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
**  *****.** **************....

883. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagcg	Protospacer
**  **.***** **************....

884. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccggtgtctccggtaggtccagtagcg	Protospacer
**  **.***** **************....

885. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
agcgccagtatctccggtaggtccagtagcg	Protospacer
**  *****.** **************....

886. spacer 3.32|1610715|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

agagccagtgttgccggtaggtccggtgttg	CRISPR spacer
aggtccagtgtttccggtagatccggtaggc	Protospacer
**. ******** *******.******.

887. spacer 3.32|1610715|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

agagccagtgttgccggtaggtccggtgttg	CRISPR spacer
aggtccagtgtttccggtagatccggtagat	Protospacer
**. ******** *******.******.

888. spacer 3.32|1610715|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

agagccagtgttgccggtaggtccggtgttg	CRISPR spacer
aggtccagtgtttccggtagatccggtaggt	Protospacer
**. ******** *******.******.

889. spacer 3.32|1610715|31|NZ_CP045537|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 8, identity: 0.742

agagccagtgttgccggtaggtccggtgttg	CRISPR spacer
cggtccagtgtttccggtaggtccagtatct	Protospacer
 *. ******** ***********.**.*.

890. spacer 3.32|1610715|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 8, identity: 0.742

agagccagtgttgccggtaggtccggtgttg	CRISPR spacer
cggtccagtgtttccggtaggtccagtatct	Protospacer
 *. ******** ***********.**.*.

891. spacer 3.32|1610715|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 8, identity: 0.742

agagccagtgttgccggtaggtccggtgttg	CRISPR spacer
gggtccagtgtctccggtaggtccggtatct	Protospacer
.*. *******. **************.*.

892. spacer 3.32|1610715|31|NZ_CP045537|CRT matches to NZ_CP026221 (Aeromonas sp. ASNIH4 plasmid pAER-f909, complete sequence) position: , mismatch: 8, identity: 0.742

agagccagtgttgccggtaggtccggtgttg	CRISPR spacer
tgggatggtgttgccggtcggtccagtgttc	Protospacer
 *.* ..*********** *****.*****

893. spacer 3.32|1610715|31|NZ_CP045537|CRT matches to NC_019519 (Agrobacterium phage 7-7-1, complete genome) position: , mismatch: 8, identity: 0.742

agagccagtgttgccggtaggtccggtgttg	CRISPR spacer
tcttccagtgttgccggttgttccggtcctg	Protospacer
    ************** * ****** .**

894. spacer 3.35|1610895|31|NZ_CP045537|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 8, identity: 0.742

agagccagtgtcgcccgtaggtccggtgttc	CRISPR spacer
gggtccagtgtctccggtaggtccggtatct	Protospacer
.*. ******** ** ***********.*..

895. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 8, identity: 0.742

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
gattccagtagctccagtgattccagtgact	Protospacer
* . **.**************.*****.. *

896. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 8, identity: 0.742

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
gattccagtagctccagtgattccagtgact	Protospacer
* . **.**************.*****.. *

897. spacer 3.40|1611192|31|NZ_CP045537|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 8, identity: 0.742

gtcgccggtagctccagtgatcccagtaggt	CRISPR spacer
aactccggtagctccagtgactccagtgact	Protospacer
. * ****************..*****.. *

898. spacer 3.2|1608735|40|NZ_CP045537|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 9, identity: 0.775

aggtccagtagctcccgtaggtccagtaatcccagtagct	CRISPR spacer
aggtccagtagatccagtaggtccagtaggtaaagtaagt	Protospacer
*********** *** ************. .  ****. *

899. spacer 3.3|1608798|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
ggcgccggtgtctccggtaggtccagtagcg	Protospacer
.*  **.***** **************....

900. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
gtttccggtaggtccagtaggtccagtcgat	Protospacer
.  ********  **************

901. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 9, identity: 0.71

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
tgatcctgtagctccagtaggtccagcagga	Protospacer
 *.*** ***** *************..  .

902. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 9, identity: 0.71

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
tgatcctgtagctccagtaggtccagcagga	Protospacer
 *.*** ***** *************..  .

903. spacer 3.12|1609374|31|NZ_CP045537|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 9, identity: 0.71

aggtccggtagcgccagtaggtccagtgtcg	CRISPR spacer
tgatcctgtagctccagtaggtccagcagga	Protospacer
 *.*** ***** *************..  .

904. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggaccagtagctccggtcggaccggtcggt	Protospacer
.   ************** ** ***** *

905. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtcgatccggtaggtccggtcgat	Protospacer
.  .***** * *************** *

906. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagatccggtaggtccagtcgga	Protospacer
.  .******* ************.** * .

907. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcgagtaggtccagtaggtccggtagat	Protospacer
.  .* ***** ***.*************

908. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagatccggtaggtccagtgtct	Protospacer
.  .******* ************.**. *

909. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

910. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagtcgga	Protospacer
. . ****** *************.** * .

911. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

912. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

913. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

914. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

915. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

916. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

917. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to NZ_CP015352 (Bacillus thuringiensis strain MYBT18246 plasmid p142098, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggaccagtaactccggtaggtccagttggt	Protospacer
.   ******.*************.** *

918. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggaccagtagctccggtcggaccggtcggt	Protospacer
.   ************** ** ***** *

919. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtcgatccggtaggtccggtcgat	Protospacer
.  .***** * *************** *

920. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagatccggtaggtccagtcgga	Protospacer
.  .******* ************.** * .

921. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtcgagtaggtccagtaggtccggtagat	Protospacer
.  .* ***** ***.*************

922. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagatccggtaggtccagtgtct	Protospacer
.  .******* ************.**. *

923. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

924. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagtcgga	Protospacer
. . ****** *************.** * .

925. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

926. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

927. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

928. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

929. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

930. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agcgccagtatctccggtaggtccagttgga	Protospacer
. . ****** *************.** * .

931. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to NZ_CP015352 (Bacillus thuringiensis strain MYBT18246 plasmid p142098, complete sequence) position: , mismatch: 9, identity: 0.71

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggaccagtaactccggtaggtccagttggt	Protospacer
.   ******.*************.** *

932. spacer 3.21|1609896|31|NZ_CP045537|CRT matches to NZ_CP020455 (Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence) position: , mismatch: 9, identity: 0.71

aggtccagtgtcgccggtagagccagtgttc	CRISPR spacer
gatggcagtgttgccggtagagccactgatg	Protospacer
..   ******.************* ** *

933. spacer 3.22|1609950|31|NZ_CP045537|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

aggtccagtgtcgccggtaggtccagtgata	CRISPR spacer
ggcgccggtgtctccggtaggtccagtagcg	Protospacer
.*  **.***** **************....

934. spacer 3.35|1610895|31|NZ_CP045537|CRT matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 9, identity: 0.71

agagccagtgtcgcccgtaggtccggtgttc	CRISPR spacer
atcgccagtgtcgccagcaggtccggcacct	Protospacer
*  ************ *.********.....

935. spacer 3.35|1610895|31|NZ_CP045537|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

agagccagtgtcgcccgtaggtccggtgttc	CRISPR spacer
tggcccagtgttgccagtaggtccggtagcg	Protospacer
 *. *******.*** ***********. .

936. spacer 3.13|1609428|40|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 10, identity: 0.75

aggtccggtgataccagtaggtccagtaggtccagtgtcg	CRISPR spacer
aggtccagtgatgccagtaggtccagtattgccggtaggt	Protospacer
******.*****.***************   **.**.

937. spacer 3.13|1609428|40|NZ_CP045537|CRT matches to KY963370 (Bacillus phage Negev_SA, complete genome) position: , mismatch: 10, identity: 0.75

aggtccggtgataccagtaggtccagtaggtccagtgtcg	CRISPR spacer
aggtccagtgatgccagtaggtccagtattgccggtaggc	Protospacer
******.*****.***************   **.**.

938. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 10, identity: 0.677

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtaggtccggtaggtccagtgttt	Protospacer
.  .******* ************.**. .

939. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 10, identity: 0.677

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctccagtaggtcctgttaaa	Protospacer
.  .***********.******** ** . .

940. spacer 3.15|1609554|31|NZ_CP045537|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 10, identity: 0.677

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctccagtaggtcctgttaaa	Protospacer
.  .***********.******** ** . .

941. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 10, identity: 0.677

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
agatccagtaggtccggtaggtccagtgttt	Protospacer
.  .******* ************.**. .

942. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 10, identity: 0.677

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctccagtaggtcctgttaaa	Protospacer
.  .***********.******** ** . .

943. spacer 3.17|1609671|31|NZ_CP045537|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 10, identity: 0.677

gttcccagtagctccggtaggtccggtagcg	CRISPR spacer
aggtccagtagctccagtaggtcctgttaaa	Protospacer
.  .***********.******** ** . .

944. spacer 3.28|1610427|40|NZ_CP045537|CRT matches to MN586053 (Arthrobacter phage BeatusComedenti, complete genome) position: , mismatch: 10, identity: 0.75

atcgccagtaggtccagtgtcgccggtagctccggtgttg	CRISPR spacer
cggaccctgaggtccagtggcgccggtcgctccggtgtcg	Protospacer
   .**   ********** ******* **********.*

945. spacer 3.28|1610427|40|NZ_CP045537|CRT matches to NC_031231 (Arthrobacter phage KellEzio, complete genome) position: , mismatch: 10, identity: 0.75

atcgccagtaggtccagtgtcgccggtagctccggtgttg	CRISPR spacer
cggaccctgaggtccagtggcgccggtcgctccggtgtcg	Protospacer
   .**   ********** ******* **********.*

946. spacer 3.42|1611291|40|NZ_CP045537|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 10, identity: 0.75

gtttccggaaggtccagtagtcccagtagatccagtaggt	CRISPR spacer
aggtccagtcaatccagtaggtccagtagatccagtaggt	Protospacer
.  ***.*  ..******** .******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

267999 : 275948

uncultured_virus(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917306.1\|267999_268284_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8
WP_001029999.1\|268322_269957_+	chaperonin GroEL	A0A219YK78	uncultured_virus	2.0e-157	58.2
WP_000743925.1\|270364_271903_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	6.8e-22	31.2
WP_000833093.1\|272287_273613_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.4e-44	29.5
WP_001262951.1\|273757_274459_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.3e-40	36.9
WP_000719191.1\|274442_275948_+	aminopeptidase AmpS	W8CYF6	Bacillus_phage	2.4e-32	31.3

DBSCAN-SWA_2

321244 : 329617

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625677.1\|321244_322552_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.5
WP_001170542.1\|322640_323360_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000278826.1\|323352_323607_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666779.1\|323603_324287_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055586.1\|324270_326490_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.3e-162	41.2
WP_000879038.1\|326474_327890_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.3e-55	35.4
WP_001262449.1\|327992_329033_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.6e-67	45.9
WP_000088580.1\|329029_329617_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.5e-27	37.1

DBSCAN-SWA_3

1912784 : 1922114

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755553.1\|1912784_1914065_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	4.5e-11	31.5
WP_001194312.1\|1914162_1914927_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000453859.1\|1915166_1916927_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.2e-270	96.7
WP_000937026.1\|1917015_1917693_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.6e-119	94.7
WP_001254317.1\|1917689_1918763_+	sensor histidine kinase	W8CYF6	Bacillus_phage	1.3e-176	90.5
WP_000818985.1\|1919570_1920290_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000061722.1\|1920437_1921109_+	O-methyltransferase	W8CYT3	Bacillus_phage	7.7e-63	89.8
WP_001258509.1\|1921241_1922114_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	6.5e-62	42.5

DBSCAN-SWA_4

2594555 : 2602898

Geobacillus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046952019.1\|2594555_2595923_-	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	2.8e-19	38.6
WP_000124904.1\|2596280_2597474_-	glycosyl transferase family 1	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	4.8e-07	26.8
WP_001058134.1\|2597559_2598240_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BUR2	Microcystis_phage	1.7e-30	38.2
WP_000720544.1\|2598386_2598890_-	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	4.3e-42	45.5
WP_001093431.1\|2598911_2599298_-	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_000655489.1\|2599363_2600071_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	2.0e-16	26.5
WP_000648514.1\|2600092_2600446_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_000288952.1\|2600459_2600867_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000714650.1\|2601297_2602683_+	MBL fold metallo-hydrolase	Q0H255	Geobacillus_phage	2.7e-78	59.9
WP_000820162.1\|2602685_2602898_+	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	1.1e-12	54.4

DBSCAN-SWA_5

3209231 : 3215155

uncultured_Caudovirales_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000164881.1\|3209231_3210698_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	1.6e-44	32.3
WP_001102718.1\|3210952_3212047_+	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.9e-127	65.8
WP_000619635.1\|3212043_3212232_+	Phr family secreted Rap phosphatase inhibitor	A0A2H4JBB8	uncultured_Caudovirales_phage	3.9e-09	63.0
WP_001074673.1\|3212339_3212660_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_154981971.1\|3212794_3213178_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	1.5e-07	41.6
WP_154981844.1\|3213059_3213536_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	5.2e-13	36.4
WP_000275791.1\|3213887_3214493_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
WP_000813624.1\|3214627_3215155_-	GrpB family protein	A0A2K5B2B6	Erysipelothrix_phage	2.6e-18	33.9

DBSCAN-SWA_6

3390025 : 3483114

106

Bacillus_phage(85.71%)

terminase,head,protease,tail,portal,integrase,tRNA,holin,capsid

attL 3422905:3422919|attR 3481832:3481846

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000872364.1\|3390025_3390391_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_000578957.1\|3390387_3391065_+	LrgB family protein	NA	NA	NA	NA
WP_000442971.1\|3391077_3391491_-	NUDIX hydrolase	NA	NA	NA	NA
WP_000576450.1\|3391631_3391832_+	DUF3903 domain-containing protein	NA	NA	NA	NA
WP_000974648.1\|3392147_3392903_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_000644411.1\|3393001_3393148_-	BC1881 family protein	NA	NA	NA	NA
WP_002080739.1\|3393313_3395041_-	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	1.8e-39	55.0
WP_000280330.1\|3395256_3395760_-	hypothetical protein	NA	NA	NA	NA
WP_000386799.1\|3395829_3396849_-	NERD domain-containing protein	A0A1L2JY40	Aeribacillus_phage	2.5e-25	26.9
WP_000818394.1\|3396967_3398731_-	ABC transporter ATP-binding protein	A0A1V0SD74	Indivirus	1.4e-15	23.6
WP_000862469.1\|3398730_3400482_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	3.7e-48	28.7
WP_154981983.1\|3400853_3401438_-	hypothetical protein	NA	NA	NA	NA
WP_017561990.1\|3401494_3402052_-	hypothetical protein	NA	NA	NA	NA
WP_154981985.1\|3402825_3404208_-	hypothetical protein	NA	NA	NA	NA
WP_017561988.1\|3404224_3405001_-	hypothetical protein	NA	NA	NA	NA
WP_154981987.1\|3405508_3406897_-\|portal	phage portal protein	NA	NA	NA	NA
WP_017561986.1\|3406941_3407400_-	hypothetical protein	NA	NA	NA	NA
WP_154981989.1\|3407451_3409029_-	DNA packaging protein	A0A2I7RNR6	Vibrio_phage	1.1e-30	27.6
WP_017561984.1\|3409030_3409417_-	hypothetical protein	NA	NA	NA	NA
WP_017561983.1\|3409434_3410487_-	hypothetical protein	NA	NA	NA	NA
WP_017561982.1\|3410524_3410728_-	hypothetical protein	NA	NA	NA	NA
WP_154982114.1\|3410764_3411523_-	hypothetical protein	NA	NA	NA	NA
WP_001021805.1\|3411905_3412079_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_074568243.1\|3412170_3413052_-	hypothetical protein	A0A2H4J2M3	uncultured_Caudovirales_phage	6.8e-19	30.4
WP_154981991.1\|3413073_3413529_-	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_154981993.1\|3413901_3414891_-	hypothetical protein	NA	NA	NA	NA
WP_017561980.1\|3415757_3416672_-\|integrase	tyrosine-type recombinase/integrase	A0A2D2W391	Mycobacterium_phage	3.1e-06	23.7
WP_001123317.1\|3416863_3417085_-	YneF family protein	NA	NA	NA	NA
WP_000860645.1\|3417163_3417604_-	sporulation inhibitor of replication protein SirA	NA	NA	NA	NA
WP_000019770.1\|3417759_3419760_-	transketolase	NA	NA	NA	NA
WP_154981995.1\|3420241_3421045_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_001000756.1\|3421044_3421839_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_000569254.1\|3421835_3422609_-	phosphonate ABC transporter ATP-binding protein	W5SAS9	Pithovirus	2.7e-11	27.5
WP_000915059.1\|3422692_3423631_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
3422905:3422919	attL	NA	NA	NA	NA
WP_001075242.1\|3423816_3425400_+	2',3'-cyclic-nucleotide 2'-phosphodiesterase	NA	NA	NA	NA
WP_000948565.1\|3425428_3425668_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_000991471.1\|3425713_3426370_-	recombinase family protein	NA	NA	NA	NA
WP_000413738.1\|3426511_3427132_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	8.2e-19	62.2
WP_000976112.1\|3427218_3428025_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_000032399.1\|3428025_3428568_-	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_001102620.1\|3428560_3428884_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_000473087.1\|3429582_3430176_+	hypothetical protein	A0A0U3TZ58	Bacillus_phage	5.9e-99	100.0
WP_001287580.1\|3430228_3430444_-	hypothetical protein	A0A0U3TKC9	Bacillus_phage	4.1e-34	100.0
WP_012580673.1\|3430464_3431100_-	hypothetical protein	A0A0U3J2H0	Bacillus_phage	4.2e-119	99.5
WP_002027563.1\|3431104_3432262_-	DNA translocase FtsK	A0A1B1P7T5	Bacillus_phage	6.3e-222	100.0
WP_000488699.1\|3432271_3432598_-	hypothetical protein	A0A1B1P7T1	Bacillus_phage	2.7e-53	100.0
WP_000427397.1\|3432610_3433003_-	hypothetical protein	A0A1B1P7T3	Bacillus_phage	6.9e-72	100.0
WP_000340446.1\|3433307_3433514_+	helix-turn-helix domain-containing protein	A0A1B1P7S8	Bacillus_phage	8.4e-29	100.0
WP_000542512.1\|3433569_3434379_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	5.4e-164	100.0
WP_000159644.1\|3434378_3434585_-	hypothetical protein	D2XR32	Bacillus_phage	1.6e-32	98.5
WP_000151211.1\|3434587_3434869_-	hypothetical protein	D2XR31	Bacillus_phage	1.2e-41	100.0
WP_000822837.1\|3434883_3435843_-\|integrase	tyrosine-type recombinase/integrase	D2XR30	Bacillus_phage	5.5e-171	93.1
WP_000434602.1\|3436050_3436746_-	hypothetical protein	D2XR29	Bacillus_phage	1.8e-123	99.6
WP_001260174.1\|3436871_3440897_-	hypothetical protein	H0USX5	Bacillus_phage	0.0e+00	85.5
WP_000094085.1\|3440893_3442366_-\|tail	phage tail protein	H0USX4	Bacillus_phage	2.2e-232	78.7
WP_000896623.1\|3442402_3447418_-\|tail	phage tail tape measure protein	A0A1B1P7S6	Bacillus_phage	0.0e+00	99.4
WP_000938712.1\|3447433_3447574_-	hypothetical protein	A0A1B1P7R9	Bacillus_phage	1.5e-18	100.0
WP_001157384.1\|3447591_3447987_-	hypothetical protein	A0A1B1P7S9	Bacillus_phage	3.9e-59	100.0
WP_000952020.1\|3448046_3448631_-\|tail	tail protein	A0A1B1P7S4	Bacillus_phage	5.2e-108	100.0
WP_001211423.1\|3448644_3449004_-	hypothetical protein	A0A1B1P7S7	Bacillus_phage	2.8e-64	99.2
WP_000852722.1\|3449000_3449438_-	HK97 gp10 family phage protein	A0A1B1P7R6	Bacillus_phage	1.2e-77	100.0
WP_001069940.1\|3449425_3449773_-\|head	phage head closure protein	A0A1B1P7T4	Bacillus_phage	8.2e-61	99.1
WP_000891191.1\|3449759_3450035_-\|head,tail	phage gp6-like head-tail connector protein	A0A1B1P7Q8	Bacillus_phage	8.0e-43	98.9
WP_033679183.1\|3450043_3450262_-	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_000782636.1\|3450320_3451508_-\|capsid	phage major capsid protein	A0A1B1P7R4	Bacillus_phage	1.8e-216	100.0
WP_001107318.1\|3451504_3452260_-\|protease	Clp protease ClpP	A0A0U3U021	Bacillus_phage	9.6e-139	99.6
WP_000767176.1\|3452237_3453452_-\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	4.7e-236	100.0
WP_000633618.1\|3453467_3455240_-\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	0.0e+00	99.5
WP_000357495.1\|3455220_3455601_-\|terminase	phage terminase small subunit P27 family	A0A1B1P7R2	Bacillus_phage	2.2e-67	100.0
WP_001992786.1\|3455761_3455977_-	endonuclease	A0A1B1P8D2	Bacillus_phage	3.1e-34	98.6
WP_000761540.1\|3456422_3456635_-	hypothetical protein	A0A1B1P8F3	Bacillus_phage	1.1e-28	95.7
WP_000002729.1\|3456658_3456913_-	hypothetical protein	W8CZ42	Bacillus_phage	1.6e-05	64.6
WP_000443968.1\|3456905_3457280_-	hypothetical protein	A0A0A7AQ61	Bacillus_phage	1.2e-38	85.4
WP_001055139.1\|3457880_3458423_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7Y2	Bacillus_phage	5.5e-96	100.0
WP_001209121.1\|3458419_3458893_-	ArpU family transcriptional regulator	A0A1B1P7X5	Bacillus_phage	4.0e-82	100.0
WP_001061241.1\|3459191_3459323_-	DUF3983 domain-containing protein	A0A1B1P7V8	Bacillus_phage	4.8e-14	97.7
WP_000389465.1\|3460000_3460276_-	hypothetical protein	A0A1B1P870	Bacillus_phage	1.2e-46	100.0
WP_000678893.1\|3460373_3460637_-	hypothetical protein	A0A1B1P871	Bacillus_phage	1.8e-39	100.0
WP_000439567.1\|3460670_3460868_-	hypothetical protein	NA	NA	NA	NA
WP_000661412.1\|3460902_3461130_-	hypothetical protein	A0A218KCK2	Bacillus_phage	5.3e-24	65.3
WP_001216585.1\|3461167_3461389_-	hypothetical protein	D2XR53	Bacillus_phage	2.0e-36	100.0
WP_001002761.1\|3461705_3462380_-	hypothetical protein	D2XR52	Bacillus_phage	2.3e-131	100.0
WP_154981997.1\|3462577_3462820_-	hypothetical protein	I1TLG8	Bacillus_phage	4.1e-35	100.0
WP_016718366.1\|3463004_3463487_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	2.3e-21	50.0
WP_016718367.1\|3463502_3463922_-	hypothetical protein	A0A1B1P8B9	Bacillus_phage	3.1e-14	41.9
WP_016718368.1\|3463934_3464189_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	1.1e-38	92.9
WP_000805174.1\|3464203_3464377_-	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	100.0
WP_154981999.1\|3464402_3464597_-	hypothetical protein	A0A1B1P7U7	Bacillus_phage	9.7e-27	89.1
WP_154982001.1\|3464609_3465524_-	AAA family ATPase	A0A0U3U1U1	Bacillus_phage	3.4e-170	99.7
WP_087966866.1\|3465538_3466432_-	chromosomal replication initiator DnaA	A0A0U3TZZ4	Bacillus_phage	3.3e-93	66.3
WP_048540317.1\|3466819_3467080_-	group-specific protein	A0A1B1P7U4	Bacillus_phage	1.3e-34	80.2
WP_154982003.1\|3467111_3467843_-	Rha family transcriptional regulator	A0A1B1P7T7	Bacillus_phage	5.0e-124	91.8
WP_154982005.1\|3467861_3468083_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_154982006.1\|3468256_3468598_+	helix-turn-helix domain-containing protein	A0A1B0T6A7	Bacillus_phage	7.2e-17	42.1
WP_154982008.1\|3469080_3470310_-	hypothetical protein	D2XQ10	Bacillus_virus	2.5e-83	46.2
WP_154982010.1\|3470807_3471161_+	helix-turn-helix domain-containing protein	A0A1B1P888	Bacillus_phage	4.7e-19	43.6
WP_154982012.1\|3471589_3472735_+\|integrase	tyrosine-type recombinase/integrase	A0A0M5M609	Bacillus_phage	2.0e-66	38.0
WP_000135330.1\|3472857_3474192_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_000656783.1\|3474240_3474630_-	transcriptional repressor GlnR	NA	NA	NA	NA
WP_000460306.1\|3474805_3476077_-	methionine gamma-lyase family protein	NA	NA	NA	NA
WP_154982116.1\|3476069_3477344_-	GTPase HflX	NA	NA	NA	NA
WP_000312265.1\|3477436_3478060_+	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_000438181.1\|3478328_3479285_-	stage V sporulation protein K	G3MAX6	Bacillus_virus	6.0e-53	44.0
WP_000450313.1\|3479398_3480364_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_000813896.1\|3481914_3482139_-	RNA chaperone Hfq	NA	NA	NA	NA
3481832:3481846	attR	NA	NA	NA	NA
WP_000504942.1\|3482160_3483114_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA

DBSCAN-SWA_7

3673464 : 3749453

Bacillus_phage(70.37%)

terminase,head,protease,tail,tRNA,integrase,portal,holin,capsid,transposase

attL 3707089:3707103|attR 3749493:3749507

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000455936.1\|3673464_3676230_-\|tRNA	isoleucine--tRNA ligase	A0A2K9L9X8	Tupanvirus	7.0e-86	27.1
WP_001131612.1\|3676577_3677084_-	septum site-determining protein DivIVA	NA	NA	NA	NA
WP_000029725.1\|3677173_3677941_-	RNA-binding protein	NA	NA	NA	NA
WP_000450919.1\|3677956_3678220_-	YggT family protein	NA	NA	NA	NA
WP_000119138.1\|3678226_3678697_-	cell division protein SepF	NA	NA	NA	NA
WP_000218169.1\|3678716_3679391_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_001209000.1\|3679387_3680206_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_001993471.1\|3680324_3680609_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_000197753.1\|3680776_3681556_-	RNA polymerase sporulation sigma factor SigG	A0A0Y0AU18	Bacillus_phage	5.8e-46	43.5
WP_000976948.1\|3681713_3682433_-	RNA polymerase sporulation sigma factor SigE	A0A2H4JC68	uncultured_Caudovirales_phage	3.3e-19	42.9
WP_000261978.1\|3682452_3683370_-	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
WP_000888991.1\|3685268_3686423_-	cell division protein FtsZ	NA	NA	NA	NA
WP_001087555.1\|3686462_3687770_-	cell division protein FtsA	NA	NA	NA	NA
WP_000798230.1\|3688170_3688941_-	cell division protein DivIB	NA	NA	NA	NA
WP_000437043.1\|3689039_3689945_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_001265415.1\|3690006_3691101_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_000753510.1\|3691205_3692297_-	stage V sporulation protein E	NA	NA	NA	NA
WP_000860123.1\|3692387_3693740_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_000893058.1\|3693740_3694715_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_000766298.1\|3694737_3696213_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_001266227.1\|3696421_3698338_-	stage V sporulation protein D	NA	NA	NA	NA
WP_000600097.1\|3698419_3700519_-	penicillin-binding protein	NA	NA	NA	NA
WP_000067081.1\|3700591_3700954_-	cell division protein FtsL	NA	NA	NA	NA
WP_000481790.1\|3700969_3701902_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_000403053.1\|3702270_3703887_-	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
WP_000782393.1\|3703966_3704857_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_000506707.1\|3705150_3705624_+	N-acetyltransferase	NA	NA	NA	NA
WP_000246478.1\|3705658_3706165_-	RsfA family transcriptional regulator	G3MB11	Bacillus_virus	1.0e-11	35.5
WP_001984764.1\|3706294_3706468_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_000872145.1\|3706529_3707030_-	DUF177 domain-containing protein	NA	NA	NA	NA
3707089:3707103	attL	NA	NA	NA	NA
WP_000105686.1\|3707303_3707921_-	hypothetical protein	A0A288WFQ7	Bacillus_phage	4.7e-83	79.5
WP_048557647.1\|3707862_3709047_-	cell division protein FtsK	H0USY1	Bacillus_phage	1.4e-144	63.1
WP_048557646.1\|3709165_3709348_-	hypothetical protein	A0A288WGN6	Bacillus_phage	1.4e-19	80.0
WP_001267642.1\|3709344_3709647_-	hypothetical protein	H0USY0	Bacillus_phage	3.1e-24	54.6
WP_001237237.1\|3709831_3710053_+	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	1.0e-27	89.0
WP_048557645.1\|3710045_3710537_+	hypothetical protein	Q3HL01	Bacillus_phage	1.1e-71	89.0
WP_048557644.1\|3710574_3711360_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7T9	Bacillus_phage	6.1e-35	83.1
WP_000787573.1\|3711376_3711607_-\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	1.4e-32	94.7
WP_001115042.1\|3711649_3711889_-	peptidase	A0A1B1P7E0	Bacillus_phage	7.4e-37	100.0
WP_048557643.1\|3711904_3712864_-\|integrase	tyrosine-type recombinase/integrase	D2XR30	Bacillus_phage	7.1e-171	92.2
WP_000626436.1\|3713100_3714294_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-218	100.0
WP_154982024.1\|3714579_3718419_-	peptidase S74	Q2I8E8	Bacillus_phage	0.0e+00	88.5
WP_080349453.1\|3718415_3719906_-\|tail	phage tail protein	A0A2H4JC38	uncultured_Caudovirales_phage	9.7e-276	92.3
WP_048557641.1\|3719920_3722539_-\|tail	phage tail tape measure protein	Q2I8F0	Bacillus_phage	9.0e-285	98.2
WP_048557640.1\|3722714_3724031_-\|tail	phage tail tape measure protein	A0A288WG36	Bacillus_phage	9.8e-163	96.3
WP_016718340.1\|3724252_3724570_-	hypothetical protein	A0A288WFU2	Bacillus_phage	7.5e-53	98.1
WP_048557639.1\|3724618_3725224_-\|tail	tail protein	W8CYT6	Bacillus_phage	1.2e-94	95.0
WP_048557638.1\|3725224_3725584_-	DUF3168 domain-containing protein	A0A2H4JAR3	uncultured_Caudovirales_phage	9.4e-60	96.6
WP_016718343.1\|3725580_3726015_-	HK97 gp10 family phage protein	H0USW9	Bacillus_phage	6.9e-73	93.1
WP_048557637.1\|3726007_3726331_-\|head	phage head closure protein	A0A2H4J374	uncultured_Caudovirales_phage	1.4e-54	96.3
WP_016718345.1\|3726327_3726606_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4J6E5	uncultured_Caudovirales_phage	3.3e-44	100.0
WP_048557636.1\|3726626_3727799_-\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	5.1e-203	94.9
WP_048557635.1\|3727836_3728547_-\|protease	Clp protease ClpP	A0A2H4JC29	uncultured_Caudovirales_phage	1.0e-126	98.7
WP_154982026.1\|3728533_3729787_-\|portal	phage portal protein	A0A2H4J371	uncultured_Caudovirales_phage	2.7e-239	98.3
WP_048557633.1\|3729975_3731670_-\|terminase	terminase large subunit	A6M948	Geobacillus_virus	6.2e-210	64.6
WP_048557632.1\|3731666_3732167_-\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	1.0e-64	74.1
WP_048557631.1\|3732305_3732683_-	HNH endonuclease	A0A2H4J3B4	uncultured_Caudovirales_phage	7.6e-68	97.6
WP_048557630.1\|3732672_3732927_-	hypothetical protein	A0A0S2GLL6	Bacillus_phage	1.7e-39	90.5
WP_048557629.1\|3732942_3733185_-	hypothetical protein	A0A288WG15	Bacillus_phage	3.9e-25	72.5
WP_048557628.1\|3733316_3733529_-	hypothetical protein	A0A1B1P8F3	Bacillus_phage	1.7e-29	97.1
WP_048557627.1\|3733515_3733779_-	hypothetical protein	A0A1B1P7X2	Bacillus_phage	7.2e-33	82.4
WP_048557626.1\|3733809_3734559_-	site-specific DNA-methyltransferase	A0A0H3UZL7	Geobacillus_virus	2.9e-79	58.9
WP_001012162.1\|3735143_3735686_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	2.9e-89	92.2
WP_000166202.1\|3735685_3736168_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	3.4e-73	83.1
WP_000645582.1\|3736483_3736606_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_048557624.1\|3736623_3736953_-	hypothetical protein	NA	NA	NA	NA
WP_000389465.1\|3737361_3737637_-	hypothetical protein	A0A1B1P870	Bacillus_phage	1.2e-46	100.0
WP_000854065.1\|3737756_3737966_-	hypothetical protein	NA	NA	NA	NA
WP_048557672.1\|3739253_3739736_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	2.3e-21	50.5
WP_048557623.1\|3739751_3740171_-	hypothetical protein	A0A1B1P8B9	Bacillus_phage	1.1e-14	43.0
WP_016718368.1\|3740183_3740438_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	1.1e-38	92.9
WP_000805174.1\|3740452_3740626_-	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	100.0
WP_048548799.1\|3740651_3740846_-	hypothetical protein	A0A1B1P7U7	Bacillus_phage	9.0e-25	85.9
WP_014297966.1\|3740860_3741664_-	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	2.5e-145	98.9
WP_048557622.1\|3741632_3742505_-	DnaD domain protein	W8CYG5	Bacillus_phage	1.6e-57	45.5
WP_000364154.1\|3742501_3742687_-	hypothetical protein	A0A1B1P7U0	Bacillus_phage	4.6e-18	69.0
WP_000284331.1\|3742937_3743138_-	helix-turn-helix domain-containing protein	A0A0U4IIS1	Bacillus_phage	5.1e-07	48.0
WP_000935436.1\|3743247_3743442_-	helix-turn-helix transcriptional regulator	A0A0A7AQV9	Bacillus_phage	1.2e-05	45.2
WP_048548405.1\|3743610_3743967_+	helix-turn-helix transcriptional regulator	A0A0P0IZG9	Lactobacillus_phage	1.9e-12	39.6
WP_048548416.1\|3743963_3744146_-	hypothetical protein	NA	NA	NA	NA
WP_048548403.1\|3744287_3744422_-	hypothetical protein	NA	NA	NA	NA
WP_048548402.1\|3744423_3745569_-	hypothetical protein	H0UST6	Bacillus_phage	1.1e-58	33.2
WP_044821771.1\|3746005_3746350_+	helix-turn-helix transcriptional regulator	A8ASM2	Listeria_phage	1.3e-05	28.9
WP_048548400.1\|3746439_3746619_-	hypothetical protein	NA	NA	NA	NA
WP_000511407.1\|3746895_3747201_-	STAS-like domain-containing protein	J7KJ12	Streptococcus_phage	4.8e-12	45.2
WP_048548396.1\|3747191_3748094_-	sensor histidine kinase	NA	NA	NA	NA
WP_154982028.1\|3748322_3749453_+\|integrase	tyrosine-type recombinase/integrase	A0A0U4JNS1	Bacillus_phage	9.0e-64	38.6
3749493:3749507	attR	NA	NA	NA	NA

DBSCAN-SWA_8

4681291 : 4721950

Prochlorococcus_phage(16.67%)

protease,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000447123.1\|4681291_4681969_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002028775.1\|4682067_4682862_-	DUF4111 domain-containing protein	NA	NA	NA	NA
WP_000248590.1\|4682914_4683223_-	YuzD family protein	NA	NA	NA	NA
WP_000431159.1\|4683429_4683666_+	NifU family protein	Q58MC7	Prochlorococcus_phage	2.0e-10	46.6
WP_001125488.1\|4683990_4684206_+	hypothetical protein	NA	NA	NA	NA
WP_000581271.1\|4684267_4685269_-\|coat	spore coat protein CotS	NA	NA	NA	NA
WP_000665103.1\|4685389_4685881_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	3.5e-41	53.8
WP_000351140.1\|4685901_4686381_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000683409.1\|4686993_4687575_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_000276467.1\|4687789_4688554_-	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_000503354.1\|4688663_4689296_-	transcriptional regulator	NA	NA	NA	NA
WP_000274006.1\|4689376_4689817_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_000439090.1\|4689964_4690936_+	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_000392606.1\|4690952_4691219_+	DUF3055 domain-containing protein	NA	NA	NA	NA
WP_001174567.1\|4691592_4692090_+	hypothetical protein	NA	NA	NA	NA
WP_000435943.1\|4692135_4692438_-	YutD family protein	NA	NA	NA	NA
WP_000744130.1\|4692556_4693135_+	hypothetical protein	NA	NA	NA	NA
WP_001241009.1\|4693172_4693904_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_001055915.1\|4694008_4695439_+\|transposase	IS4-like element ISBce2 family transposase	NA	NA	NA	NA
WP_002028770.1\|4695650_4696466_+\|protease	YhfC family intramembrane metalloprotease	NA	NA	NA	NA
WP_000738184.1\|4696488_4696932_-	hypothetical protein	NA	NA	NA	NA
WP_000721019.1\|4697064_4697619_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_000272743.1\|4697693_4698173_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_000166370.1\|4698193_4699090_-	lipoyl synthase	NA	NA	NA	NA
WP_000944673.1\|4699279_4700263_+	M23 family metallopeptidase	NA	NA	NA	NA
WP_154982085.1\|4700299_4701031_-	sporulation protein YunB	NA	NA	NA	NA
WP_000248463.1\|4701085_4701388_-	DUF1805 domain-containing protein	NA	NA	NA	NA
WP_079994036.1\|4701453_4702845_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_001118823.1\|4703528_4704926_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_000009523.1\|4704974_4705406_-	iron-sulfur cluster assembly scaffold protein SufU	A0A0K1LS29	Mycobacterium_phage	1.5e-14	37.6
WP_001020770.1\|4705395_4706616_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	1.4e-118	47.6
WP_000152163.1\|4706615_4707908_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_000929157.1\|4707923_4708709_-	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	7.5e-09	25.8
WP_000722401.1\|4708947_4709754_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000735091.1\|4709826_4710639_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000359556.1\|4710662_4711328_-	ABC transporter permease	NA	NA	NA	NA
WP_000601758.1\|4711320_4712346_-	methionine ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_000424933.1\|4712878_4713223_-	hypothetical protein	NA	NA	NA	NA
WP_000568169.1\|4713375_4713675_-	thioredoxin family protein	NA	NA	NA	NA
WP_000640869.1\|4713687_4714032_-	DNA primase	NA	NA	NA	NA
WP_000026900.1\|4714531_4714915_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_000218967.1\|4714956_4715322_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	6.7e-21	48.6
WP_001224771.1\|4716050_4716422_-	hypothetical protein	NA	NA	NA	NA
WP_012644684.1\|4716539_4716803_-	DUF3937 domain-containing protein	NA	NA	NA	NA
WP_000826889.1\|4717035_4717563_-	hypothetical protein	NA	NA	NA	NA
WP_000713747.1\|4717706_4718354_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_000666170.1\|4718410_4719424_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_154982087.1\|4719446_4720646_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_001002987.1\|4720642_4720891_-\|coat	spore coat protein	NA	NA	NA	NA
WP_001180555.1\|4720904_4721090_-	hypothetical protein	NA	NA	NA	NA
WP_000005487.1\|4721236_4721950_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP045537

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection