CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP044498	Bacillus subtilis strain ms-2 chromosome, complete genome	2 crisprs	csa3,cas3,DEDDh,WYL,DinG	0	1	11	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044498_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044498_1

890800-890905

Orphan

Consensus_repeat	Method
AGAAAACAAAACCAACAATCAGCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044498_1

>merge|NZ_CP044498|1|890800-890905|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTGCTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTCAGAAAACAAAACCAGCAATCAGCTG

>NZ_CP044498|1|1|890800-890905|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTG	CTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTC
AGAAAACAAAACCAGCAATCAGCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044498.1\|WP_009966836.1\|892202_893945_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP044498.1\|WP_003244136.1\|887311_888295_-\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|224899
NZ_CP044498.1\|WP_003223285.1\|897340_897778_+\|peroxide-responsive-transcriptional-repressor-PerR	unknown	unknown	gnl\|CDD\|223806
NZ_CP044498.1\|WP_029726839.1\|882580_883441_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP044498.1\|WP_014113119.1\|897812_898166_-\|YgzB-family-protein	unknown	unknown	gnl\|CDD\|371346
NZ_CP044498.1\|WP_015715543.1\|898373_899258_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379641
NZ_CP044498.1\|WP_015252512.1\|891097_891442_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372951
NZ_CP044498.1\|WP_003243789.1\|881244_881514_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379438
NZ_CP044498.1\|WP_003243838.1\|888510_889620_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|130156
NZ_CP044498.1\|WP_032679045.1\|882261_882579_+\|SdpC-immunity-protein-SpdL	unknown	unknown	gnl\|CDD\|227945
NZ_CP044498.1\|WP_029726841.1\|881658_882177_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|214600
NZ_CP044498.1\|WP_003223262.1\|889933_890686_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	unknown	unknown	gnl\|CDD\|236145
NZ_CP044498.1\|WP_015715541.1\|895303_896593_-\|glutamate-1-semialdehyde-2,1-aminomutase	unknown	unknown	gnl\|CDD\|183493
NZ_CP044498.1\|WP_003244113.1\|883672_884662_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_CP044498.1\|WP_015715542.1\|896744_897218_+\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|224146
NZ_CP044498.1\|WP_003223272.1\|891585_892116_+\|DUF402-domain-containing-protein	unknown	unknown	gnl\|CDD\|184219
NZ_CP044498.1\|WP_015715540.1\|889627_889852_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044498.1\|WP_038427539.1\|884733_887319_+\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|226888
NZ_CP044498.1\|WP_003233537.1\|894021_895083_-\|aromatic-acid-exporter-family-protein	unknown	unknown	gnl\|CDD\|226614
NZ_CP044498.1\|WP_029726361.1\|906222_906999_-\|sporulation-control-protein-Spo0M	unknown	unknown	gnl\|CDD\|226776

Protein	Function_ID	Function_description	E-value
NZ_CP044498.1\|WP_009966836.1\|892202_893945_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NZ_CP044498.1\|WP_003244136.1\|887311_888295_-\|metal-dependent-hydrolase	gnl\|CDD\|224899	COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only].	2.00254e-44
NZ_CP044498.1\|WP_003223285.1\|897340_897778_+\|peroxide-responsive-transcriptional-repressor-PerR	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	2.19115e-56
NZ_CP044498.1\|WP_029726839.1\|882580_883441_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.79974e-38
NZ_CP044498.1\|WP_014113119.1\|897812_898166_-\|YgzB-family-protein	gnl\|CDD\|371346	pfam11023, DUF2614, Zinc-ribbon containing domain. This is a family of proteins conserved in the Bacillaceae family. Some members are annotated as being protein YgzB. The function is not known.	1.8925e-70
NZ_CP044498.1\|WP_015715543.1\|898373_899258_+\|hypothetical-protein	gnl\|CDD\|379641	pfam14540, NTF-like, Nucleotidyltransferase-like. Structural comparisons with Structure 1kny indicate that this N-terminal domain resembles a nucleotidyltransferase fold.	2.23368e-58
NZ_CP044498.1\|WP_015252512.1\|891097_891442_+\|hypothetical-protein	gnl\|CDD\|372951	pfam14182, YgaB, YgaB-like protein. The YgaB-like protein family includes the B. subtilis YgaB protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	7.7337e-29
NZ_CP044498.1\|WP_003243789.1\|881244_881514_+\|hypothetical-protein	gnl\|CDD\|379438	pfam14043, WVELL, WVELL protein. This family includes the B. subtilis YfjH protein, which is functionally uncharacterized. This is not a homolog of E. coli YfjH, a synonym for IscX, which belongs to pfam04384. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length and contain a highly conserved WVELL motif.	4.98563e-41
NZ_CP044498.1\|WP_003243838.1\|888510_889620_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|130156	TIGR01084, A/G-specific_adenine_glycosylase, A/G-specific adenine glycosylase. This equivalog model identifies mutY members of the pfam00730 superfamily (HhH-GPD: Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate). The major members of the superfamily are nth and mutY. [DNA metabolism, DNA replication, recombination, and repair].	5.10517e-157
NZ_CP044498.1\|WP_032679045.1\|882261_882579_+\|SdpC-immunity-protein-SpdL	gnl\|CDD\|227945	COG5658, COG5658, Predicted integral membrane protein [Function unknown].	4.72456e-23
NZ_CP044498.1\|WP_029726841.1\|881658_882177_+\|SH3-domain-containing-protein	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	6.63792e-13
NZ_CP044498.1\|WP_003223262.1\|889933_890686_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	gnl\|CDD\|236145	PRK08063, PRK08063, enoyl-[acyl-carrier-protein] reductase FabL.	2.59874e-172
NZ_CP044498.1\|WP_015715541.1\|895303_896593_-\|glutamate-1-semialdehyde-2,1-aminomutase	gnl\|CDD\|183493	PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional.	0
NZ_CP044498.1\|WP_003244113.1\|883672_884662_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	2.54502e-85
NZ_CP044498.1\|WP_015715542.1\|896744_897218_+\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	3.09168e-86
NZ_CP044498.1\|WP_003223272.1\|891585_892116_+\|DUF402-domain-containing-protein	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	7.36814e-127
NZ_CP044498.1\|WP_038427539.1\|884733_887319_+\|YfhO-family-protein	gnl\|CDD\|226888	COG4485, COG4485, Predicted membrane protein [Function unknown].	0
NZ_CP044498.1\|WP_003233537.1\|894021_895083_-\|aromatic-acid-exporter-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	2.49461e-90
NZ_CP044498.1\|WP_029726361.1\|906222_906999_-\|sporulation-control-protein-Spo0M	gnl\|CDD\|226776	COG4326, Spo0M, Sporulation control protein [General function prediction only].	4.74842e-155

>NZ_CP044498.1|WP_003223262.1|889933_890686_+|enoyl-[acyl-carrier-protein]-reductase-FabL
MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSLLV
>NZ_CP044498.1|WP_015715540.1|889627_889852_-|hypothetical-protein
MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYGELTQEIEARGGMKRNEADYSHGTRVSYD
>NZ_CP044498.1|WP_003243838.1|888510_889620_+|A/G-specific-adenine-glycosylase
MNVLEDKLKQKDIQQFRDDLISWFEREQRVLPWREDQDPYKVWVSEVMLQQTRVETVIPYFLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKDFGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEDAIRAFISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQQHCSAFEEGTERELPVKSKKKKPGIKTMAAIVLTDEDGQVYIHKRPSKGLLANLWEFPNLETQKGIKTEREQLIAFLENEYGIQADISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSKLKKVTKEELEQFAFPVSHQKIWKMAGEAAAISAAP
>NZ_CP044498.1|WP_003244136.1|887311_888295_-|metal-dependent-hydrolase
MDTGTHVVMGIALGGIATLDPVVGSDPAMAHAVMIATLAGSQAPDIDTVLKLKNNAVYIRNHRGFTHSIPAVLFWSVIIPAILYLFYPQADFLHLWLWTLLAVVLHVFVDIFNAYGTQAIRPFSKKWVALGLINTFDPFIFISHLAAIAIWYAGGSPGITFLSLYIILVGYYLVRLIMQLRIKRKLHEMIHDEIESIIISPTMKFRQWRIAVTTAHAFYVGRSMEGHVVILDTFNRVPVPETDVMHAAKQDDNIAAFLSFSPVYRWEVDTFKDHYEVRFIDLRYRSKGHYPFVAIVHIGHDLTIRSSYTGWIFSEEKLQKKLKLGSI
>NZ_CP044498.1|WP_038427539.1|884733_887319_+|YfhO-family-protein
MKRKHIMIYAASLLVSVLAHAFFVKEWAEGRYMTGPGDGLAQMIVFKKLLFDQYTHGNFFYNYSFGLGGGTFSQLGYYFSASFLFLAVSAAVWLLQAVQLIGEADTLFWAESAVFISIFKLSLIIFTSASVFHYLLKHRAASFTGAVLYGVSIIYFRHEAYWEFFTDTMVWLPLLVFGAEKIIRERRPAWFIVACSLTLINNFYFAYINLIFIGIYVLFRWLIRLEPHEEKRWIQIRLFLVSGFISFGISAAAFVPVVYGFLNNLRPPYSQKIEWLNFDDNILFSSRIIIVPAAFLLFLFIISFYKNRVFRLFAGLSLLFILFHFSPYAASVFNGFSAPQNRFEYVLAFTIAGAAAAGLSQLSELKRKELLPAAAVVLLLYLYHIQRYKLDIWKPANESILLLLLMTIAALFAAAFAKKRAKMAVYGIIILSSLFVANSYQKYALSEGGDLDSVTKEYLTSEEYRGRESSELIRRLQKEDDDPLMRIDWMNGVRNNTPIIYGFNGFSAYSSILNKDLLAFYWNDLSIDMGRESVSRYASLGDRANLYSLLYGKYYMTEKTNEASVPYGFKKHLETEHYAVYENQYMLPFVKTADAIYSESELDRLPALAKEQAMLKGIILKDPSGKTEQTPKPSNLITKSDITAKQAQYQNGLLTVTGENGGELIITPKQPSSAPGDYYVSFYLKSKAKDKGFALKVNDYVTTRKSNKSIYKTGVNNITVRVPKSGHISINLPKGTYELRNIALYEENYQTLKNAVMQNKTEKADKLNWNKNRLTFAYHLSKDQYIMLPIPYEKGWELKINGKTQKIEKADYAFIGFKAQKGDNHIELTYYPPYFKISAVISLVSLLLAVFYIRRKKPGSI
>NZ_CP044498.1|WP_003244113.1|883672_884662_+|glycosyltransferase-family-2-protein
MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAATCSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVIAQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSKGLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILLLSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPHYLIKEANIPNKDLPETNELKSMRRLTKMH
>NZ_CP044498.1|WP_029726839.1|882580_883441_+|alpha/beta-hydrolase
MDGVKCQFVNTNGITLHVAAAGPEDGPLIVLLHGFPEFWYGWKNQIKPLVDAGYRVIAPDQRGYNLSDKPEGIDSYRIDTLRDDIIGLITQFTDEKAIVIGHDWGGAVAWHLASTRPEYLEKLIAINIPHPHVMKTVTPLYPPQWLKSSYIAYFQLPDIPEASLRENDYDTLDKAIGLSDRPALFTSEDVSRYKEAWKQPGALTAMLNWYRALRKGSLAEKPSYETVPYRMIWGMEDRFLSRKLAKETERHCPNGHLIFVDEASHWINHEKPAIVNQLILEYLKNQ
>NZ_CP044498.1|WP_032679045.1|882261_882579_+|SdpC-immunity-protein-SpdL
MTGLVGGGLMIIAGILIKLFPPKSINSVYGYRTRRSMSDQRLWNEANRYSASLMILSGLVIAGMGLLLGSNLIILQLILLIAACVITFMLTEKRLKIITHSQGGD
>NZ_CP044498.1|WP_029726841.1|881658_882177_+|SH3-domain-containing-protein
MKKKQVMLALTAAAGLGLTALHSAPAAKAAPLHDISVSMPSSDTYIIKTGKLNVRTEPNHEGDILGTVSSEQKVKVDRFVNADWAQIYFKGKKAYISTHFLMKTASQAKTTKQTAFYAPTPENGKAKQLSSGTEVTILGWGFSENGGFDFTWAFVDYGGVKGYIHTKDLQMR
>NZ_CP044498.1|WP_003243789.1|881244_881514_+|hypothetical-protein
MNMYIEKLTNLLLEKNEMISYIQAKTWVELLWSDFEATYAKAGHAYQGEKMTEKIVTQWIENYGGQLHLFQSSRNDVNDYLNQSRGLLH
>NZ_CP044498.1|WP_015252512.1|891097_891442_+|hypothetical-protein
MSQRVCFTEIEMIKGGNVYTFIRLKEEPMTEFEKLVSEQMKTMDKLLDLQSELDRCKQIEAELRHLERDARLRGIQAEIAVKRKHLADIQDMFQKQTEQVIRSYRSSEKPSSFV
>NZ_CP044498.1|WP_003223272.1|891585_892116_+|DUF402-domain-containing-protein
MGYPKEGETIQIHSYKHNGLIHRIWNETTILKSTEMCVIGANDRTMVTESDGRTWITREPAICYFHARQWFNVIGMLREDGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEYDDHRKAMNYPKEIDSILRDYLNTLLHWIHQRQGPFAPEFVDMWYERYLRYTK
>NZ_CP044498.1|WP_009966836.1|892202_893945_+|ABC-transporter-ATP-binding-protein
MGVMKRYMQFVKPYKKQIFVTVLIGIVKFSIPLALPLLLKYVVDDIIQGGGTASDKTTSLFTIMAIMFALFLILRPPVEYYRQYFAQWTASKVLYDIRAKLFDHIQKLSLRFYANTRTGEVISRVINDVEQTKDFVITGLMNIWLDMLTILIVISIMLTLDVKLTLISIVLFPLYGISVKYFYGRLRKLTRERSQALAQVQGHLHERIQGMPVIRSFAIEDHEQAQFNEKNGHFLDKAIRHTNWNAKTFAVVNTITDLAPLIVIACAGYFVINGPLTVGTMVAFVGYIDRMYNPVRRLINSSTTLTQSIASMDRVFEFIDEPYELTDKPNAIKADQIRGGVEFQNVSFQYEKDKENILHDVSLKVNRGETVALVGMSGGGKSTLVSLIPRFYDVTSGRLLIDGTDIRDYEARSLRNQVGMVLQDTFLFSETIRENIAIGKPDATLEEIIEAAKAANAHEFIMSFPEGYETRVGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMDKLAKDRTTFVVAHRLSTITHADKIVVMENGTIIEIGTHDELMDYESQYKHLFTIQNLN
>NZ_CP044498.1|WP_003233537.1|894021_895083_-|aromatic-acid-exporter-family-protein
MKLGARIFKTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANIIGAVIATVFGLIFGPSPIMIGLTAVIVITIMLKLKIEHTISIALVTVIAILESAGDDFLMFALIRTSTVILGVLSSFIVNLVFLPPKYETKLIHNTVENTEEIMKWIRLSMRQSTEHSILKEDIEKLKEKMIKLDQTYLLYKEERSYFKKTTYVKSRKLVLFRQAIITANRALDTLKKLHRLENEIYHMPEEFQETLTEELDYLLYWHERILMRFVGKIKPHDDAVEEGIRYKQLLTKSFLKNQQNTDEELIDYNMLNIMASAVEYREQLEHLETLITSFQTYHPKDCEIETEE
>NZ_CP044498.1|WP_015715541.1|895303_896593_-|glutamate-1-semialdehyde-2,1-aminomutase
MHTKSIELHNEALQHIVGGVNSPSRSYKAVGGGSPVAMEKASGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITEAIKKAAENGVLYGTPTKHEVTFAKMLKEAIPAMDKVRFVNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIANEVITVPFNDIDSYKAALDKWGSEIAAVLVEPIVGNFGIVEPKEGFLEKVNELTHNAGALVIYDEVITAFRFMYGGAQDLLQVKPDLTALGKIIGGGLPIGAYGGKQEIMEQVAPLGPAYQAGTMAGNPASILSGIACLEVLKEKGVYEKLDHLGAMLEEGILKHAETHGITITVNRLKGALTVYFSDEKVENYEQAERSDGETFATFFKLMLERGINLAPSKYEAWFITTAHTEQDIKDTLAAVEDAFKHLKN
>NZ_CP044498.1|WP_015715542.1|896744_897218_+|thioredoxin-dependent-thiol-peroxidase
MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRVIKEWRKVKVKDHVAEALQTLKDMSEK
>NZ_CP044498.1|WP_003223285.1|897340_897778_+|peroxide-responsive-transcriptional-repressor-PerR
MAAHELKEALETLKETGVRITPQRHAILEYLVNSMAHPTADDIYKALEGKFPNMSVATVYNNLRVFRESGLVKELTYGDASSRFDFVTSDHYHAICENCGKIVDFHYPGLDEVEQLAAHVTGFKVSHHRLEIYGVCQECSKKENH
>NZ_CP044498.1|WP_014113119.1|897812_898166_-|YgzB-family-protein
MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWIGMLSTKAVRVICPGCEKETKVLGRVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK
>NZ_CP044498.1|WP_015715543.1|898373_899258_+|hypothetical-protein
MENLLRPIYQERASHPNTLAVIMIERRNKTSSLTDNFDAALLVIVKDADDPVFIKHYEFDHQTASLHVVTDSQIQEWILLGTNRRIIDWIVNGRVLFDRNEYVVELIDRLNTFPFAERKLKIGLEYGKLIRRYVEGKAFFEANQFLDAYNAVVHALHHLARIEVIDRGFHPETTVWSQVRQMEPQVYKLYSELIESHESLEKRLELLFLANDFLIHSKAEIGSAHLFEVMKEKDIWQFGELLQHHDLKHFTQDLGVMLDYLTEKGLINVCQIETKGQAVYHRGYSFKKGVDSDS
>NZ_CP044498.1|WP_029726361.1|906222_906999_-|sporulation-control-protein-Spo0M
MSFFKKLAASAGIGAAKVDTILEKDAYFPGEEVQGTVHVKGGKIAQDIRYIDLQLSTRYVIVKDDEEHRKYATIHSFRVTGSFTIQPGEEHQFPFTFTLPLDTPITVGKVEVAVVTDLDIQGGIDKSDHDRIFVEAHPWIENVLEAIENLGFRLNEADCEQAPYFQRRLPFVQEFEFVPTSGYYRQMLDELELIFLLDEDGLEIIFEVDRRARGFRGWLEEMYNDGEQLVRVRFSQSELEDTEELEEVLEEILDQYAE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044498_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044498_2

3070201-3070308

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044498_2

>merge|NZ_CP044498|2|3070201-3070308|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>NZ_CP044498|2|2|3070201-3070308|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044498.1\|WP_003243361.1\|3081143_3081722_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
NZ_CP044498.1\|WP_004399071.1\|3057204_3057636_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044498.1\|WP_003244320.1\|3084705_3085248_+\|transcriptional-regulator-GbsR	unknown	unknown	gnl\|CDD\|224427
NZ_CP044498.1\|WP_003229031.1\|3057637_3058693_-\|spore-coat-protein-CotS	unknown	unknown	gnl\|CDD\|131952
NZ_CP044498.1\|WP_015251368.1\|3079957_3080482_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376684
NZ_CP044498.1\|WP_003229024.1\|3061183_3061651_+\|TspO/MBR-family-protein	unknown	unknown	gnl\|CDD\|226007
NZ_CP044498.1\|WP_003228966.1\|3077248_3077827_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
NZ_CP044498.1\|WP_003243556.1\|3085444_3085990_+\|biofilm-surface-layer-protein-BslA	unknown	unknown	gnl\|CDD\|379999
NZ_CP044498.1\|WP_029727108.1\|3065514_3066546_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
NZ_CP044498.1\|WP_003228963.1\|3077868_3078390_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
NZ_CP044498.1\|WP_038427868.1\|3058707_3059841_-\|spore-coat-protein-CotSA	unknown	unknown	gnl\|CDD\|340831
NZ_CP044498.1\|WP_038427871.1\|3064063_3065518_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NZ_CP044498.1\|WP_003242867.1\|3080649_3081138_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NZ_CP044498.1\|WP_003243430.1\|3083034_3084507_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
NZ_CP044498.1\|WP_003243227.1\|3081809_3083018_-\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
NZ_CP044498.1\|WP_072692952.1\|3060030_3061104_+\|spore-coat-kinase-CotI	unknown	unknown	gnl\|CDD\|131952
NZ_CP044498.1\|WP_003228960.1\|3078407_3079937_-\|flotillin-lipid-rafts-scaffold-protein-FloT	unknown	unknown	gnl\|CDD\|225177
NZ_CP044498.1\|WP_003229018.1\|3066569_3067712_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NZ_CP044498.1\|WP_068947633.1\|3067708_3069592_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
NZ_CP044498.1\|WP_038427870.1\|3061680_3064077_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967

Protein	Function_ID	Function_description	E-value
NZ_CP044498.1\|WP_003243361.1\|3081143_3081722_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	1.34032e-05
NZ_CP044498.1\|WP_003244320.1\|3084705_3085248_+\|transcriptional-regulator-GbsR	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	4.43641e-73
NZ_CP044498.1\|WP_003229031.1\|3057637_3058693_-\|spore-coat-protein-CotS	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	3.56293e-130
NZ_CP044498.1\|WP_015251368.1\|3079957_3080482_-\|hypothetical-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.000241146
NZ_CP044498.1\|WP_003228963.1\|3077868_3078390_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	4.15425e-10
NZ_CP044498.1\|WP_003228966.1\|3077248_3077827_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.328e-72
NZ_CP044498.1\|WP_003243556.1\|3085444_3085990_+\|biofilm-surface-layer-protein-BslA	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46
NZ_CP044498.1\|WP_029727108.1\|3065514_3066546_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP044498.1\|WP_003229024.1\|3061183_3061651_+\|TspO/MBR-family-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	1.0961e-40
NZ_CP044498.1\|WP_038427868.1\|3058707_3059841_-\|spore-coat-protein-CotSA	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	4.441e-74
NZ_CP044498.1\|WP_038427871.1\|3064063_3065518_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NZ_CP044498.1\|WP_003242867.1\|3080649_3081138_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	3.20062e-17
NZ_CP044498.1\|WP_003243430.1\|3083034_3084507_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
NZ_CP044498.1\|WP_003243227.1\|3081809_3083018_-\|choline-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175
NZ_CP044498.1\|WP_072692952.1\|3060030_3061104_+\|spore-coat-kinase-CotI	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	5.51077e-133
NZ_CP044498.1\|WP_003228960.1\|3078407_3079937_-\|flotillin-lipid-rafts-scaffold-protein-FloT	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	6.12922e-123
NZ_CP044498.1\|WP_003229018.1\|3066569_3067712_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NZ_CP044498.1\|WP_068947633.1\|3067708_3069592_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP044498.1\|WP_038427870.1\|3061680_3064077_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0

>NZ_CP044498.1|WP_068947633.1|3067708_3069592_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYNLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGPPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVDFLKKLNQTMREAYPHVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>NZ_CP044498.1|WP_003229018.1|3066569_3067712_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>NZ_CP044498.1|WP_029727108.1|3065514_3066546_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYRTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTADQPLVLRKGLVQGELMNS
>NZ_CP044498.1|WP_038427871.1|3064063_3065518_-|glycogen-synthase-GlgA
MKILFAVSECTPFVKSGGLADVAGALPKALARLGNEVYVMLPKYSQIPESWKKRMKKKAECTVAVGWRQQYCGIEHMAEDDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAKVVNVPADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNRFVNFMKAGIIAADHVTTVSPTYRNEILTPYYGEQLEQVLQYRENDVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQRRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALLFYRQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVRE
>NZ_CP044498.1|WP_038427870.1|3061680_3064077_-|glycogen/starch/alpha-glucan-phosphorylase
MFASKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMGWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIEDMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYASDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPDSIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDSGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSERSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>NZ_CP044498.1|WP_003229024.1|3061183_3061651_+|TspO/MBR-family-protein
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISLSAAIVYAAFSFKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYSRAASYLLLPYFLWSAFATFLSFTINSMNL
>NZ_CP044498.1|WP_072692952.1|3060030_3061104_+|spore-coat-kinase-CotI
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQLYLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDEETFHVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALQQLI
>NZ_CP044498.1|WP_038427868.1|3058707_3059841_-|spore-coat-protein-CotSA
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIANKHEVTVFSIKDPNLADREKVDGVHYVHLDGDRYEEAVGAELKKSRFDLVHVCNRPSWVPKLKKQAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKTYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAENKFGWQRVAENLLSVYEKNR
>NZ_CP044498.1|WP_003229031.1|3057637_3058693_-|spore-coat-protein-CotS
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALRALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDSFLDKLPELYKKIKAYREAN
>NZ_CP044498.1|WP_004399071.1|3057204_3057636_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSISAEKEEEEKHLDVGSIRELPHINAPKEYQKETKEKETDRKIVDDEEETKFETTLEPEEERDSKRSAPPYEEEDEDEEPDLAEEAKVEIIILPSESKPAPWFSQTVKRKA
>NZ_CP044498.1|WP_003228966.1|3077248_3077827_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>NZ_CP044498.1|WP_003228963.1|3077868_3078390_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEKGSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEFLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
>NZ_CP044498.1|WP_003228960.1|3078407_3079937_-|flotillin-lipid-rafts-scaffold-protein-FloT
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKINQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTIQKSE
>NZ_CP044498.1|WP_015251368.1|3079957_3080482_-|hypothetical-protein
MELFGVPIQTIYLYTLIIAGSLTLLFLFFGDVFAGLPEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>NZ_CP044498.1|WP_003242867.1|3080649_3081138_+|DinB-family-protein
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKPLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>NZ_CP044498.1|WP_003243361.1|3081143_3081722_-|MOSC-domain-containing-protein
MWKRMTAKAEGLYIADTKSFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDQPKLASAFVRHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>NZ_CP044498.1|WP_003243227.1|3081809_3083018_-|choline-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>NZ_CP044498.1|WP_003243430.1|3083034_3084507_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPELQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>NZ_CP044498.1|WP_003244320.1|3084705_3085248_+|transcriptional-regulator-GbsR
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVTAIEEAQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPVETK
>NZ_CP044498.1|WP_003243556.1|3085444_3085990_+|biofilm-surface-layer-protein-BslA
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044498_2	2.1\|3070225\|60\|NZ_CP044498\|CRISPRCasFinder	3070225-3070284	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
NZ_CP044498_2	2.1\|3070225\|60\|NZ_CP044498\|CRISPRCasFinder	3070225-3070284	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
NZ_CP044498_2	2.1\|3070225\|60\|NZ_CP044498\|CRISPRCasFinder	3070225-3070284	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
NZ_CP044498_2	2.1\|3070225\|60\|NZ_CP044498\|CRISPRCasFinder	3070225-3070284	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
NZ_CP044498_2	2.1\|3070225\|60\|NZ_CP044498\|CRISPRCasFinder	3070225-3070284	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
NZ_CP044498_2	2.1\|3070225\|60\|NZ_CP044498\|CRISPRCasFinder	3070225-3070284	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
NZ_CP044498_2	2.1\|3070225\|60\|NZ_CP044498\|CRISPRCasFinder	3070225-3070284	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
NZ_CP044498_2	2.1\|3070225\|60\|NZ_CP044498\|CRISPRCasFinder	3070225-3070284	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
NZ_CP044498_2	2.1\|3070225\|60\|NZ_CP044498\|CRISPRCasFinder	3070225-3070284	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 2.1|3070225|60|NZ_CP044498|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 2.1|3070225|60|NZ_CP044498|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 2.1|3070225|60|NZ_CP044498|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 2.1|3070225|60|NZ_CP044498|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 2.1|3070225|60|NZ_CP044498|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 2.1|3070225|60|NZ_CP044498|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 2.1|3070225|60|NZ_CP044498|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 2.1|3070225|60|NZ_CP044498|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 2.1|3070225|60|NZ_CP044498|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

662863 : 671229

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015715438.1\|662863_664159_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.5e-19	25.7
WP_029726599.1\|664232_664958_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.1
WP_003219409.1\|664950_665205_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_029726600.1\|665201_665885_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_029726601.1\|665868_668097_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	7.2e-158	40.0
WP_003233947.1\|668072_669503_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
WP_003233945.1\|669604_670645_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.8e-64	42.0
WP_015252651.1\|670641_671229_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0

DBSCAN-SWA_2

1160634 : 1204832

Planktothrix_phage(25.0%)

coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003232972.1\|1160634_1160874_-\|coat	spore coat protein YjzB	NA	NA	NA	NA
WP_003232971.1\|1161038_1161977_+	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_003244890.1\|1161999_1163241_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_003232967.1\|1163316_1164102_+	DUF2268 domain-containing protein	NA	NA	NA	NA
WP_003232965.1\|1164293_1165280_+	oligopeptide ABC transporter ATP-binding protein AppD	G9BWD6	Planktothrix_phage	5.7e-22	32.9
WP_003232964.1\|1165276_1166266_+	oligopeptide ABC transporter ATP-binding protein AppF	F2Y302	Organic_Lake_phycodnavirus	6.7e-07	26.1
WP_003245082.1\|1166353_1167985_+	oligopeptide-binding protein AppA	NA	NA	NA	NA
WP_003245828.1\|1168060_1169011_+	oligopeptide ABC transporter permease AppB	NA	NA	NA	NA
WP_003232961.1\|1169027_1169939_+	oligopeptide ABC transporter permease AppC	NA	NA	NA	NA
WP_003239298.1\|1170143_1170896_+	DUF3603 family protein	A0A0A0RP53	Bacillus_phage	5.4e-49	43.9
WP_003245134.1\|1170930_1171923_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003232957.1\|1172666_1174304_+	oligopeptide ABC transporter substrate-binding protein OppA	NA	NA	NA	NA
WP_003245554.1\|1174411_1175347_+	oligopeptide ABC transporter permease OppB	NA	NA	NA	NA
WP_003232954.1\|1175350_1176268_+	oligopeptide ABC transporter permease OppC	NA	NA	NA	NA
WP_014906294.1\|1176272_1177349_+	oligopeptide ABC transporter ATP-binding protein OppD	G9BWD6	Planktothrix_phage	2.1e-17	30.8
WP_003245567.1\|1177350_1178268_+	oligopeptide ABC transporter ATP-binding protein OppF	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
WP_010886478.1\|1178374_1179592_+	MFS transporter	NA	NA	NA	NA
WP_003244921.1\|1179755_1180334_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003245483.1\|1180514_1180910_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_003232944.1\|1180952_1181609_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
WP_121572562.1\|1181778_1181919_+	hypothetical protein	NA	NA	NA	NA
WP_015383354.1\|1181885_1182542_+	adaptor protein MecA	NA	NA	NA	NA
WP_029726275.1\|1182701_1183853_+	competence protein CoiA	NA	NA	NA	NA
WP_009967010.1\|1183899_1185912_+	oligoendopeptidase F	NA	NA	NA	NA
WP_003244944.1\|1185949_1186117_-	hypothetical protein	NA	NA	NA	NA
WP_032678802.1\|1186212_1186413_-	hypothetical protein	NA	NA	NA	NA
WP_003245184.1\|1186431_1187331_-	adaptor protein SpxH	NA	NA	NA	NA
WP_003232928.1\|1187327_1187726_-	group 2 truncated hemoglobin YjbI	NA	NA	NA	NA
WP_072692654.1\|1187980_1188526_-	bifunctional muramidase/murein lytic transglycosylase	A0A1P8CWQ1	Bacillus_phage	3.7e-39	60.4
WP_014479452.1\|1188729_1189302_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_038427600.1\|1189426_1189795_+	hypothetical protein	NA	NA	NA	NA
WP_003245294.1\|1189823_1190459_+	GTP diphosphokinase	NA	NA	NA	NA
WP_003232918.1\|1190477_1191278_+	NAD kinase	NA	NA	NA	NA
WP_010886481.1\|1191340_1192192_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_003244765.1\|1192204_1192939_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	M4Q4T6	Vibrio_phage	3.2e-06	25.0
WP_003232910.1\|1193173_1195018_+	sodium:proton antiporter	NA	NA	NA	NA
WP_003232909.1\|1195266_1195977_+	thiaminase II	NA	NA	NA	NA
WP_003232908.1\|1195951_1196569_+	thiazole tautomerase TenI	NA	NA	NA	NA
WP_029726273.1\|1196552_1197662_+	glycine oxidase ThiO	NA	NA	NA	NA
WP_072173897.1\|1197661_1197862_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_003232902.1\|1197858_1198629_+	thiazole synthase	NA	NA	NA	NA
WP_003232900.1\|1198625_1199636_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
WP_014479462.1\|1199654_1200470_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003232896.1\|1200605_1201382_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_072692635.1\|1201482_1202166_+\|coat	spore coat protein CotO	NA	NA	NA	NA
WP_014479464.1\|1202258_1202708_-\|coat	spore coat protein CotZ	NA	NA	NA	NA
WP_014479465.1\|1202835_1203324_-\|coat	spore coat protein CotY	NA	NA	NA	NA
WP_015252341.1\|1203475_1203988_-\|coat	Spore coat protein X	NA	NA	NA	NA
WP_015252340.1\|1204082_1204406_-	hypothetical protein	NA	NA	NA	NA
WP_029726269.1\|1204445_1204832_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_3

1269225 : 1301877

Bacillus_phage(29.63%)

terminase,portal,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003245490.1\|1269225_1270497_+	ATPase YjoB	A0A1V0SEI6	Indivirus	8.6e-15	37.1
WP_010886491.1\|1270641_1271778_+	response regulator aspartate phosphatase RapA	A0A1P8CWN8	Bacillus_phage	8.3e-94	47.4
WP_003245487.1\|1271767_1271902_+	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
WP_003232731.1\|1271932_1272190_-	YciI family protein	NA	NA	NA	NA
WP_003244876.1\|1272310_1273264_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	7.3e-67	74.1
WP_003245254.1\|1273303_1273681_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	6.1e-17	42.3
WP_003244789.1\|1273786_1274389_+	hypothetical protein	F8WQ53	Bacillus_phage	3.8e-45	49.2
WP_003245071.1\|1274465_1275302_+	manganese catalase	NA	NA	NA	NA
WP_003232721.1\|1275345_1275942_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
WP_003232719.1\|1276104_1276446_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
WP_003232712.1\|1276623_1276803_+	hypothetical protein	NA	NA	NA	NA
WP_003245799.1\|1276789_1277626_+	phage-like element PBSX protein XkdB	S6BFM4	Thermus_phage	1.8e-24	28.2
WP_010886492.1\|1277525_1278326_+	ATP-binding protein	A6XMI1	Bacillus_virus	5.0e-61	51.7
WP_003245588.1\|1278325_1278493_+	hypothetical protein	NA	NA	NA	NA
WP_003245290.1\|1278577_1278928_+	phage-like element PBSX protein XkdD	NA	NA	NA	NA
WP_109789043.1\|1278931_1279126_+	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_003245797.1\|1279246_1279756_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	1.9e-21	38.6
WP_003244697.1\|1279871_1280669_+\|terminase	PBSX phage terminase small subunit	A0A0S2MVB6	Bacillus_phage	8.0e-59	50.2
WP_151433385.1\|1280665_1281967_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	2.6e-152	60.0
WP_003245427.1\|1281970_1283458_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.7e-139	55.7
WP_003245836.1\|1283477_1284305_+	phage-like element PBSX protein XkdF	A0A1B1P7E4	Bacillus_phage	2.1e-54	58.7
WP_003232690.1\|1284330_1285266_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
WP_014479552.1\|1285287_1285671_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	1.4e-13	40.5
WP_009967053.1\|1285667_1286024_+	DUF3599 family protein	NA	NA	NA	NA
WP_003245226.1\|1286020_1286506_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	2.1e-38	47.0
WP_029726235.1\|1286518_1286959_+	hypothetical protein	NA	NA	NA	NA
WP_003232679.1\|1286962_1287181_+	hypothetical protein	NA	NA	NA	NA
WP_003245369.1\|1287177_1288578_+	phage-like element PBSX protein XkdK	A0A0A7S087	Clostridium_phage	2.3e-77	39.3
WP_003232677.1\|1288579_1289023_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	8.4e-26	45.2
WP_015715734.1\|1289113_1289560_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	5.9e-11	37.7
WP_072692631.1\|1289601_1289742_+	hypothetical protein	NA	NA	NA	NA
WP_046664098.1\|1289742_1294824_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	1.1e-41	43.8
WP_029727048.1\|1294816_1295476_+	LysM peptidoglycan-binding domain-containing protein	A0A0A8WJR4	Clostridium_phage	1.1e-24	33.2
WP_003245730.1\|1295491_1296469_+	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
WP_015715735.1\|1296468_1296735_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.7e-05	36.4
WP_015715736.1\|1296792_1297218_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	6.6e-12	38.0
WP_015715737.1\|1297210_1298257_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	2.4e-71	44.0
WP_015483131.1\|1298240_1298819_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	5.1e-15	33.1
WP_015715738.1\|1298815_1299088_+	hypothetical protein	NA	NA	NA	NA
WP_029727046.1\|1301550_1301877_+\|portal	phage portal protein	NA	NA	NA	NA

DBSCAN-SWA_4

1814509 : 1902606

Bacillus_phage(62.96%)

capsid,holin,tail,terminase,integrase,head,protease,tRNA,portal,plate

attL 1832838:1832897|attR 1876201:1876298

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029726462.1\|1814509_1815838_-\|protease	serine protease AprX	A0A1B0T6A2	Bacillus_phage	1.6e-27	33.2
WP_014476869.1\|1816062_1816296_+	hypothetical protein	NA	NA	NA	NA
WP_003245758.1\|1816575_1817283_+	hypothetical protein	F8WQ53	Bacillus_phage	3.2e-51	56.9
WP_003245175.1\|1817352_1817805_+	OsmC family protein	NA	NA	NA	NA
WP_003245163.1\|1817818_1818172_-	multidrug efflux SMR transporter subunit EbrB	NA	NA	NA	NA
WP_009967307.1\|1818185_1818503_-	multidrug efflux SMR transporter subunit EbrA	NA	NA	NA	NA
WP_029317825.1\|1818638_1818914_-	hypothetical protein	NA	NA	NA	NA
WP_003231769.1\|1819002_1819416_+	hypothetical protein	NA	NA	NA	NA
WP_029726461.1\|1819515_1820460_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_003221097.1\|1820499_1820721_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_014479841.1\|1820916_1821189_+	hypothetical protein	NA	NA	NA	NA
WP_003245262.1\|1821270_1821501_+	hypothetical protein	NA	NA	NA	NA
WP_003231758.1\|1821743_1822136_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
WP_014479842.1\|1822095_1824198_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
WP_003231754.1\|1824215_1825205_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
WP_003245105.1\|1825254_1825875_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
WP_014476879.1\|1825938_1826706_-	sporulation-specific N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	5.3e-52	50.0
WP_003231746.1\|1827338_1828307_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5
WP_015483254.1\|1828439_1829702_+	GTPase HflX	NA	NA	NA	NA
WP_029726458.1\|1829719_1830985_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003238341.1\|1831094_1831502_+	transcriptional repressor GlnR	NA	NA	NA	NA
WP_015252037.1\|1831560_1832895_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
1832838:1832897	attL	NA	NA	NA	NA
WP_072692613.1\|1833007_1834162_-\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	9.1e-64	38.9
WP_072692612.1\|1834174_1835233_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JAE0	uncultured_Caudovirales_phage	2.2e-11	33.3
WP_072692611.1\|1835229_1835571_-	helix-turn-helix transcriptional regulator	D2XQ11	Bacillus_virus	1.6e-08	33.0
WP_059335915.1\|1835666_1835903_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_128992114.1\|1836009_1836771_+	Rha family transcriptional regulator	A8ATN0	Listeria_phage	1.8e-44	44.7
WP_072692610.1\|1836785_1837097_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_072692609.1\|1837115_1837355_+	hypothetical protein	Q9ZXD0	Bacillus_phage	6.8e-06	55.3
WP_072692608.1\|1837351_1837627_+	hypothetical protein	Q9ZXC9	Bacillus_phage	6.8e-18	45.3
WP_072692607.1\|1837616_1837844_+	hypothetical protein	D6R417	Bacillus_phage	9.3e-05	87.5
WP_072692606.1\|1837942_1838497_+	hypothetical protein	Q9ZXC8	Bacillus_phage	1.2e-93	95.7
WP_072692605.1\|1838500_1839439_+	AAA family ATPase	Q9ZXC7	Bacillus_phage	4.1e-163	92.6
WP_072692604.1\|1839428_1839626_+	hypothetical protein	Q9ZXC6	Bacillus_phage	1.4e-17	85.4
WP_072692603.1\|1839650_1840091_+	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	2.1e-77	96.6
WP_072692602.1\|1840151_1842569_+	DNA primase	D6R422	Bacillus_phage	0.0e+00	89.1
WP_072693002.1\|1842767_1843205_+	hypothetical protein	Q9ZXC3	Bacillus_phage	4.8e-74	91.7
WP_072693003.1\|1843201_1843741_+	nuclease	Q9ZXC2	Bacillus_phage	2.0e-93	96.1
WP_072693005.1\|1844466_1844664_+	hypothetical protein	NA	NA	NA	NA
WP_072693006.1\|1844670_1844856_+	hypothetical protein	M4ZR07	Bacillus_phage	1.7e-09	50.0
WP_072693007.1\|1844855_1845218_+	hypothetical protein	NA	NA	NA	NA
WP_072693008.1\|1845214_1845616_+	hypothetical protein	M4ZR14	Bacillus_phage	2.8e-60	92.5
WP_072693009.1\|1845628_1845835_+	hypothetical protein	NA	NA	NA	NA
WP_072693035.1\|1845920_1846334_+	ArpU family transcriptional regulator	D6R428	Bacillus_phage	1.2e-63	99.2
WP_072693010.1\|1846778_1847294_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_072693011.1\|1847418_1847733_+	hypothetical protein	NA	NA	NA	NA
WP_072693012.1\|1847785_1848046_+	hypothetical protein	NA	NA	NA	NA
WP_072693013.1\|1848105_1848471_+	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	5.1e-29	50.8
WP_019846969.1\|1848698_1849214_+\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	2.2e-33	43.4
WP_072693015.1\|1849210_1850920_+\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	1.1e-206	62.6
WP_072693016.1\|1851108_1852389_+\|portal	phage portal protein	D6R3Y6	Bacillus_phage	4.3e-155	64.3
WP_072693017.1\|1852351_1852978_+\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	3.8e-80	75.4
WP_072693018.1\|1853016_1854312_+\|capsid	phage major capsid protein	A0A0A7RTL2	Clostridium_phage	2.3e-92	48.1
WP_068947596.1\|1854335_1854797_+	collagen-like protein	D6R3Z0	Bacillus_phage	1.8e-10	58.9
WP_041057207.1\|1854814_1855117_+\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	2.1e-12	46.3
WP_072693019.1\|1855106_1855421_+\|head	phage head closure protein	A0A2H4JCB1	uncultured_Caudovirales_phage	4.9e-12	36.3
WP_041057201.1\|1855420_1855819_+	hypothetical protein	NA	NA	NA	NA
WP_041057199.1\|1855815_1856208_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_072693020.1\|1856222_1856834_+\|tail	phage tail protein	J7KKC8	Streptococcus_phage	3.6e-11	35.1
WP_072693021.1\|1856900_1857278_+	hypothetical protein	NA	NA	NA	NA
WP_072693022.1\|1857477_1861965_+\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	2.0e-66	41.5
WP_072693023.1\|1861958_1862798_+\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	8.9e-93	59.0
WP_072693024.1\|1862812_1864516_+	alkaline phosphatase	D6R400	Bacillus_phage	1.9e-179	55.6
WP_072693025.1\|1864567_1866466_+	teichoic acid biosynthesis protein	A0A185AMX0	Staphylococcus_phage	3.3e-42	32.5
WP_072693026.1\|1866481_1866790_+	hypothetical protein	NA	NA	NA	NA
WP_128471876.1\|1866972_1868556_+\|plate	phage baseplate upper protein	A0A1P8CWR7	Bacillus_phage	2.8e-63	48.0
WP_072693028.1\|1868569_1868938_+	hypothetical protein	Q9ZXE0	Bacillus_phage	2.0e-17	48.4
WP_072693029.1\|1868937_1869111_+	XkdX family protein	Q9ZXD9	Bacillus_phage	5.6e-18	73.7
WP_031600555.1\|1869162_1869375_+	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.9e-15	59.4
WP_069837321.1\|1869389_1869653_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.1e-24	66.7
WP_072693030.1\|1869707_1870685_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	2.4e-65	69.2
WP_038427712.1\|1870725_1871025_-	hypothetical protein	NA	NA	NA	NA
WP_072693032.1\|1871031_1872879_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	5.1e-125	61.3
WP_128992116.1\|1874503_1874692_-	hypothetical protein	A0A2H4J4T3	uncultured_Caudovirales_phage	2.9e-12	55.0
WP_072693034.1\|1874888_1875926_-	DUF4917 family protein	NA	NA	NA	NA
WP_029726456.1\|1877869_1878091_+	hypothetical protein	A0A0U4B0C8	Bacillus_phage	1.6e-09	50.0
1876201:1876298	attR	NA	NA	NA	NA
WP_029726455.1\|1878170_1878968_+	hypothetical protein	NA	NA	NA	NA
WP_029726454.1\|1879152_1879905_+	hypothetical protein	NA	NA	NA	NA
WP_029726453.1\|1879997_1880444_+	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	1.6e-37	56.2
WP_029726452.1\|1880506_1881304_+	FRG domain-containing protein	A0A1S6KZX9	Salmonella_phage	3.5e-06	25.3
WP_029726451.1\|1881520_1881937_-	pilus assembly protein HicB	D6R430	Bacillus_phage	2.9e-68	89.1
WP_029726450.1\|1882008_1882191_-	addiction module toxin, HicA family	D6R431	Bacillus_phage	5.7e-21	78.3
WP_029726449.1\|1882363_1882729_+	hypothetical protein	NA	NA	NA	NA
WP_029726448.1\|1882876_1883581_+	hypothetical protein	NA	NA	NA	NA
WP_053581880.1\|1883772_1884195_+	hypothetical protein	NA	NA	NA	NA
WP_072693039.1\|1884661_1885027_+	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	3.3e-28	50.8
WP_029726445.1\|1885255_1885771_+\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	1.1e-32	42.8
WP_029726443.1\|1886301_1886481_+	hypothetical protein	NA	NA	NA	NA
WP_029726442.1\|1886539_1887394_+	hypothetical protein	NA	NA	NA	NA
WP_029726441.1\|1888553_1888844_+	hypothetical protein	NA	NA	NA	NA
WP_029726440.1\|1889082_1889571_+	hypothetical protein	NA	NA	NA	NA
WP_068947603.1\|1890603_1895949_+	S-layer family protein	NA	NA	NA	NA
WP_029726887.1\|1896052_1896724_-	glycosyl transferase	NA	NA	NA	NA
WP_029726888.1\|1896720_1897428_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_029726889.1\|1897414_1898521_-	glycosyltransferase	NA	NA	NA	NA
WP_051673223.1\|1898517_1899894_-	glycosyltransferase	NA	NA	NA	NA
WP_029726893.1\|1901088_1901625_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_029726894.1\|1901703_1902606_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_5

2074015 : 2081893

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015714072.1\|2074015_2076616_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	5.6e-45	34.5
WP_015714073.1\|2077073_2077715_-	endo-1,4-beta-xylanase XynA	NA	NA	NA	NA
WP_029727214.1\|2078050_2078245_+	hypothetical protein	O64196	Bacillus_phage	1.1e-06	52.8
WP_029727213.1\|2078347_2078587_-	TM2 domain-containing protein	M4ZS56	Bacillus_phage	1.2e-18	65.8
WP_038427749.1\|2078757_2079096_+	helix-turn-helix transcriptional regulator	A0A0P0IZG9	Lactobacillus_phage	5.5e-09	31.7
WP_004399488.1\|2079129_2079486_-	hypothetical protein	NA	NA	NA	NA
WP_029727212.1\|2079587_2079872_-	hypothetical protein	NA	NA	NA	NA
WP_029318060.1\|2079905_2080235_-	HIT domain-containing protein	NA	NA	NA	NA
WP_029727211.1\|2080713_2081025_-	hypothetical protein	NA	NA	NA	NA
WP_029727210.1\|2081180_2081393_-	hypothetical protein	O64089	Bacillus_phage	6.0e-22	77.5
WP_029727209.1\|2081396_2081648_-	hypothetical protein	A0A1P8CWV6	Bacillus_phage	4.6e-37	97.6
WP_080282471.1\|2081713_2081893_+	hypothetical protein	A0A1P8CWV7	Bacillus_phage	6.0e-23	89.3

DBSCAN-SWA_6

2308508 : 2314604

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003223904.1\|2308508_2309102_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
WP_015714192.1\|2309091_2309847_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	9.4e-09	25.8
WP_015251790.1\|2310127_2310652_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003223910.1\|2310665_2311040_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_003223915.1\|2311152_2311617_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
WP_014480160.1\|2311649_2312846_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.1e-115	54.9
WP_029726753.1\|2312860_2313508_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	8.5e-43	45.9
WP_004398763.1\|2313518_2314604_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.1e-56	36.1

DBSCAN-SWA_7

2549945 : 2589150

uncultured_Caudovirales_phage(29.03%)

capsid,holin,tail,terminase,portal,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068947614.1\|2549945_2551541_+	type II toxin-antitoxin system toxin ribonuclease YqcG	A0A1P8CWI7	Bacillus_phage	6.5e-76	60.5
WP_009967790.1\|2551555_2552134_+	type II toxin-antitoxin system antitoxin YqcF	NA	NA	NA	NA
WP_009967791.1\|2552251_2552398_+	hypothetical protein	NA	NA	NA	NA
WP_003229947.1\|2552394_2552757_-	hypothetical protein	NA	NA	NA	NA
WP_004399085.1\|2552772_2553252_-	hypothetical protein	NA	NA	NA	NA
WP_017697459.1\|2553416_2554235_-	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	3.8e-64	73.8
WP_017697460.1\|2554279_2554702_-\|holin	holin family protein	D6R405	Bacillus_phage	1.7e-47	72.9
WP_032722160.1\|2554747_2555641_-	hypothetical protein	NA	NA	NA	NA
WP_003229944.1\|2555728_2555893_-	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	2.7e-14	67.9
WP_009967793.1\|2555889_2556225_-\|portal	phage portal protein	NA	NA	NA	NA
WP_032722161.1\|2556234_2557335_-	hypothetical protein	M4ZRP1	Bacillus_phage	1.7e-19	56.1
WP_032722163.1\|2557338_2557611_-	hypothetical protein	NA	NA	NA	NA
WP_032722164.1\|2557607_2558186_-	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	1.9e-14	33.8
WP_032722165.1\|2558169_2559216_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	4.8e-72	44.0
WP_032722166.1\|2559208_2559634_-	DUF2634 domain-containing protein	A0A0A8WJV8	Clostridium_phage	5.6e-11	33.3
WP_032722167.1\|2559646_2559913_-	DUF2577 domain-containing protein	NA	NA	NA	NA
WP_032722168.1\|2559909_2560890_-	hypothetical protein	H7BV96	unidentified_phage	1.6e-40	32.3
WP_032722169.1\|2560902_2561562_-	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	2.1e-25	34.7
WP_043940167.1\|2561554_2566312_-	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	1.8e-44	47.2
WP_003229934.1\|2566314_2566452_-	hypothetical protein	NA	NA	NA	NA
WP_017697468.1\|2566493_2566943_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	5.9e-11	40.2
WP_106610765.1\|2567099_2567186_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_017697469.1\|2567444_2567888_-\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	2.5e-25	45.4
WP_017697470.1\|2567890_2569291_-\|portal	phage portal protein	S5MNC1	Brevibacillus_phage	4.8e-75	39.3
WP_033880532.1\|2569291_2569483_-	hypothetical protein	NA	NA	NA	NA
WP_017697472.1\|2569479_2569917_-	hypothetical protein	NA	NA	NA	NA
WP_017697473.1\|2569929_2570433_-	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	1.7e-38	47.5
WP_017697474.1\|2570429_2570792_-	DUF3599 family protein	NA	NA	NA	NA
WP_017697475.1\|2570788_2571184_-	DUF3199 family protein	NA	NA	NA	NA
WP_068947615.1\|2571188_2571500_-	hypothetical protein	NA	NA	NA	NA
WP_068947616.1\|2571510_2572446_-\|capsid	major capsid protein	A0A1B1P7E3	Bacillus_phage	8.6e-105	65.4
WP_068947617.1\|2572464_2573439_-\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	6.3e-58	56.6
WP_040082428.1\|2573595_2574501_-	hypothetical protein	NA	NA	NA	NA
WP_068947618.1\|2574545_2575463_-	hypothetical protein	A0A1B1P7D7	Bacillus_phage	5.2e-54	39.6
WP_068947619.1\|2575459_2576992_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.0e-147	52.0
WP_072692701.1\|2576995_2578291_-\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.6e-154	63.2
WP_017697483.1\|2578283_2579003_-	hypothetical protein	A0A2P1JTW4	Anoxybacillus_phage	1.3e-60	61.3
WP_068947621.1\|2579078_2579837_-	DNA-directed RNA polymerase	NA	NA	NA	NA
WP_017697601.1\|2579952_2580420_-	hypothetical protein	NA	NA	NA	NA
WP_017697600.1\|2580563_2581019_-	hypothetical protein	A0A2H4J4R7	uncultured_Caudovirales_phage	3.1e-60	73.5
WP_017697599.1\|2581109_2581868_-	hypothetical protein	NA	NA	NA	NA
WP_017697598.1\|2582077_2582437_+	hypothetical protein	NA	NA	NA	NA
WP_017697597.1\|2582584_2582794_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	2.7e-19	68.7
WP_017697596.1\|2582875_2583304_-	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	1.6e-42	67.2
WP_072692702.1\|2583398_2583548_-	hypothetical protein	NA	NA	NA	NA
WP_072692704.1\|2583538_2584480_-	ATP-binding protein	A6XMI1	Bacillus_virus	2.1e-58	52.2
WP_128992198.1\|2584361_2585039_-	DnaD domain protein	A0A2H4J6G9	uncultured_Caudovirales_phage	1.1e-05	32.2
WP_017697591.1\|2585115_2585970_-	recombinase RecT	A0A2H4JCY8	uncultured_Caudovirales_phage	5.1e-120	77.6
WP_068947622.1\|2585972_2586932_-	YqaJ viral recombinase family protein	A0A2H4JA52	uncultured_Caudovirales_phage	1.3e-135	74.2
WP_068947623.1\|2587037_2587232_-	hypothetical protein	NA	NA	NA	NA
WP_122060486.1\|2587191_2587365_-	hypothetical protein	NA	NA	NA	NA
WP_015714340.1\|2587361_2587619_-	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	6.4e-10	42.2
WP_068947624.1\|2587615_2588185_-	helix-turn-helix transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	1.5e-64	61.0
WP_003229902.1\|2588258_2588399_-	hypothetical protein	NA	NA	NA	NA
WP_068947625.1\|2588431_2588641_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_021480133.1\|2588796_2589150_+	helix-turn-helix domain-containing protein	A0A0A7RTK4	Clostridium_phage	8.0e-11	48.6

DBSCAN-SWA_8

2742648 : 2796087

Faustovirus(14.29%)

coat,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029727124.1\|2742648_2743812_-\|coat	spore coat assembly protein SafA	NA	NA	NA	NA
WP_038427815.1\|2743928_2745035_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_029318181.1\|2745021_2745891_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_029727122.1\|2745844_2747440_-	L-aspartate oxidase	NA	NA	NA	NA
WP_029727121.1\|2747542_2748730_+	cysteine desulfurase NifS	A0A141ZJV0	Faustovirus	1.7e-33	27.4
WP_004398582.1\|2748689_2749232_+	transcription repressor NadR	NA	NA	NA	NA
WP_029727120.1\|2749255_2750113_-	prephenate dehydratase	NA	NA	NA	NA
WP_003222630.1\|2750129_2750573_-	transcriptional regulator ThrR	NA	NA	NA	NA
WP_029727119.1\|2750633_2751920_-	GTPase ObgE	NA	NA	NA	NA
WP_004399131.1\|2751953_2752532_-	sporulation initiation phosphotransferase Sop0B	NA	NA	NA	NA
WP_003229671.1\|2752609_2752732_+	hypothetical protein	NA	NA	NA	NA
WP_003222623.1\|2752852_2753137_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_003229669.1\|2753149_2753488_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003229668.1\|2753490_2753799_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_004398649.1\|2753945_2754812_-	stage IV sporulation protein SpoIVFB	NA	NA	NA	NA
WP_029727118.1\|2754804_2755599_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_004398624.1\|2755747_2756554_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_004398901.1\|2756555_2757236_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_004398811.1\|2757288_2757807_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_003222609.1\|2757803_2758676_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003229650.1\|2758706_2759720_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_015251546.1\|2759811_2760507_-	JAB domain-containing protein	NA	NA	NA	NA
WP_004398496.1\|2760543_2761113_-	septum formation protein Maf	NA	NA	NA	NA
WP_038427816.1\|2761265_2762261_-	stage II sporulation protein SpoIIB	NA	NA	NA	NA
WP_072692713.1\|2762394_2763141_-	prepilin peptidase	NA	NA	NA	NA
WP_038427817.1\|2763282_2764575_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_029727115.1\|2764634_2767277_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	4.9e-161	42.6
WP_003222590.1\|2767724_2767916_+	hypothetical protein	NA	NA	NA	NA
WP_029727114.1\|2767934_2768960_-\|coat	spore coat protein CotN	NA	NA	NA	NA
WP_029727113.1\|2768992_2770720_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_015384279.1\|2770850_2772143_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_029727112.1\|2772172_2773147_-	porphobilinogen synthase	NA	NA	NA	NA
WP_029727111.1\|2773143_2773932_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_072692716.1\|2773921_2774866_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_003222575.1\|2774898_2775729_-	protein HemX	NA	NA	NA	NA
WP_004399038.1\|2775736_2777104_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_014477563.1\|2777333_2777831_+	hypothetical protein	NA	NA	NA	NA
WP_003229621.1\|2777852_2778440_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_029726365.1\|2778436_2780761_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.6e-182	43.7
WP_029726366.1\|2780941_2782600_-\|protease	ATP-dependent protease LonB	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
WP_003229613.1\|2782753_2784016_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9
WP_015714466.1\|2784287_2785562_-	trigger factor	NA	NA	NA	NA
WP_029726367.1\|2785789_2786794_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_029726368.1\|2786912_2787512_-	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_003229604.1\|2787524_2788943_-	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
WP_004399139.1\|2788992_2790090_-	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
WP_038427818.1\|2790110_2791667_-	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	1.3e-09	38.5
WP_029726371.1\|2791653_2792682_-	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_004399096.1\|2792705_2793224_-	acetolactate synthase small subunit	NA	NA	NA	NA
WP_029726372.1\|2793220_2794945_-	acetolactate synthase large subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	2.2e-61	30.4
WP_029726373.1\|2795760_2796087_+\|coat	inner spore coat protein CotQ	NA	NA	NA	NA

DBSCAN-SWA_9

3358731 : 3366466

Organic_Lake_phycodnavirus(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038427914.1\|3358731_3359412_-\|holin	choline ABC transporter permease OpuBD	NA	NA	NA	NA
WP_038427915.1\|3359428_3360349_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003228370.1\|3360360_3361014_-\|holin	choline ABC transporter permease OpuBB	NA	NA	NA	NA
WP_038427916.1\|3361030_3362176_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	6.0e-15	32.3
WP_014478002.1\|3362459_3362993_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_038427917.1\|3363024_3363699_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCD	NA	NA	NA	NA
WP_072692820.1\|3363716_3364628_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_038427919.1\|3364647_3365301_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCB	NA	NA	NA	NA
WP_003243370.1\|3365323_3366466_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.2e-12	29.3

DBSCAN-SWA_10

3740217 : 3763730

Staphylococcus_phage(66.67%)

protease,tRNA,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038427988.1\|3740217_3741888_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_003243604.1\|3741884_3742313_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003222002.1\|3742625_3742757_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
WP_010886632.1\|3742713_3742866_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
WP_038427989.1\|3742890_3744237_+	subtilosin maturase AlbA	NA	NA	NA	NA
WP_003222006.1\|3744249_3744411_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
WP_029726076.1\|3744407_3745127_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.6e-19	27.2
WP_038427990.1\|3745119_3746430_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
WP_072692833.1\|3746419_3747580_+	insulinase family protein	NA	NA	NA	NA
WP_003227558.1\|3747584_3748865_+	insulinase family protein	NA	NA	NA	NA
WP_038427991.1\|3748861_3749563_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbG	NA	NA	NA	NA
WP_038427992.1\|3749568_3750942_-	YncE family protein	NA	NA	NA	NA
WP_038427993.1\|3750984_3752340_-	YncE family protein	NA	NA	NA	NA
WP_009968328.1\|3752336_3752567_-	hypothetical protein	NA	NA	NA	NA
WP_029318693.1\|3752569_3753715_+	response regulator aspartate phosphatase RapF	A0A1P8CWN8	Bacillus_phage	1.4e-77	43.0
WP_009968329.1\|3753698_3753818_+	phosphatase RapF inhibitor PhrF	NA	NA	NA	NA
WP_038427994.1\|3754070_3754550_+	hypothetical protein	NA	NA	NA	NA
WP_015714893.1\|3754698_3755487_+	membrane protein	NA	NA	NA	NA
WP_015714894.1\|3755473_3756148_+	hypothetical protein	NA	NA	NA	NA
WP_038427995.1\|3756148_3756955_+	hypothetical protein	NA	NA	NA	NA
WP_015714896.1\|3756957_3757605_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.7e-28	40.0
WP_015714897.1\|3757597_3758158_+	hypothetical protein	NA	NA	NA	NA
WP_003227545.1\|3758206_3759079_-	agmatinase	NA	NA	NA	NA
WP_003227543.1\|3759139_3759970_-	spermidine synthase	NA	NA	NA	NA
WP_038427996.1\|3760170_3762246_+	penicillin-binding protein	NA	NA	NA	NA
WP_015250981.1\|3762538_3763057_-	hypothetical protein	NA	NA	NA	NA
WP_003243167.1\|3763070_3763730_-\|protease	site-2 protease family protein	NA	NA	NA	NA

DBSCAN-SWA_11

3793342 : 3842371

Enterobacteria_phage(25.0%)

coat,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014481242.1\|3793342_3793798_-\|coat	spore coat polysaccharide biosynthesis protein SpsL	NA	NA	NA	NA
WP_015250965.1\|3793790_3794642_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	3.7e-38	38.9
WP_003244201.1\|3794655_3795603_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.4e-72	43.8
WP_014478328.1\|3795602_3796343_-	NTP transferase domain-containing protein	I7I009	Enterobacteria_phage	4.5e-48	41.9
WP_038428003.1\|3796367_3797387_-\|coat	spore coat protein	NA	NA	NA	NA
WP_038428004.1\|3797389_3798112_-\|coat	spore coat protein	NA	NA	NA	NA
WP_029726215.1\|3798104_3799226_-\|coat	spore coat biosynthesis protein SpsE	NA	NA	NA	NA
WP_029726214.1\|3799225_3800095_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014481249.1\|3800095_3801265_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	1.2e-15	28.1
WP_029726213.1\|3801285_3802710_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_015250957.1\|3802714_3803485_-	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	3.4e-06	28.6
WP_015714913.1\|3803477_3803657_-	hypothetical protein	NA	NA	NA	NA
WP_014481253.1\|3803804_3804350_+\|coat	spore coat protein GerQ	NA	NA	NA	NA
WP_003227446.1\|3804393_3804765_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_029726212.1\|3804826_3806149_-	purine permease	NA	NA	NA	NA
WP_029726211.1\|3806168_3806486_-	YwdI family protein	NA	NA	NA	NA
WP_029726210.1\|3806653_3808024_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_014478341.1\|3808048_3808726_-	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	1.8e-48	45.7
WP_015250953.1\|3808738_3809545_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_014665830.1\|3809735_3810551_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003243437.1\|3810641_3810890_-	hypothetical protein	NA	NA	NA	NA
WP_029726209.1\|3810983_3812423_-	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	3.1e-21	26.4
WP_029726208.1\|3812419_3813805_-	PTS system sucrose transporter subunit IIBC	NA	NA	NA	NA
WP_014481261.1\|3814106_3814877_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_003227423.1\|3814915_3815746_-	sac operon transcriptional antiterminator SacT	NA	NA	NA	NA
WP_003222155.1\|3815785_3816088_-	hypothetical protein	NA	NA	NA	NA
WP_029726207.1\|3816617_3819038_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	5.3e-21	38.2
WP_029726206.1\|3819075_3820077_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_014478349.1\|3820250_3821000_-	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
WP_015250943.1\|3821106_3822288_-	cell shape-determining peptidoglycan glycosyltransferase RodA	NA	NA	NA	NA
WP_003227411.1\|3822784_3823048_+	spore morphogenesis/germination protein YwcE	NA	NA	NA	NA
WP_003227410.1\|3823089_3823464_-	cytochrome aa3 quinol oxidase subunit IV	NA	NA	NA	NA
WP_003227409.1\|3823465_3824080_-	Quinol oxidase subunit 3	NA	NA	NA	NA
WP_003227407.1\|3824093_3826043_-	cytochrome aa3 quinol oxidase subunit I	NA	NA	NA	NA
WP_010886637.1\|3826070_3827036_-	cytochrome aa3 quinol oxidase subunit II	NA	NA	NA	NA
WP_009968363.1\|3827551_3827797_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_038428006.1\|3827867_3829409_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_015250940.1\|3829412_3830585_-	galactokinase	NA	NA	NA	NA
WP_029726203.1\|3830667_3831051_-	GtrA family protein	NA	NA	NA	NA
WP_014478350.1\|3831068_3831740_-	transcriptional regulator SlrC	NA	NA	NA	NA
WP_003243648.1\|3832094_3832253_+	transcriptional regulator SlrA	NA	NA	NA	NA
WP_029726202.1\|3832695_3833004_+	DUF485 domain-containing protein	NA	NA	NA	NA
WP_029726201.1\|3833000_3834542_+	cation acetate symporter	NA	NA	NA	NA
WP_029726200.1\|3834572_3835175_-	DsbA family protein	NA	NA	NA	NA
WP_029318658.1\|3835457_3836708_-	deferrochelatase/peroxidase EfeB	NA	NA	NA	NA
WP_029726199.1\|3836726_3837884_-	iron uptake system lipoprotein EfeM	NA	NA	NA	NA
WP_029726198.1\|3837880_3839326_-	ferrous ion permease EfeU	NA	NA	NA	NA
WP_015250933.1\|3839482_3840151_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_029726196.1\|3840147_3840966_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_015250931.1\|3840973_3841879_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003227375.1\|3841984_3842371_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP044498

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection