CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP045358	Vibrio sp. THAF64 plasmid pTHAF64_c, complete sequence	0 crisprs	NA	0	1
NZ_CP045356	Vibrio sp. THAF64 plasmid pTHAF64_a, complete sequence	1 crisprs	csa3,cas3,DEDDh,WYL	1	0
NZ_CP045355	Vibrio sp. THAF64 chromosome, complete genome	0 crisprs	DEDDh,csa3,DinG,csx1,cas3	0	3
NZ_CP045357	Vibrio sp. THAF64 plasmid pTHAF64_b, complete sequence	1 crisprs	WYL,csa3	1	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

37609 : 81260

Escherichia_phage(53.33%)

plate,integrase,tail

attL 30344:30361|attR 43947:43964

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
30344:30361	attL	NA	NA	NA	NA
WP_152473021.1\|37609_38266_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	7.1e-05	38.6
WP_152473023.1\|38265_38466_+	hypothetical protein	NA	NA	NA	NA
WP_152473025.1\|38468_38984_+	Fe3+-citrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_152473026.1\|39110_39377_+	hypothetical protein	NA	NA	NA	NA
WP_152473027.1\|39367_39898_+	hypothetical protein	NA	NA	NA	NA
WP_152473028.1\|39918_40422_+	hypothetical protein	NA	NA	NA	NA
WP_152473029.1\|40527_40875_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_152473030.1\|40879_41134_+	hypothetical protein	NA	NA	NA	NA
WP_152473031.1\|41154_41367_+	DUF4236 domain-containing protein	NA	NA	NA	NA
WP_152473032.1\|41370_41907_+	hypothetical protein	NA	NA	NA	NA
WP_152473033.1\|41991_42207_-	hypothetical protein	NA	NA	NA	NA
WP_152473034.1\|42317_42515_+	hypothetical protein	NA	NA	NA	NA
WP_152473035.1\|42526_42949_-	hypothetical protein	NA	NA	NA	NA
WP_152473036.1\|42963_43707_-	hypothetical protein	NA	NA	NA	NA
WP_152473037.1\|44678_45131_-	hypothetical protein	NA	NA	NA	NA
43947:43964	attR	NA	NA	NA	NA
WP_152473038.1\|45195_45663_-	hypothetical protein	NA	NA	NA	NA
WP_152473039.1\|45672_46398_-	hypothetical protein	A0A1B0V7N5	Roseobacter_phage	9.6e-11	44.2
WP_152473040.1\|46457_46928_-	hypothetical protein	A0A088FAL7	Vibrio_phage	8.6e-29	45.1
WP_152473041.1\|47135_47420_-	hypothetical protein	NA	NA	NA	NA
WP_152473042.1\|47420_48065_-	hypothetical protein	NA	NA	NA	NA
WP_152473043.1\|48067_48793_-	hypothetical protein	A0A076G7C3	Sinorhizobium_phage	7.3e-27	36.6
WP_152473044.1\|48789_49221_-	hypothetical protein	NA	NA	NA	NA
WP_152473045.1\|49236_49722_-	DUF4262 domain-containing protein	NA	NA	NA	NA
WP_152473046.1\|49734_49932_-	hypothetical protein	NA	NA	NA	NA
WP_152473047.1\|49935_50361_-	hypothetical protein	NA	NA	NA	NA
WP_152473048.1\|50814_51276_+	hypothetical protein	M4M9K3	Vibrio_phage	9.9e-54	68.6
WP_152473049.1\|51292_51790_+	helix-turn-helix transcriptional regulator	A0A2I7RSZ7	Vibrio_phage	2.6e-07	39.1
WP_152473050.1\|51777_52005_+	hypothetical protein	NA	NA	NA	NA
WP_152473094.1\|52324_52813_+	hypothetical protein	A0A222YXV2	Escherichia_phage	8.7e-32	53.9
WP_152473051.1\|52884_53517_+	hypothetical protein	A0A222YZ79	Escherichia_phage	1.1e-15	28.1
WP_152473052.1\|53513_53834_+\|plate	baseplate wedge protein 53	Q1MVH3	Enterobacteria_phage	6.1e-18	45.4
WP_152473053.1\|53836_54988_+\|tail	phage tail protein	A0A222YXT1	Escherichia_phage	2.8e-73	49.1
WP_152473054.1\|54984_55602_+	hypothetical protein	A0A222YXU3	Escherichia_phage	5.3e-34	45.5
WP_152473055.1\|55598_55928_+	DUF4406 domain-containing protein	A0A222YYT7	Escherichia_phage	2.4e-25	62.9
WP_152473056.1\|55976_56522_+	hypothetical protein	A0A1C9LW11	Vibrio_phage	4.0e-09	32.3
WP_152473057.1\|56524_57292_+	hypothetical protein	NA	NA	NA	NA
WP_152473058.1\|57284_58256_+	hypothetical protein	A0A222YXZ0	Escherichia_phage	8.6e-31	26.3
WP_152473059.1\|58222_59035_+	hypothetical protein	R9TNN7	Vibrio_phage	2.3e-13	44.1
WP_152473060.1\|59034_59232_+	hypothetical protein	A0A2I7RNJ8	Vibrio_phage	1.2e-11	62.5
WP_152473061.1\|59294_59648_+	hypothetical protein	NA	NA	NA	NA
WP_172974107.1\|59860_60400_+	N-acetylmuramoyl-L-alanine amidase	A0A2I7RXW8	Vibrio_phage	3.9e-25	38.2
WP_152473063.1\|60402_60726_+	hypothetical protein	NA	NA	NA	NA
WP_152473064.1\|61009_62692_+	hypothetical protein	A0A222YWC7	Escherichia_phage	4.7e-61	29.0
WP_152473065.1\|62742_63171_+	hypothetical protein	NA	NA	NA	NA
WP_152473066.1\|63157_64738_+	hypothetical protein	Q71TB2	Escherichia_phage	8.9e-110	42.1
WP_152473067.1\|64758_65439_+	hypothetical protein	A0A222YXT7	Escherichia_phage	4.6e-07	30.3
WP_152473068.1\|65448_66069_+	hypothetical protein	A0A222YY02	Escherichia_phage	5.9e-25	36.5
WP_152473069.1\|66085_66586_+\|plate	baseplate protein	NA	NA	NA	NA
WP_152473070.1\|66653_66989_-	HigA family addiction module antidote protein	A0A222YWD7	Escherichia_phage	2.7e-16	44.0
WP_152473071.1\|67061_67346_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A222YWE2	Escherichia_phage	6.0e-25	55.4
WP_152473095.1\|67858_68101_+	hypothetical protein	NA	NA	NA	NA
WP_172974108.1\|68113_68617_+	hypothetical protein	A0A222YY05	Escherichia_phage	6.8e-32	42.4
WP_152473073.1\|68616_69429_+	hypothetical protein	A0A222YZ63	Escherichia_phage	2.3e-45	34.8
WP_152473074.1\|69557_72419_+	hypothetical protein	A0A222YXR4	Escherichia_phage	2.2e-05	25.0
WP_152473075.1\|72423_72771_+	hypothetical protein	NA	NA	NA	NA
WP_152473076.1\|72767_74165_+	hypothetical protein	A0A1B0VAD6	Salmonella_phage	2.1e-70	34.7
WP_172974109.1\|77189_77648_+\|tail	tail fiber domain-containing protein	M4QML2	Micromonas_pusilla_virus	3.2e-12	45.2
WP_152473078.1\|77644_78940_+	hypothetical protein	A0A077SLH5	Escherichia_phage	2.5e-33	36.5
WP_152473079.1\|78988_79480_+	hypothetical protein	NA	NA	NA	NA
WP_152473080.1\|79481_81260_+\|tail	tail fiber protein	R9TIZ5	Vibrio_phage	3.6e-19	47.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP045357

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045357_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045357_1

245545-245623

Orphan

Consensus_repeat	Method
TATAGACCACATGGACTAAAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045357_1

>merge|NZ_CP045357|1|245545-245623|CRISPRCasFinder
TATAGACCACATGGACTAAAAAAATTGACAAGACAAAATTTGAGCGGTTAACCTTATATAGACCAAATGGACTAAAAAA

>NZ_CP045357|1|1|245545-245623|CRISPRCasFinder
TATAGACCACATGGACTAAAAAA	ATTGACAAGACAAAATTTGAGCGGTTAACCTTA
TATAGACCAAATGGACTAAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045357.1\|WP_152472780.1\|254467_255670_+\|3-oxoadipyl-CoA-thiolase	unknown	unknown	gnl\|CDD\|181624
NZ_CP045357.1\|WP_040122414.1\|244344_244659_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP045357.1\|WP_052126644.1\|252908_253772_+\|3-keto-5-aminohexanoate-cleavage-protein	unknown	unknown	gnl\|CDD\|377562
NZ_CP045357.1\|WP_019274892.1\|240978_241731_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235816
NZ_CP045357.1\|WP_043011670.1\|253797_254475_+\|dienelactone-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223477
NZ_CP045357.1\|WP_152472770.1\|238908_239211_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045357.1\|WP_152472777.1\|247817_249164_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|367293
NZ_CP045357.1\|WP_152472933.1\|255826_256771_+\|porphobilinogen-synthase	unknown	unknown	gnl\|CDD\|172020
NZ_CP045357.1\|WP_152472773.1\|240042_240942_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP045357.1\|WP_152472775.1\|245668_246286_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045357.1\|WP_080568975.1\|238351_238759_+\|GFA-family-protein	unknown	unknown	gnl\|CDD\|226314
NZ_CP045357.1\|WP_040122413.1\|244915_245464_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP045357.1\|WP_006958523.1\|250858_251794_+\|bile-acid:sodium-symporter-family-protein	unknown	unknown	gnl\|CDD\|223462
NZ_CP045357.1\|WP_039951375.1\|243033_243267_+\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|226863
NZ_CP045357.1\|WP_152472931.1\|246312_247185_+\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187554
NZ_CP045357.1\|WP_040122417.1\|241838_242750_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP045357.1\|WP_152472779.1\|249628_250603_+\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|223677
NZ_CP045357.1\|WP_152472772.1\|239225_239948_-\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|379199
NZ_CP045357.1\|WP_052126668.1\|252032_252521_+\|MepB-family-protein	unknown	unknown	gnl\|CDD\|378077
NZ_CP045357.1\|WP_040122415.1\|244004_244343_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|227028

Protein	Function_ID	Function_description	E-value
NZ_CP045357.1\|WP_152472780.1\|254467_255670_+\|3-oxoadipyl-CoA-thiolase	gnl\|CDD\|181624	PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; Validated.	0
NZ_CP045357.1\|WP_040122414.1\|244344_244659_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	3.56514e-10
NZ_CP045357.1\|WP_052126644.1\|252908_253772_+\|3-keto-5-aminohexanoate-cleavage-protein	gnl\|CDD\|377562	pfam05853, BKACE, beta-keto acid cleavage enzyme. BKACE, beta-keto acid cleavage enzyme plays, a role in lysine degradation. In certain instances it catalyzes the conversion of 3-keto-5-aminohexanoate and acetyl-CoA into acetoacetate and 3-aminobutyryl-CoA. The family is found to have at least 14 slightly different potential new enzymatic activities, all of which can therefore be designated as beta-keto acid cleavage enzymes.	1.47357e-118
NZ_CP045357.1\|WP_043011670.1\|253797_254475_+\|dienelactone-hydrolase-family-protein	gnl\|CDD\|223477	COG0400, COG0400, Predicted esterase [General function prediction only].	1.39909e-15
NZ_CP045357.1\|WP_019274892.1\|240978_241731_-\|SDR-family-oxidoreductase	gnl\|CDD\|235816	PRK06500, PRK06500, SDR family oxidoreductase.	5.08754e-60
NZ_CP045357.1\|WP_152472772.1\|239225_239948_-\|NAD(P)H-binding-protein	gnl\|CDD\|379199	pfam13460, NAD_binding_10, NAD(P)H-binding.	2.63106e-21
NZ_CP045357.1\|WP_152472933.1\|255826_256771_+\|porphobilinogen-synthase	gnl\|CDD\|172020	PRK13384, PRK13384, porphobilinogen synthase.	0
NZ_CP045357.1\|WP_152472773.1\|240042_240942_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	2.18613e-40
NZ_CP045357.1\|WP_080568975.1\|238351_238759_+\|GFA-family-protein	gnl\|CDD\|226314	COG3791, COG3791, Uncharacterized conserved protein [Function unknown].	4.58294e-27
NZ_CP045357.1\|WP_040122413.1\|244915_245464_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.38666e-15
NZ_CP045357.1\|WP_006958523.1\|250858_251794_+\|bile-acid:sodium-symporter-family-protein	gnl\|CDD\|223462	COG0385, COG0385, Predicted Na+-dependent transporter [General function prediction only].	5.34342e-78
NZ_CP045357.1\|WP_039951375.1\|243033_243267_+\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|226863	COG4456, VagC, Virulence-associated protein and related proteins [Function unknown].	5.86062e-13
NZ_CP045357.1\|WP_152472931.1\|246312_247185_+\|NAD(P)H-binding-protein	gnl\|CDD\|187554	cd05243, SDR_a5, atypical (a) SDRs, subgroup 5. This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.94364e-49
NZ_CP045357.1\|WP_040122417.1\|241838_242750_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.48204e-59
NZ_CP045357.1\|WP_152472779.1\|249628_250603_+\|zinc-binding-dehydrogenase	gnl\|CDD\|223677	COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only].	4.27395e-75
NZ_CP045357.1\|WP_152472777.1\|247817_249164_+\|AAA-family-ATPase	gnl\|CDD\|367293	pfam03008, DUF234, Archaea bacterial proteins of unknown function.	5.93382e-15
NZ_CP045357.1\|WP_052126668.1\|252032_252521_+\|MepB-family-protein	gnl\|CDD\|378077	pfam08877, MepB, MepB protein. MepB is a functionally uncharacterized protein in the mepRAB gene cluster of Staphylococcus aureus.	8.84089e-38
NZ_CP045357.1\|WP_040122415.1\|244004_244343_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|227028	COG4683, COG4683, Uncharacterized protein conserved in bacteria [Function unknown].	2.18624e-39

>NZ_CP045357.1|WP_040122413.1|244915_245464_-|TetR/AcrR-family-transcriptional-regulator
MPKIVDREAYRNELIAKAVDIFSEHGLNGLGMRGIAGALGVSKTALYHYFSSKEELFTACTEFVLEPHSLYGIDSTSPLPEDKEQAIVQLIKTLDSRFKGEMTVVLDYVKNRDSRDIANDELLKMADNQFLVELSKIVGREHANQAYALLLGGLMTRLLNGNQTKVEEIASWILQLSTRESS
>NZ_CP045357.1|WP_040122414.1|244344_244659_+|helix-turn-helix-transcriptional-regulator
MTSKTGTLAELDALMSPEALTKAKHRAKDILLGMQLAQLRESLGLTQSDVAKIMGVTQPTISSMESNGLNLKVETVERYIAACGGHHTTIQATLPGGERIEMVL
>NZ_CP045357.1|WP_040122415.1|244004_244343_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MYEIKPREIFKEWFSGLDETDQIEVRACIDVLREYGPTLRRPRVGKINGSAHPNMKELVVQSQGNPIRIFFVFDPNRTGILLCGGDKSNQKRFYKEQIKIADKEYSDHLKGE
>NZ_CP045357.1|WP_039951375.1|243033_243267_+|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MRTVSIFRNGKNQTIRLPKDFEFDGVNELEIHKEGDVITLRPVRPDWLSFGNQEEANDDFMANREDGITDEGRFNFD
>NZ_CP045357.1|WP_040122417.1|241838_242750_+|LysR-family-transcriptional-regulator
MAFHKQLENLYLFHLVALSGSFQGAADKVGLPRSSVSKRIAKLEQTLNLRLLERSTRKLSLTQSGHELLKSTEPLQQVLHHTETLSEQVHARPQGKVRIGCSTLMAHRLLIPHIHALSDTYPDICFDFNLTDEVVDLIDNHVDIAIRIGHLPDSSLLARQIGEKTFGWYASPAYLAQNGAPESPESLLHHRCLVFKNKAVTLDNWVFVHPSGGVNAINVTPAMISDDARGLVQLATLGQGIIMVDPAFIDQELRSNELVPVLTDYTHPDKQPIHLVCLGKKGRSRAVTCVWEALSEHLLIAPK
>NZ_CP045357.1|WP_019274892.1|240978_241731_-|SDR-family-oxidoreductase
MSFQTILITGATSGIGFEAAKQYVKQGWRVVFTGRDQERIASATARLRDDAHSPDQILGLLCDNANAQHYPALVSDIRHNVGTLDAVILNAGVFHPRHFSETTQSELMTTMSVNFTGPAMLLQALLPVLNDPCSVVYVSSIVVERAFPTASSYSASKAAFEAYANVLNLELAPQGVRINYLRPGVTATEIQSKAGMSEHQIDELNASLANLPLGRMLEPTEMLSSLEFLTSSSSLALRGAHITVDGGYCL
>NZ_CP045357.1|WP_152472773.1|240042_240942_+|LysR-family-transcriptional-regulator
MNWTAISFDWNRTRAFLATAELGSLSAAAHSLNVTQPTLSRQVSALEHELGVALFERSAQKLTLTRSGIELLHIAREMGDVAHKFSMVASGQSEDLNGVVVLSVCQLDAMYRLPSILAKLRRVEPKLSIDLVVTNQVSDLKRRDADIALRSAQPTQPSLIAKKLGDERVSLYGTRAYLTPFIEAQSIEDVPELQIIGFGNNGPIMTQFSHHGWSLNEDNFKLSTDFQPAQLALCKQHLGVMYLPEDIAAQEPQLMRAPDGLFPTMQLPLWLVCHEELKTNRRVRRVFDLLAAELTILDE
>NZ_CP045357.1|WP_152472772.1|239225_239948_-|NAD(P)H-binding-protein
MAVLVLGATGATGRLVVRELLSRGDRVKVVVRALERVDRDLIACESLDIVVSNVLDLSEAQLMGHLRECEAVICCLGHNLTLNGIYGQPRKLVSDTIKRICQAAAQLKPSQPIKLVLMSTTGFQNRRRGEVVSWRHRMVIQLIRQLLPPHVDNEEAARYLQDQVGDTSPYLEWVAVRPDSLVDHPFKTEFSVHASPTCDPLFAPRKSSRINVAHFMVELVGSPQTWSRWKQDMPVLYNNP
>NZ_CP045357.1|WP_152472770.1|238908_239211_+|hypothetical-protein
MNTTKWNELWTAMCTLHPRPRWRTREVDSGYVSDWDRDWFYHFRASSFRTIEWVEITTDTPSQHQSVKTVLRKIHVPADELDSGFKIYGYIPDAKYVDYL
>NZ_CP045357.1|WP_080568975.1|238351_238759_+|GFA-family-protein
MYKGSCLCGSIQFELHGGITDPIYCHCSRCRKASGSAFATNGYVNTSELQLTDEKGTLTYYESSVGKRKYFCSTCGAPIYSSNSATPDKVRIRLGAIDSDITERPISHNFITSKGNWEELDTTLPRYEGHEPSRK
>NZ_CP045357.1|WP_152472775.1|245668_246286_+|hypothetical-protein
MTNDQITLKEAPINWQCKGKFRFSTGYGATKAESAIANYAAFIAPVLLYVLVWKELDWSGSQIVVAAILTLDMIGGVLTNSLGSMKRYLHANQNLDVNWLGRLVGSKFLFPAIHFQLFLVPLCFDIVWSYAFFWYGMMMVSIVIVHFTPLYLQRPVALLIVMLSIIVAQIIPSPVGLEWLAPIFMIKLVLSHGVREEPYRPTLTE
>NZ_CP045357.1|WP_152472931.1|246312_247185_+|NAD(P)H-binding-protein
MTTSNKVLVVGATGYLGLYIVKQLQERGQDFVALARNKQKLLANGVHDSQIFEAQVTDPQQLEGICDGVDVVISCLGITRQQDGLKYMDIDYQANLNILLEAEKSGVEKFIYISAFNAPTYSNVRLLRAKERFASRLLDSEQLQPCVIRPNGFFSDLEAIYHMATKGRVYQFGASAMKLNPIHGEDLATFCLEAIPSNQKELDVGGPEILTTTEIAQLAFEAQCKNVRIVRLPDCLRRAILRLMNHLPEKWGGPAEFFLTVMGKDSIAPVYGEHKIRDHYVALFTAVNKP
>NZ_CP045357.1|WP_152472777.1|247817_249164_+|AAA-family-ATPase
MKKLYNRQRELNALQTVSEQIVDTKGQLSVMVGRRRVGKTRLLNEAFHQDNTPFLYLFISRKSESALVAEFAEIIHSELGVKFFQPQTLRDIIEFLLDYTKQKPMTIILDEFQDIDIVNPALFSDIQNLWDANKRDSMMHLVCCGSLYSMMTKIFKGKDEPLFNRDDRFFNIQPLQPSYLAEVMKDHDQFDAENMLRWWCLSGGIPKYLEWLTRFSAESDDRFEAVISEFSPLIKEGTHRLVEDFGSEHRIYFDILGAISKGNTSRARIENFLDMSVGVHLEKLDEVFDVITKLRPISSKENSRDIRYAISDPFLNFWFRFIHANKSAVEMENYEYIRRYIERDFTVYSGLELASLFKAILVESKQFGKIGGYWDAKGHNEIDIVAINDLDKTILIAEVKRQQKRYSEAKLIEKSHHLLKKLNLKGYDIEYRGFSLDNLVETMNEYQA
>NZ_CP045357.1|WP_152472779.1|249628_250603_+|zinc-binding-dehydrogenase
MKTLQVTKFGNPDVLAVNHIEKPRISNNQLLIKVIYSGVNLADTYIRKGAFPALPTPPFTLGMEGSGIIEEIGSNVSGYEQGQLVAFSASQSYAEYVVVDTTSSLEWEIAVPVALPPLTASSIGMSARTAMLLTQRLSNTSCRVLVHAAAGSVGSVLVQLLSAQNHDVIALVGSARKEEYVRSLGAAQVINYKQDDVQEVIKNAYPDGLDAIFNATGGHSIARDINLLAKNGHLIWYGFAESDHAPDIETALQNAFMKSIKLELFNGGIHSQAENISAIKSVERLIIDGKVDIPIHKVYSLEEGIKAHQDLESGDTIGKLILKL
>NZ_CP045357.1|WP_006958523.1|250858_251794_+|bile-acid:sodium-symporter-family-protein
MLRVIINAFPLWVVLGSVVAYLQPAIFTPLKPQIVPLLMLIMLSMGLTLTLDDFKRVTSSVKAVTAGLILQFSVMPLSALFVAHVFDMDMALTIGMVLVGSVAGGTASNVICYLAKGNVALSITMTAFSTLIGVVMTPFLVDALLGVNVDVPVGPMVLNLVKIVIIPITIGIALNHFFRRPVTAIAPVLPLVSMLSIVMAIAIIVALNHDKIAIVGLGVALAVILHNAMGLVLGYWVCRALKFDYVTCKTIAIEVGLQNSGLATALALKFFSPISALPAALFSIWHNLSGSILAHYWSRDKRKRSRDLSVS
>NZ_CP045357.1|WP_052126668.1|252032_252521_+|MepB-family-protein
MALDPYPQNSQYEALAFSIDGQQILYRKGHVTPDRPGHFLTIWKRSAGEGPDSKKTRPFEKPDLDYLFVEVHDHQTSKQGMFIFPLTVLLKKGVVRSEKAKGKMALRVFPPWTSSRGEVKSQVFSESAKRTQRWQCEYFVWMENNVITDVEKFAHLFGAPLN
>NZ_CP045357.1|WP_052126644.1|252908_253772_+|3-keto-5-aminohexanoate-cleavage-protein
MDKLIITAAVNGGITPRSKQPAIPHTPKEIADAVIQCSQAGASVAHIHARDDAGRPSYDQAVWREIIERIRERSDILLNLSTSGLNLPKNSPEEEAWNHLEYRPEIASFNCGSVNHGDKPFINSPALAKKLAQALKANQVMPEIEIYHSGVIHEAVTLQQQGYLGERLVFAFAMGIHGGVRPTCKDLLHLVDSLPTNSLWSAIGIGQAQLPLNTYSILLGGHVRTGLEDNIYYRKGELATSNAQLVDRVVRLSHELGRDVATVNEARALLGLSRSQPQTNPIAAATI
>NZ_CP045357.1|WP_043011670.1|253797_254475_+|dienelactone-hydrolase-family-protein
MLPLQTDIHPYTMCIEGAPLSDDNPVVILLHGRRQTADDMASLIDKLAIPEATYCLPRAPEATWYPRGFTRELDDNQPQLDQGLKVIDQILQALLSQGVNRQRIWLMGFSQGGCMAAEFVRRALQPLGGVIVFTGGLFGPQCPVAPVQKPVFEGMPLWLSGSHTDTWVPAKRITQTAAYFDQLGAHVHLEIAAERAHHVSQSEIEQARALITACYAPTHEEAAHV
>NZ_CP045357.1|WP_152472780.1|254467_255670_+|3-oxoadipyl-CoA-thiolase
MSNAYLCDFVRTPIGRYAGALSSIRADDLAAIPLKALTERHTTVDWRRVDDVILGCANQAGEDNRNVARMSLLLAGLDTDVPGSTVNRLCASGMEAVSIAARTIKTGEANLIIAGGVESMSRAPYVMGKPDAPFARNTELYDTTMGWRFINASLESQYGACSMPETAENLAVKFGISRHDQDVFARWSQTKYVAAQERGFFRHEIVPVEVARRRQDPLVVDTDEHPRLSSLETLAKLKPVVQPQGTVTAGNASGINDGAAALLLASESALGDHQLVPKARIVATACAGVEPSLMGFGPTPAIKKVLELTRLSLDQMDVIELNEAFASQVLSVVNHLGIVPDDPRLNPNGGAIALGHPLGMSGARVIGTAMNQLTLQQGRYALCSLCVGVGQGMAMIIERV
>NZ_CP045357.1|WP_152472933.1|255826_256771_+|porphobilinogen-synthase
MRTMVREHDVQLHDLIYPLFVEEALASPVPIAGLPGLTRIPESQLTDEIRALDALGIRAVMPFGVSHHKDDIGSDTWHQDGLLSRMIRTIKSTCPHMLVIPDICFCEYTTHGHCGALSKHDVDNDQTVANLVKQCINAAEAGADMLAPSSMMDGQVGAIRRGLDAAGFTKVAILAHSAKFASAFYGPFRQAVECELEGDRRTYQLDYANGRQALSEALLDEQEGADILMVKPGTPYLDVLTQLRTQTRLPLAAYQVSGEYAAIKCSAEMGIVNEQEAVLETLTGFKRAGADLIVTYFAKQFAIWQQADTMPIVE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP045357_1	1.1\|245568\|33\|NZ_CP045357\|CRISPRCasFinder	245568-245600	33	NZ_CP046164	Vibrio sp. THAF191c plasmid pTHAF191c_c, complete sequence	334587-334619	0	1.0
NZ_CP045357_1	1.1\|245568\|33\|NZ_CP045357\|CRISPRCasFinder	245568-245600	33	NZ_CP046067	Vibrio sp. THAF191d plasmid pTHAF191d_c, complete sequence	83086-83118	0	1.0
NZ_CP045357_1	1.1\|245568\|33\|NZ_CP045357\|CRISPRCasFinder	245568-245600	33	NZ_CP009266	Vibrio coralliilyticus strain OCN014 plasmid pOCN014, complete sequence	8877-8909	0	1.0
NZ_CP045357_1	1.1\|245568\|33\|NZ_CP045357\|CRISPRCasFinder	245568-245600	33	NZ_CP009620	Vibrio coralliilyticus strain RE98 plasmid p319, complete sequence	73169-73201	0	1.0
NZ_CP045357_1	1.1\|245568\|33\|NZ_CP045357\|CRISPRCasFinder	245568-245600	33	NZ_CP045357	Vibrio sp. THAF64 plasmid pTHAF64_b, complete sequence	245568-245600	0	1.0
NZ_CP045357_1	1.1\|245568\|33\|NZ_CP045357\|CRISPRCasFinder	245568-245600	33	NZ_CP020455	Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence	139183-139215	1	0.97

1. spacer 1.1|245568|33|NZ_CP045357|CRISPRCasFinder matches to NZ_CP046164 (Vibrio sp. THAF191c plasmid pTHAF191c_c, complete sequence) position: , mismatch: 0, identity: 1.0

attgacaagacaaaatttgagcggttaacctta	CRISPR spacer
attgacaagacaaaatttgagcggttaacctta	Protospacer
*********************************

2. spacer 1.1|245568|33|NZ_CP045357|CRISPRCasFinder matches to NZ_CP046067 (Vibrio sp. THAF191d plasmid pTHAF191d_c, complete sequence) position: , mismatch: 0, identity: 1.0

attgacaagacaaaatttgagcggttaacctta	CRISPR spacer
attgacaagacaaaatttgagcggttaacctta	Protospacer
*********************************

3. spacer 1.1|245568|33|NZ_CP045357|CRISPRCasFinder matches to NZ_CP009266 (Vibrio coralliilyticus strain OCN014 plasmid pOCN014, complete sequence) position: , mismatch: 0, identity: 1.0

attgacaagacaaaatttgagcggttaacctta	CRISPR spacer
attgacaagacaaaatttgagcggttaacctta	Protospacer
*********************************

4. spacer 1.1|245568|33|NZ_CP045357|CRISPRCasFinder matches to NZ_CP009620 (Vibrio coralliilyticus strain RE98 plasmid p319, complete sequence) position: , mismatch: 0, identity: 1.0

attgacaagacaaaatttgagcggttaacctta	CRISPR spacer
attgacaagacaaaatttgagcggttaacctta	Protospacer
*********************************

5. spacer 1.1|245568|33|NZ_CP045357|CRISPRCasFinder matches to NZ_CP045357 (Vibrio sp. THAF64 plasmid pTHAF64_b, complete sequence) position: , mismatch: 0, identity: 1.0

attgacaagacaaaatttgagcggttaacctta	CRISPR spacer
attgacaagacaaaatttgagcggttaacctta	Protospacer
*********************************

6. spacer 1.1|245568|33|NZ_CP045357|CRISPRCasFinder matches to NZ_CP020455 (Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence) position: , mismatch: 1, identity: 0.97

attgacaagacaaaatttgagcggttaacctta	CRISPR spacer
attgacaagacaaaatttgagcggttaatctta	Protospacer
****************************.****

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

40393 : 50615

Vibrio_phage(80.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019277002.1\|40393_40585_-	hypothetical protein	A0A2I7RE17	Vibrio_phage	1.3e-07	42.4
WP_172974092.1\|40586_40751_-	hypothetical protein	NA	NA	NA	NA
WP_152472647.1\|40784_40967_-	hypothetical protein	NA	NA	NA	NA
WP_152472648.1\|40976_42338_-	toxin	Q64EV0	Vibrio_phage	2.4e-148	57.1
WP_095562275.1\|42342_42687_-	DUF2523 domain-containing protein	R9TRT6	Vibrio_phage	2.6e-30	55.8
WP_152472649.1\|42688_43984_-	hypothetical protein	G8IRU9	Vibrio_phage	6.1e-16	31.0
WP_152472650.1\|44123_44336_-	hypothetical protein	G8IRU8	Vibrio_phage	1.3e-05	45.7
WP_095562278.1\|44371_44596_-	hypothetical protein	R9TMT7	Vibrio_phage	6.4e-14	53.4
WP_152472651.1\|44599_44914_-	hypothetical protein	NA	NA	NA	NA
WP_152472652.1\|44904_46095_-	replication initiation factor domain-containing protein	G8IRU5	Vibrio_phage	4.0e-155	66.6
WP_152472653.1\|46156_46381_-	hypothetical protein	NA	NA	NA	NA
WP_152472654.1\|46508_46877_+	hypothetical protein	Q858Q3	Vibrio_phage	1.8e-45	76.3
WP_040122553.1\|47051_47411_-	hypothetical protein	NA	NA	NA	NA
WP_052131814.1\|47651_48776_+	cyclopropane fatty acyl phospholipid synthase	A0A2I2L5L3	Orpheovirus	3.1e-64	38.4
WP_052131813.1\|49265_50615_+	replicative DNA helicase	A0A1B0VG30	Salmonella_phage	1.0e-135	56.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP045355

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

646824 : 656142

Faustovirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006959830.1\|646824_648039_+	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	6.3e-31	29.9
WP_004412993.1\|648090_648474_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	1.2e-52	78.2
WP_006959829.1\|648541_648865_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	1.2e-24	50.5
WP_043006939.1\|648920_649436_+	co-chaperone HscB	NA	NA	NA	NA
WP_006959827.1\|649455_651309_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.0e-109	40.3
WP_006959826.1\|651322_651661_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_006959825.1\|651684_651879_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_006959824.1\|652041_653340_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	1.2e-35	34.4
WP_006959823.1\|653398_653827_+	nucleoside-diphosphate kinase	L7Y4C4	Megavirus	5.5e-22	42.9
WP_006959822.1\|654054_656142_+	elongation factor G	E4ZFJ7	Streptococcus_phage	2.0e-61	27.6

DBSCAN-SWA_2

1258411 : 1327048

Vibrio_phage(29.63%)

portal,terminase,transposase,integrase,head,capsid,tail,plate

attL 1248466:1248481|attR 1299821:1299836

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1248466:1248481	attL	NA	NA	NA	NA
WP_039951144.1\|1258411_1258858_+\|transposase	IS200/IS605 family transposase	Q331U4	Clostridium_botulinum_C_phage	1.3e-21	35.6
WP_006959068.1\|1258951_1259269_-	hypothetical protein	NA	NA	NA	NA
WP_006959067.1\|1259395_1259944_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_006959066.1\|1260003_1260777_-	peptidoglycan binding protein CsiV	NA	NA	NA	NA
WP_006959065.1\|1260831_1264293_-	transcription-repair coupling factor	NA	NA	NA	NA
WP_006959064.1\|1264300_1264870_-	hypothetical protein	NA	NA	NA	NA
WP_006959063.1\|1265035_1266241_+	lipoprotein-releasing ABC transporter permease subunit LolC	NA	NA	NA	NA
WP_152472092.1\|1266233_1266920_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	6.7e-38	40.0
WP_006959061.1\|1266921_1268166_+	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
WP_006959060.1\|1268274_1268805_-	DUF2062 domain-containing protein	NA	NA	NA	NA
WP_006959059.1\|1268813_1271051_+	DNA internalization-related competence protein ComEC/Rec2	Q0H255	Geobacillus_phage	2.1e-11	27.1
WP_006959058.1\|1271082_1272831_+	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	1.4e-60	30.9
WP_006959057.1\|1272834_1273842_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_006075338.1\|1273822_1274002_+	Trm112 family protein	NA	NA	NA	NA
WP_006959056.1\|1274001_1274754_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_006959055.1\|1274784_1276323_-	SpoVR family protein	NA	NA	NA	NA
WP_006959054.1\|1276333_1277605_-	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	9.9e-11	38.1
WP_006959053.1\|1277741_1279676_-	PrkA family serine protein kinase	NA	NA	NA	NA
WP_006959052.1\|1280014_1280782_+	MipA/OmpV family protein	NA	NA	NA	NA
WP_006959051.1\|1280846_1281347_-	YfbU family protein	NA	NA	NA	NA
WP_039951644.1\|1281472_1282138_-	energy-coupling factor ABC transporter permease	NA	NA	NA	NA
WP_029236135.1\|1282207_1282948_-	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	8.8e-28	32.4
WP_006959048.1\|1283174_1285055_+	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_039951642.1\|1285051_1286053_-	lipid A deacylase LpxR family protein	NA	NA	NA	NA
WP_006959046.1\|1286223_1288500_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	3.5e-160	42.1
WP_006959045.1\|1288799_1290347_-	DUF3360 family protein	NA	NA	NA	NA
WP_006959044.1\|1291022_1291793_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-14	27.1
WP_006959043.1\|1291862_1292633_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006959042.1\|1292757_1293498_+	ABC transporter permease	NA	NA	NA	NA
WP_006959041.1\|1293501_1294179_+	ABC transporter permease	NA	NA	NA	NA
WP_006959040.1\|1294238_1295921_-	aspartate:alanine antiporter	NA	NA	NA	NA
WP_006959039.1\|1296110_1296377_-	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	4.3e-25	70.5
WP_152472093.1\|1296907_1297936_-\|integrase	tyrosine-type recombinase/integrase	A0A160DJR8	Vibrio_phage	8.9e-95	51.1
WP_152472094.1\|1298135_1298378_-	DUF4177 domain-containing protein	A0A0A7NPW2	Enterobacteria_phage	2.7e-18	57.5
WP_152472095.1\|1298668_1299664_-	hypothetical protein	NA	NA	NA	NA
WP_152472096.1\|1299663_1301094_-	ATP-binding protein	NA	NA	NA	NA
1299821:1299836	attR	NA	NA	NA	NA
WP_152472097.1\|1301152_1302307_-	DNA (cytosine-5-)-methyltransferase	M1PSQ0	Streptococcus_phage	4.0e-35	29.4
WP_152472098.1\|1302529_1303156_-	helix-turn-helix domain-containing protein	A0A1D9C9M6	Salinivibrio_phage	2.2e-32	37.1
WP_019275486.1\|1303247_1303460_+	hypothetical protein	U3PFJ1	Vibrio_phage	8.7e-13	51.4
WP_021455699.1\|1303571_1304111_+	phage regulatory CII family protein	A0A2I7RNI1	Vibrio_phage	5.8e-53	59.2
WP_152472099.1\|1304139_1304352_+	hypothetical protein	A0A2I7RNH0	Vibrio_phage	1.2e-14	60.3
WP_152472100.1\|1304339_1304567_+	hypothetical protein	U3PIK2	Vibrio_phage	1.8e-16	52.8
WP_019275356.1\|1304563_1304797_+	hypothetical protein	NA	NA	NA	NA
WP_152472101.1\|1305121_1307233_+	hypothetical protein	A0A2I7RNF8	Vibrio_phage	2.9e-164	45.7
WP_152472102.1\|1307329_1307524_-	hypothetical protein	NA	NA	NA	NA
WP_031342464.1\|1307772_1307991_+	hypothetical protein	Q8HA64	Vibrio_phage	1.7e-16	63.9
WP_045985106.1\|1308016_1308259_+	ogr/Delta-like zinc finger family protein	F1BUT0	Erwinia_phage	4.5e-05	41.5
WP_095560569.1\|1308293_1308737_-	hypothetical protein	NA	NA	NA	NA
WP_152472103.1\|1309446_1310637_+	DNA circularization N-terminal domain-containing protein	NA	NA	NA	NA
WP_152472104.1\|1310633_1311572_+\|tail	phage tail protein	NA	NA	NA	NA
WP_152472105.1\|1311564_1312170_+\|plate	phage baseplate assembly protein	NA	NA	NA	NA
WP_152472106.1\|1312166_1312568_+	phage GP46 family protein	NA	NA	NA	NA
WP_152472107.1\|1312564_1313608_+\|plate	baseplate J/gp47 family protein	A0A192Y6E4	Salmonella_phage	8.6e-21	28.1
WP_152472108.1\|1313589_1314120_+	hypothetical protein	NA	NA	NA	NA
WP_152472109.1\|1315208_1315769_+	hypothetical protein	NA	NA	NA	NA
WP_152472110.1\|1315919_1316162_+	hypothetical protein	NA	NA	NA	NA
WP_152472111.1\|1316158_1316704_+	glycoside hydrolase family protein	E5G6N1	Salmonella_phage	6.5e-28	42.5
WP_152472112.1\|1316706_1317213_+	hypothetical protein	NA	NA	NA	NA
WP_152472113.1\|1317308_1317854_+	hypothetical protein	NA	NA	NA	NA
WP_152472114.1\|1317963_1318932_-\|portal	phage portal protein	A0A0M3LS06	Mannheimia_phage	8.2e-58	40.4
WP_152472115.1\|1318953_1320714_-\|terminase	terminase	E5E3X0	Burkholderia_phage	1.5e-110	41.5
WP_021455676.1\|1320848_1321664_+\|capsid	GPO family capsid scaffolding protein	Q94MZ5	Haemophilus_virus	1.0e-21	42.2
WP_043010143.1\|1321696_1322734_+\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	6.3e-64	40.5
WP_152472116.1\|1322842_1323292_+\|head	head completion/stabilization protein	NA	NA	NA	NA
WP_152472117.1\|1323291_1323756_+\|tail	phage tail protein	NA	NA	NA	NA
WP_152472118.1\|1323752_1324262_+	phage virion morphogenesis protein	NA	NA	NA	NA
WP_152472119.1\|1324261_1324444_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_152472120.1\|1324440_1325574_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A0C4UQS0	Shigella_phage	5.6e-50	40.1
WP_019274354.1\|1325577_1325943_+\|tail	phage tail tube protein	NA	NA	NA	NA
WP_152472121.1\|1325953_1326634_+	hypothetical protein	NA	NA	NA	NA
WP_152472122.1\|1326617_1326905_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_100207327.1\|1326943_1327048_+\|tail	GpE family phage tail protein	NA	NA	NA	NA

DBSCAN-SWA_3

2769878 : 2776563

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006957919.1\|2769878_2770349_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	4.9e-32	48.0
WP_006957920.1\|2770526_2771636_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.1e-65	39.6
WP_006957921.1\|2771716_2772367_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	7.7e-36	37.7
WP_006957922.1\|2772369_2773476_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	7.2e-42	32.6
WP_006957923.1\|2773483_2773933_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_006957924.1\|2774164_2775415_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	5.6e-99	47.9
WP_006957925.1\|2775429_2776563_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	9.9e-63	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP045356

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045356_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045356_1

453698-453908

Orphan

Consensus_repeat	Method
AAACATGCCTGACATGTCTGTTACATTTGACACATCCCAATAGCCAACATTTTGATTAAAT	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP045356_1

>merge|NZ_CP045356|1|453698-453908|PILER-CR
AAACATGCCCGACATACTTGTTACATTTGACACATCCCAATAGCCAACATTTTGGTCGAAAGACTTTGCGAAAGCAAACACCTCTGACATGTCTGTTACATTTGATACATCCCAATAGCCAACATTTTGATTGAATTCTTCCGCCTTATAAAACATGGCTGACATGTCTGTTACATTGGACACATCCCAATAGCTGATATCTTGATTAAAT

>NZ_CP045356|1|1|453698-453908|PILER-CR
AAACATGCCCGACATACTTGTTACATTTGACACATCCCAATAGCCAACATTTTGGTCGAAA	GACTTTGCGAAAGCAAACACCTCTGACAT
GTCTGTTACATTTGATACATCCCAATAGCCAACATTTTGATTGAATTCTTCCGCCTTATAA	AACATGGCTGACAT
GTCTGTTACATTGGACACATCCCAATAGCTGATATCTTGATTAAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045356.1\|WP_006960716.1\|446343_446811_-\|DM13-domain-containing-protein	unknown	unknown	gnl\|CDD\|378440
NZ_CP045356.1\|WP_006960711.1\|451123_452044_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045356.1\|WP_152472450.1\|461215_462142_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP045356.1\|WP_006960710.1\|452072_452795_-\|carbonic-anhydrase-family-protein	unknown	unknown	gnl\|CDD\|239398
NZ_CP045356.1\|WP_152472603.1\|462662_463046_-\|DUF2809-domain-containing-protein	unknown	unknown	gnl\|CDD\|378530
NZ_CP045356.1\|WP_006960714.1\|448206_448662_-\|DUF3429-domain-containing-protein	unknown	unknown	gnl\|CDD\|378761
NZ_CP045356.1\|WP_006960703.1\|457729_458464_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP045356.1\|WP_152472447.1\|445069_445261_-\|DUF1289-domain-containing-protein	unknown	unknown	gnl\|CDD\|377738
NZ_CP045356.1\|WP_152472451.1\|462152_462542_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319940
NZ_CP045356.1\|WP_006960706.1\|455186_456218_-\|L-threonine-3-dehydrogenase	unknown	unknown	gnl\|CDD\|180054
NZ_CP045356.1\|WP_152472448.1\|458460_460068_+\|response-regulator	unknown	unknown	gnl\|CDD\|381123
NZ_CP045356.1\|WP_006960704.1\|456217_457414_-\|glycine-C-acetyltransferase	unknown	unknown	gnl\|CDD\|235893
NZ_CP045356.1\|WP_152472449.1\|460057_460870_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP045356.1\|WP_006960715.1\|446889_448119_-\|peptidase-T	unknown	unknown	gnl\|CDD\|235484
NZ_CP045356.1\|WP_006960719.1\|443966_445040_+\|ACR3-family-arsenite-efflux-transporter	unknown	unknown	gnl\|CDD\|213563
NZ_CP045356.1\|WP_152472452.1\|463137_464487_-\|cell-envelope-integrity-protein-CreD	unknown	unknown	gnl\|CDD\|236960
NZ_CP045356.1\|WP_019274394.1\|450542_450989_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045356.1\|WP_039951967.1\|454416_454848_-\|BspA-family-leucine-rich-repeat-surface-protein	unknown	unknown	gnl\|CDD\|308794
NZ_CP045356.1\|WP_006960713.1\|448751_449960_-\|NupC/NupG-family-nucleoside-CNT-transporter	unknown	unknown	gnl\|CDD\|224883
NZ_CP045356.1\|WP_006960717.1\|445340_446201_-\|mechanosensitive-ion-channel-family-protein	unknown	unknown	gnl\|CDD\|223740

Protein	Function_ID	Function_description	E-value
NZ_CP045356.1\|WP_006960716.1\|446343_446811_-\|DM13-domain-containing-protein	gnl\|CDD\|378440	pfam10517, DM13, Electron transfer DM13. The DM13 domain is a component of a novel electron-transfer system potentially involved in oxidative modification of animal cell-surface proteins. It contains a nearly absolutely conserved cysteine, which could be involved in a redox reaction, either as a naked thiol group or through binding a prosthetic group like heme.	1.23148e-19
NZ_CP045356.1\|WP_006960713.1\|448751_449960_-\|NupC/NupG-family-nucleoside-CNT-transporter	gnl\|CDD\|224883	COG1972, NupC, Nucleoside permease [Nucleotide transport and metabolism].	9.27126e-178
NZ_CP045356.1\|WP_152472450.1\|461215_462142_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.23052e-63
NZ_CP045356.1\|WP_006960710.1\|452072_452795_-\|carbonic-anhydrase-family-protein	gnl\|CDD\|239398	cd03124, alpha_CA_prokaryotic_like, Carbonic anhydrase alpha, prokaryotic-like subfamily. Carbonic anhydrases (CAs) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism: a nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. Most alpha CAs are monomeric enzymes. The zinc ion is complexed by three histidines. This sub-family includes bacterial carbonic anhydrase alpha, as well as plant enzymes such as tobacco nectarin III and yam dioscorin and, carbonic anhydrases from molluscs, such as nacrein, which are part of the organic matrix layer in shells. Other members of this family may be involved in maintaining pH balance, in facilitating transport of carbon dioxide or carbonic acid, or in sensing carbon dioxide levels in the environment. Dioscorin is the major storage protein of yam tubers and may play a role as an antioxidant. Tobacco Nectarin may play a role in the maintenace of pH and oxidative balance in nectar. Mollusc nacrein may participate in calcium carbonate crystal formation of the nacreous layer. This subfamily also includes three alpha carbonic anhydrases from Chlamydomonas reinhardtii (CAH 1-3). CAHs1-2 are localized in the periplasmic space. CAH1 faciliates the movement of carbon dioxide across the plasma membrane when the medium is alkaline. CAH3 is localized to the thylakoid lumen and provides CO2 to Rubisco.	7.61585e-92
NZ_CP045356.1\|WP_152472603.1\|462662_463046_-\|DUF2809-domain-containing-protein	gnl\|CDD\|378530	pfam10990, DUF2809, Protein of unknown function (DUF2809). Some members in this family of proteins are annotated as yjgA however currently no function for the protein is known.	1.89595e-21
NZ_CP045356.1\|WP_006960714.1\|448206_448662_-\|DUF3429-domain-containing-protein	gnl\|CDD\|378761	pfam11911, DUF3429, Protein of unknown function (DUF3429). This family of proteins are functionally uncharacterized. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 147 to 245 amino acids in length.	1.02076e-21
NZ_CP045356.1\|WP_006960703.1\|457729_458464_+\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	3.45294e-62
NZ_CP045356.1\|WP_152472447.1\|445069_445261_-\|DUF1289-domain-containing-protein	gnl\|CDD\|377738	pfam06945, DUF1289, Protein of unknown function (DUF1289). This family consists of a number of hypothetical bacterial proteins. The aligned region spans around 56 residues and contains 4 highly conserved cysteine residues towards the N-terminus. The function of this family is unknown. Structural modelling suggests this domain may bind nucleic acids.	4.85826e-18
NZ_CP045356.1\|WP_152472451.1\|462152_462542_+\|VOC-family-protein	gnl\|CDD\|319940	cd08352, VOC_Bs_YwkD_like, vicinal oxygen chelate (VOC) family protein Bacillus subtilis YwkD and similar proteins. uncharacterized subfamily of vicinal oxygen chelate (VOC) family contains Bacillus subtilis YwkD and similar proteins. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.97339e-71
NZ_CP045356.1\|WP_152472448.1\|458460_460068_+\|response-regulator	gnl\|CDD\|381123	cd17589, REC_TPR, phosphoacceptor receiver (REC) domain of uncharacterized tetratricopeptide repeat (TPR)-containing response regulators. Response regulators share the common phosphoacceptor REC domain and different output domains. This subfamily contains uncharacterized response regulators with TPR repeats as the effector or output domain, which might contain between 3 to 16 TPR repeats (each about 34 amino acids). TPR-containing proteins occur in all domains of life and the abundance of TPR-containing proteins in a bacterial proteome is not indicative of virulence. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays. Some members in this subfamily may contain inactive REC domains lacking canonical metal-binding and active site residues.	1.90056e-07
NZ_CP045356.1\|WP_006960704.1\|456217_457414_-\|glycine-C-acetyltransferase	gnl\|CDD\|235893	PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzyme A ligase; Provisional.	0
NZ_CP045356.1\|WP_152472449.1\|460057_460870_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.26249e-10
NZ_CP045356.1\|WP_006960715.1\|446889_448119_-\|peptidase-T	gnl\|CDD\|235484	PRK05469, PRK05469, tripeptide aminopeptidase PepT.	0
NZ_CP045356.1\|WP_006960719.1\|443966_445040_+\|ACR3-family-arsenite-efflux-transporter	gnl\|CDD\|213563	TIGR00832, Uncharacterized_transporter_slr0944, arsenical-resistance protein. The Arsenical Resistance-3 (ACR3) Family (TC 2.A.59) The first protein of the ACR3 family functionally characterized was the ACR3 protein of Saccharomyces cerevisiae. It is present in the yeast plasma membrane and pumps arsenite out of the cell in response to the pmf. Similar proteins are found in bacteria, often as part of a four gene operon with an regulatory protein ArsR, a protein of unknown function ArsH, and an arsenate reductase that converts arsenate to arsenite to facilitate transport. [Cellular processes, Detoxification, Transport and binding proteins, Anions].	7.12593e-151
NZ_CP045356.1\|WP_152472452.1\|463137_464487_-\|cell-envelope-integrity-protein-CreD	gnl\|CDD\|236960	PRK11715, PRK11715, cell envelope integrity protein CreD.	0
NZ_CP045356.1\|WP_039951967.1\|454416_454848_-\|BspA-family-leucine-rich-repeat-surface-protein	gnl\|CDD\|308794	pfam03382, DUF285, Mycoplasma protein of unknown function, DUF285. This region appears distantly related to leucine rich repeats.	2.27942e-21
NZ_CP045356.1\|WP_006960706.1\|455186_456218_-\|L-threonine-3-dehydrogenase	gnl\|CDD\|180054	PRK05396, tdh, L-threonine 3-dehydrogenase; Validated.	0
NZ_CP045356.1\|WP_006960717.1\|445340_446201_-\|mechanosensitive-ion-channel-family-protein	gnl\|CDD\|223740	COG0668, MscS, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane].	3.37755e-16

>NZ_CP045356.1|WP_006960710.1|452072_452795_-|carbonic-anhydrase-family-protein
MKKTFIAASLMIAMAGTVQAAEWGYKGDKGPEHWGDVAKECATGKNQSPIDIKDVVDAELMPLNIEYQGMVTGLTNNGHTLQAVVEGNNAVTVDGVEFNLAQFHFHTPSENHIRGQNFPLEAHFVNADKDGNLAVVAVMYNAAPGENNQITQLTATMPEPGETVRLQTPFAVKDMLPATGEYYRFNGSLTTPPCSEGVRWFVLKSAQTLTTEQAKQMQMVMGNNNRPIQKQNARVVLTND
>NZ_CP045356.1|WP_006960711.1|451123_452044_+|hypothetical-protein
MRYCLLLACTISLSAYAEDEIDYSSCHSQPDSAGILDSAFSYVNARLCEPAVWFDNFFVDDRTDEDANAGSIVRWTNDFAYVEAKGYEFKTRFKARFHLPKVTKRLKVVFESDDEDDLRDLFPQNSSDAESTLAMRYDWLSNARTSFNIKLTAKPGIEGRFSYTYPISDDIVLRATQKIYQRKRVTGESTEVDLDYSISPDFLFRWSSFASYEDDIKGWELGTGFTLYQHISDHQALSYQISTTGTNRPFHYIPNTHVSITYRQSFWRPWLFYEVIPEYNWNREEDTQREGEAKATLRLEVLFHNI
>NZ_CP045356.1|WP_019274394.1|450542_450989_+|hypothetical-protein
MQRDYTLSSLQSIPREELEELSLRMIHRLIAEESMTELFTFDADETESEDKLQEAQFDAMLRMSAIALSELPALFSESDNQQQNTLRMQRLLLWHFYSVSFHLEQAIPLEVHCQHVEVLLKQAPTNALEWVTTLTDLLRQYAKISQSS
>NZ_CP045356.1|WP_006960713.1|448751_449960_-|NupC/NupG-family-nucleoside-CNT-transporter
MNVLFGLIGVVALLLCAVLLSESRKAINWKTVSRALLLQVGFAALVLYFPWGQTALTSLSNGVSSLLGFADEGIGFLFGDLANTGFIFAVRVLPIIIFFSALISALYYLGIMQKVIEFIGGGIQKFLGTSKAESLVATGNIFLSQGESPLLVRPFLSRMTRSELFAVMAGGMASVAGSVLGGYAGLGVELKYLIAASFMAAPGSLMMAKIIVPERETPIDQSDIEMDKAQDSNVIDALASGAMNGMKVAVAVGTMLIAFVSVIAMVNTGLESLGEVAGFSGITLQTLFGYLFSPLAWVIGVPANEMLMAGSYIGQKIVMNEFVAFIDFVEHKALLSEHTQVIVTFALCGFANIGSIAIQLGSIGVIAPERRSEVANLGIKAVLAGTLANLMSACLAGIFILL
>NZ_CP045356.1|WP_006960714.1|448206_448662_-|DUF3429-domain-containing-protein
MNKATSSTSIMFRLGYLGLLPFALSLICIVTGASLFGLTGEEMFISYSVVILSFLSGVLWGNGIDHSVDKISRNALLLSNLFAVMTWGVLLLSRQNIALALILLAIGYFLVWFSERAVRIAEKERKPAGYKILRARLTTSVVIMHCIALIA
>NZ_CP045356.1|WP_006960715.1|446889_448119_-|peptidase-T
MNELVQRFLRYVTFNTQSNPSNPACPSSEGQITFAQFLKQELLELGLSEVSLDDNGYLMAKLPSNVDYDVPAIGFVAHMDTAPDASGKNVKPQIVEDYQGGDIALGKGDEVLSPVQYPDLRRLLGHNLITTDGTTLLGADNKAGIAEIISAIAELKTNPDIPHGDICIGFTPDEEIGRGADLFDVEKFGAKWAYTIDGGPVGELEYENFNATSADVICHGVNVHPGTAKNKMVNAMNIAAQFQMMMPADETPEATEGYQGFYHLKSAEMAVARCELGYIIRDFERDGLEQRKAFMQSKVDELNDALTKGRVELKLSDSYFNMKEMVEPHPHIIELAKQAMIACDVEPKIKPIRGGTDGARLSFMGLPCPNIFTGGYNFHGIHEFISIEGMEQAVKVIVTLSEKTALHYR
>NZ_CP045356.1|WP_006960716.1|446343_446811_-|DM13-domain-containing-protein
MKRIFLLFTHLICGAIGFAVGIYALPILIQPDSPSMSSVESVTNNAVYTATFQRDRKDSDFLHWGEGSVSISNDQIAFVGELAPGPDYKLYLSPQFIETEVDFNQQKHTMVKVGEVKTFDRFALNLPTDVDLGEYNTVIVWCETFGEFITSARFK
>NZ_CP045356.1|WP_006960717.1|445340_446201_-|mechanosensitive-ion-channel-family-protein
MEKVQAVIDFLLTHKFIFTALIIVLIAIIRRIVLSKIRGDVAFVSEEQRNWMSRTKNGAFAITVLLLFILWKSEINEFALSVTAIAVAIVVASKEIILCFTGSIQRASSRSFRIGDWIEVGKLCGEVIEHNMMATVIQEIDLHHGQYHYTGKTATLPNSMFFTYPVKNLNFMKRYVYHNFSIVVSEFVNLYPLVPVMIEKIEGHCHYFSDVATRYNAMIEKHAGVDLPGAEPHIHITSGSTGEQVVHFMIFCPTDKATHLEQEIRKDFMELYEDRFQSEKEETKES
>NZ_CP045356.1|WP_152472447.1|445069_445261_-|DUF1289-domain-containing-protein
MMMTTDVEKVPVPCVRNCCLDGEDVCLGCFRTLNEILEWRSYTDEEKQAVLVRCERRRKEKGQ
>NZ_CP045356.1|WP_006960719.1|443966_445040_+|ACR3-family-arsenite-efflux-transporter
MKTETAVNNAANNMSFLDRYLTVWIFVAMAVGVAIGALFPQVADWNEAMSVGSTNIPLAIGLILMMYPPLAKVNYSLLGKVRQDKKAITLSLVMNWIVGPILMFILALTFLGDHPGYMVGIILIGLARCIAMVLVWNDIGGGNKEYGAALVALNSAFQIVTYSFMAWLFISVLPPVFGYQGFEVDISMLDIAESVMIYLGIPFLAGYLSRKWLVAAKGEQWYNEVFIPRISPITLIALLATIVLMFSLKGEMILELPMDVVRVAIPLAIYFVLMFFVSFFIGKKMGIEYDKNASIAFTATGNNFELAIAVSIAVFGLNSDQAFAGVIGPLIEVPVLIALVNVALKMKQKYKLRAQHA
>NZ_CP045356.1|WP_039951967.1|454416_454848_-|BspA-family-leucine-rich-repeat-surface-protein
MQLKLIVLACALLGSACSFATESITCESNAPGTVLIEEEELFVVVNDQLIRNSDYWQNFLAGNIQLCTSHVTDMSHLFAKDEFFNQDISRWDTRRVINMDGMFLGAKRFDQDLTVWDVSKVKRHTDFSKDSGLSENDLPQFPQ
>NZ_CP045356.1|WP_006960706.1|455186_456218_-|L-threonine-3-dehydrogenase
MKIKALSKLKPEEGIWMTEVEKPKVGHNDILIKIKKTAICGTDVHIYNWDEWSQNTIPVPMVVGHEYVGEVVAIGQEVRGFEIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNREGAFAEYLVIPAFNAFKIPEGISDDLASIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAAAVAKHVGARHVVITDVNEYRLELARKMGVTRAVNVAEEKLEDVMEELGMTEGFDVGLEMSGVQAAFSTMLKTMNHGGRIALLGIPPSDMGIDWNQVIFKGLVIKGIYGREMFETWYKMASLIQSGLDLTPIITHHFKVDDFQKGFDAMRSGQSGKVILDWE
>NZ_CP045356.1|WP_006960704.1|456217_457414_-|glycine-C-acetyltransferase
MSSAFYEQIKQQIEEVKAEGLYKSERVITSQQQAAVKISTGEEVLNFCANNYLGLANHPELIEAGKAGMDKHGFGMASVRFICGTQDIHKELEQKLSTFLGKEDTILYTSCFDANAGLFETILGKEDAIISDALNHASIIDGVRLCKAMRFRYSNNNMEELEQQLIAAKEAGARNILIVTDGVFSMDGVVANLPAICDLADKYGALTMVDDSHAVGFMGKTGAGTHEYHDVVDRIDIITGTLGKAMGGASGGYTSGKAEVIDWLRQRSRPYLFSNSVAPAIVNASIRVLDLLEQSGDLRDRLWENAAHFRTRMEAAGFTMGGADHAIIPIMLGDAKVAAEFAERALEKGIYVIGFSFPVVPKGQARIRTQMSAAHSREQLDRAIDAFIEVGRDMEIIK
>NZ_CP045356.1|WP_006960703.1|457729_458464_+|EAL-domain-containing-protein
MTLSDQLIRDAFSNGWHTCVYQPKVEPSFEKIQGVEALFRLDIPGQGIYLPSHFIERAFELGYEEAIFFIVLEQSLKDVKGIGANIGLAINISHQVLINPENIERVRELLWEYSIPAARLTFELSESEELDEQVSPQVKAFQNMGIKISIDDFGAGYSNFNKVLSLNIDEIKFDRSIINNNEMRSAALIKNILQFCRDFGITSVAEGVEDSDTRIYIRNLGFDTYQGFHFSKPVRIHELRQIAA
>NZ_CP045356.1|WP_152472448.1|458460_460068_+|response-regulator
MIIRASNPVPLQHQNVIAQFRVLVVDESTLFAQSIKKMLMQLKVDDKSITHASDTKLAAKYLRESKDSGSYFDVIICSFNFKSQPQGREFFRYLEKEQVRAHLTALIITDNATDIDTVRQIDAFLPDGFIAKPFNHNQFLSKFGQITEKALRLKSLKNAYFQKRYHDVLELTQDECLPSNVANDMLRLRCLSLIKLDRFEEAVELCQPFIGAQQEWPSVLLIELYSLQNDSQKISDILYTTTTLKDHPRVHWVLNESQLEGDDYQYLLSHYSKVNDDHEKSVKAALVHLLALDYDATLDSLGHLIRSNKTNPLLDKRLLVFLQGLVSLSSTFENKNKVLEVNDLNKIAPSKESQHQLYFLFVYILKHYDRKSLFLTGQRIDAFFDKALYAKDNLVLILLALACYQLGLYSKLQKLYQQRMSFIEKDYLAILTSKILGQLVQMSDKRELYYDTNRDDDLSALVSMTHSSPLNTRYHEGFISQLSDIVKRRKVKRTKEIISHIESSIAFLKDSYESLGLTSDLMRLRSEYELIKINL
>NZ_CP045356.1|WP_152472449.1|460057_460870_-|helix-turn-helix-domain-containing-protein
MNKENFSESLKELREERQLSQEELADVLSNSHRAFSGVNQVMISQWERGKTTPSFVRRVGLASFFQVEYDFSVEEMSQVKSATKLMNRPFNSDVAYDYEITQVDTYNFSSLPEKELALIRSMHAKLYGFDFLDTTQRFGFSREGIVVICFRSEGLLVGHFAYTTEANMFLSLGASSIIIRRQIFDYLSKNLEDTFVSFPTIDPAMSQFLYDLYFEPCCHQHGFIFYRADIKKVIENPFSQTIQNRHDVYFKYIRYHDLKQKKKSVEFLIG
>NZ_CP045356.1|WP_152472450.1|461215_462142_+|LysR-family-transcriptional-regulator
MVNSKLIALLPDLASFILIVDEGSFTAAAKKLDVTPSALSKLITRLESALSVKLFERTTRKLVITPTGQQVYDQAIVMVNAAQQAWELSTTDHKQATGSLTIAAPEAFLNSVLQPFVVPFLQQYPDIQLKLRVADGEIDLLRDGIDVAFKLTDKPDENLVLKEVGKTNLVLCASPEYIDKRGMPSHPTDLQHHDCLYLAETERDNVWDFFKDDEFHSMTVSGRYAVNHSQMRLTGVKNALGIGIFHDFVIAEAIEKKQVVPVLSAWTIKSNYHGAVAMQYPQTKYMPARLRVFIDYISQVLGDKLASK
>NZ_CP045356.1|WP_152472451.1|462152_462542_+|VOC-family-protein
MFNKIHHVAIICSDYPVSKQFYTQVLGLKILAENYREARSSYKLDLELPDRSQIELFSFPGAPERPSFPEAQGLRHLAFEVDSVEDVKSYLESKGIEVEPVRIDEFTGKAFTFFQDPDGLPLEIYQAQT
>NZ_CP045356.1|WP_152472603.1|462662_463046_-|DUF2809-domain-containing-protein
MMFVVLVFIAGYVRDSFIRPTFGDVLVVVWLYYTIASVIRINPKVLAMLVVGIATLVELSQYFQLAQWLGIEPSSLLYVVLGATFDWKDSVAYGVGGALCVVLESGLFRRDGALSADVKRGQVDEPS
>NZ_CP045356.1|WP_152472452.1|463137_464487_-|cell-envelope-integrity-protein-CreD
MKKILNNQLGMKFGFVLFLFVLLQIPVSMVSGLVSERSYRQQEVRDEIARSSSGEQRIIGPFIAIDFTETVRREDRTYNVERQAYILPNTFDMSAHLESFEKYRGIYKARLYKAQSALKGSFDLSALHEFERYKIEQIKMVVGVKDSRGLVKLDQMKLGGEAFDVVPGTGIKQLAQGFHTQLNVAHLDLSKPLDFDLNFLLQGMGKLQVTPIGKTTTVELSSEWPHPSFIGDYLPIESTVSESGFSAQWESNNFSSNITQLFKNCMEEESSCYELEQRQMGVDLIDPVDHYLKSHRAINYSLLVITLVFASFFLLELFQARPVHPVQYGFVGLALALFYLLLISLSEHTGFNWAYVISVLASTSLLSVYVAGMLDNNKHGTVFGVSLLCLYGLLFGLLQAESYALLMGTLLCFVILSFVMVITRNVDWYERSKKAVERANDEHQGSTDA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP045356_1	1.1\|453759\|29\|NZ_CP045356\|PILER-CR	453759-453787	29	NZ_CP046163	Vibrio sp. THAF191c plasmid pTHAF191c_b, complete sequence	1122768-1122796	0	1.0
NZ_CP045356_1	1.1\|453759\|29\|NZ_CP045356\|PILER-CR	453759-453787	29	NZ_CP046066	Vibrio sp. THAF191d plasmid pTHAF191d_b, complete sequence	1306160-1306188	0	1.0
NZ_CP045356_1	1.1\|453759\|29\|NZ_CP045356\|PILER-CR	453759-453787	29	NZ_CP045356	Vibrio sp. THAF64 plasmid pTHAF64_a, complete sequence	453752-453780	0	1.0
NZ_CP045356_1	1.1\|453759\|29\|NZ_CP045356\|PILER-CR	453759-453787	29	NZ_CP009417	Jeotgalibacillus malaysiensis strain malaysiensis plasmid unnamed, complete sequence	72898-72926	8	0.724

1. spacer 1.1|453759|29|NZ_CP045356|PILER-CR matches to NZ_CP046163 (Vibrio sp. THAF191c plasmid pTHAF191c_b, complete sequence) position: , mismatch: 0, identity: 1.0

gtcgaaagactttgcgaaagcaaacacct	CRISPR spacer
gtcgaaagactttgcgaaagcaaacacct	Protospacer
*****************************

2. spacer 1.1|453759|29|NZ_CP045356|PILER-CR matches to NZ_CP046066 (Vibrio sp. THAF191d plasmid pTHAF191d_b, complete sequence) position: , mismatch: 0, identity: 1.0

gtcgaaagactttgcgaaagcaaacacct	CRISPR spacer
gtcgaaagactttgcgaaagcaaacacct	Protospacer
*****************************

3. spacer 1.1|453759|29|NZ_CP045356|PILER-CR matches to NZ_CP045356 (Vibrio sp. THAF64 plasmid pTHAF64_a, complete sequence) position: , mismatch: 0, identity: 1.0

gtcgaaagactttgcgaaagcaaacacct	CRISPR spacer
gtcgaaagactttgcgaaagcaaacacct	Protospacer
*****************************

4. spacer 1.1|453759|29|NZ_CP045356|PILER-CR matches to NZ_CP009417 (Jeotgalibacillus malaysiensis strain malaysiensis plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.724

gtcgaaagactttgcgaaagcaaacacct	CRISPR spacer
taagaaagactttgtgaaagcaaaagacc	Protospacer
   ***********.********* . *.

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP045358

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP045357

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP045355

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP045356

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection