CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP043857	Arcobacter cibarius strain H743 chromosome, complete genome	0 crisprs	cas4,DEDDh,PrimPol,WYL,csa3,c2c10_CAS-V-U3,RT,cas3	0	0	5	0
NZ_CP043858	Arcobacter cibarius strain H743 plasmid pACIB, complete sequence	1 crisprs	RT,WYL,PrimPol	0	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

196806 : 210415

Clostridioides_phage(12.5%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151028827.1\|196806_197526_-	hypothetical protein	A0A1V0DZX6	Clostridioides_phage	2.1e-13	41.4
WP_138108191.1\|197538_198132_-	peptidase P60	A0A2P0ZLG0	Lactobacillus_phage	1.6e-08	40.4
WP_024775648.1\|198249_198804_+	hypothetical protein	NA	NA	NA	NA
WP_024775649.1\|198813_199530_+	SIMPL domain-containing protein	NA	NA	NA	NA
WP_024775650.1\|199536_200016_-	hypothetical protein	NA	NA	NA	NA
WP_151028828.1\|200025_202581_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	3.9e-75	36.4
WP_024775652.1\|202768_203086_+	thioredoxin	A0A0K2FIM3	Achromobacter_phage	2.6e-13	37.6
WP_024775653.1\|203284_204214_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	1.4e-54	42.3
WP_024775654.1\|204217_204991_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_024775655.1\|205004_206351_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.1e-55	33.7
WP_024775656.1\|206350_207316_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	3.6e-13	30.8
WP_024775657.1\|207348_208245_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_151028829.1\|208360_210415_+	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	4.5e-106	37.3

DBSCAN-SWA_2

230095 : 237025

Campylobacter_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024775678.1\|230095_231088_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	5.5e-33	35.1
WP_024775679.1\|231197_231542_+	histidine triad nucleotide-binding protein	NA	NA	NA	NA
WP_024775680.1\|231562_232498_-	acetyl-CoA carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
WP_024775681.1\|232545_233805_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_024775682.1\|233931_234162_-	acyl carrier protein	M4QDG5	Prochlorococcus_phage	1.2e-07	66.0
WP_024775683.1\|234255_234999_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	9.8e-19	30.2
WP_024775684.1\|235057_235822_-	7-carboxy-7-deazaguanine synthase QueE	D5GV09	Campylobacter_virus	7.4e-54	44.8
WP_024775685.1\|235808_236336_-	6-carboxytetrahydropterin synthase	D5GVR0	Campylobacter_virus	1.0e-41	48.1
WP_151028832.1\|236335_237025_-	7-cyano-7-deazaguanine synthase QueC	A0A0E3JPW6	Enterobacteria_phage	2.2e-28	34.2

DBSCAN-SWA_3

480362 : 597998

108

Leptospira_phage(18.52%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024774822.1\|480362_481295_+\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
WP_138108859.1\|481373_482195_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_138108860.1\|482191_484252_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	H8ZJI5	Ostreococcus_tauri_virus	3.7e-100	40.0
WP_138108861.1\|484306_485341_-	AI-2E family transporter	NA	NA	NA	NA
WP_138108862.1\|485337_486366_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	1.8e-07	31.7
WP_138108863.1\|486365_487175_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	1.0e-37	32.7
WP_138154245.1\|487278_488019_+	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_138108865.1\|488019_488757_+	arginyltransferase	NA	NA	NA	NA
WP_138108866.1\|488833_489187_+	hypothetical protein	NA	NA	NA	NA
WP_138108867.1\|489191_491102_-	ferrous iron transport protein B	NA	NA	NA	NA
WP_138108868.1\|491091_491319_-	ferrous iron transport protein A	NA	NA	NA	NA
WP_024774833.1\|491462_491903_+	transcriptional repressor	NA	NA	NA	NA
WP_024774834.1\|491953_492451_-	transglycosylase SLT domain-containing protein	A0A0H4ISW9	Pseudoalteromonas_phage	4.1e-13	31.7
WP_138108869.1\|492527_493244_-	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_138108870.1\|493313_493991_+	response regulator transcription factor	NA	NA	NA	NA
WP_138108871.1\|493980_495300_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_151028899.1\|495313_495802_-	hypothetical protein	NA	NA	NA	NA
WP_151028900.1\|495832_497443_-\|transposase	IS1634 family transposase	NA	NA	NA	NA
WP_034218488.1\|498518_499148_+	hypothetical protein	NA	NA	NA	NA
WP_151028901.1\|499196_500453_+	diguanylate cyclase	G3MA91	Bacillus_virus	1.0e-12	35.9
WP_151028902.1\|500449_500863_+	NUDIX domain-containing protein	A0A0X8WP26	Ralstonia_phage	4.1e-06	34.7
WP_151028903.1\|500831_501533_-	serine/threonine protein phosphatase	A0A0A0YWI7	Pseudomonas_phage	5.3e-06	33.3
WP_151028904.1\|501545_501932_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_151028905.1\|501928_502555_-	hypothetical protein	NA	NA	NA	NA
WP_151028906.1\|502953_503184_-	hypothetical protein	NA	NA	NA	NA
WP_138109187.1\|503334_503769_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_138109186.1\|503769_504474_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_151028907.1\|504637_506578_+	EAL domain-containing protein	NA	NA	NA	NA
WP_151028908.1\|507303_507576_+	hypothetical protein	NA	NA	NA	NA
WP_151028909.1\|507674_508685_+\|transposase	transposase	NA	NA	NA	NA
WP_151028910.1\|508760_509963_+	saccharopine dehydrogenase family protein	NA	NA	NA	NA
WP_151029426.1\|509964_511113_+	carboxynorspermidine decarboxylase	NA	NA	NA	NA
WP_024774848.1\|511133_512084_+	polyphosphate kinase 2	NA	NA	NA	NA
WP_138109182.1\|512080_513229_+	polyphosphate kinase 2	NA	NA	NA	NA
WP_138109181.1\|513329_514631_+	trigger factor	NA	NA	NA	NA
WP_024774851.1\|514645_515230_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.0e-55	57.1
WP_024774852.1\|515239_515755_+	peptide deformylase	NA	NA	NA	NA
WP_024774853.1\|515763_516138_-	hypothetical protein	NA	NA	NA	NA
WP_151028911.1\|516251_516608_+	hypothetical protein	NA	NA	NA	NA
WP_151028912.1\|516561_517605_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.3e-36	30.4
WP_151028913.1\|517982_518342_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	2.1e-14	47.0
WP_151028914.1\|518352_519645_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_151028915.1\|519645_520425_+	hypothetical protein	NA	NA	NA	NA
WP_151028916.1\|520463_520838_+	ATP-binding protein	NA	NA	NA	NA
WP_151028914.1\|521032_522325_+\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_151028917.1\|522328_522622_+	hypothetical protein	NA	NA	NA	NA
WP_138109232.1\|522618_522852_+	hypothetical protein	NA	NA	NA	NA
WP_138109231.1\|523100_524654_+	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	4.8e-07	25.3
WP_138109230.1\|524687_525014_+	thioredoxin family protein	NA	NA	NA	NA
WP_138109229.1\|525013_525433_+	heme-binding domain-containing protein	NA	NA	NA	NA
WP_151028918.1\|525897_530928_-	hypothetical protein	NA	NA	NA	NA
WP_151028919.1\|530927_531596_-	hypothetical protein	NA	NA	NA	NA
WP_151028920.1\|532515_533331_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	8.2e-59	47.7
WP_151028921.1\|533318_534431_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	2.5e-58	42.2
WP_151028922.1\|534592_535792_+\|transposase	transposase	NA	NA	NA	NA
WP_118917911.1\|535992_536268_-	hypothetical protein	NA	NA	NA	NA
WP_118917910.1\|536269_536866_-	hypothetical protein	NA	NA	NA	NA
WP_118917909.1\|537052_540085_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	5.1e-90	26.0
WP_118917908.1\|540088_540787_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_118917907.1\|540783_542028_-	TolC family protein	NA	NA	NA	NA
WP_118917906.1\|542006_542621_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_118917905.1\|542832_544197_+\|transposase	transposase	NA	NA	NA	NA
WP_151028923.1\|544237_544507_+	hypothetical protein	NA	NA	NA	NA
WP_151028924.1\|544484_545411_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_151028925.1\|545646_547110_-	hypothetical protein	NA	NA	NA	NA
WP_046996138.1\|547419_548727_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_151028926.1\|548901_551862_+	DNA mismatch repair protein	A0A1V0SDQ0	Indivirus	6.7e-143	35.7
WP_024774859.1\|551878_552478_+	MarC family protein	NA	NA	NA	NA
WP_151028927.1\|552505_554362_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.1e-23	39.7
WP_138109034.1\|554435_555143_-	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_138109033.1\|555163_555769_-	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_151028928.1\|555802_556375_-	ComF family protein	NA	NA	NA	NA
WP_024774863.1\|556384_558172_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	9.3e-23	24.8
WP_151028929.1\|558291_559350_-	OmpA family protein	NA	NA	NA	NA
WP_151028930.1\|559480_560512_-	OmpA family protein	NA	NA	NA	NA
WP_024774866.1\|560579_561512_-	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	6.3e-47	38.5
WP_151028931.1\|561640_562114_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	3.9e-13	31.7
WP_151028932.1\|562110_563160_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	2.8e-43	32.9
WP_151028933.1\|563199_563826_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_138109030.1\|564006_565167_+	Opr family porin	NA	NA	NA	NA
WP_138109029.1\|565191_566232_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_138109028.1\|566243_567347_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_138109027.1\|567394_567880_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_151028934.1\|567952_568978_-	M24 family metallopeptidase	NA	NA	NA	NA
WP_138109025.1\|569055_569532_+	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_151028935.1\|569537_570761_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_151028936.1\|570753_571641_+	signal peptide peptidase SppA	A0A0K2FHL6	Achromobacter_phage	2.3e-14	31.0
WP_151028937.1\|571675_572878_-	acetate/propionate family kinase	NA	NA	NA	NA
WP_151028938.1\|572906_573902_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_138109021.1\|574152_575343_-	acetate kinase	NA	NA	NA	NA
WP_138109020.1\|575446_576637_-	acetate kinase	NA	NA	NA	NA
WP_138109019.1\|576653_577265_-	3'-5' exonuclease	NA	NA	NA	NA
WP_138109018.1\|577257_579099_-	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_138109017.1\|579147_580815_-	cation acetate symporter	NA	NA	NA	NA
WP_024774882.1\|580814_581132_-	DUF485 domain-containing protein	NA	NA	NA	NA
WP_138109016.1\|581365_583015_-	cation acetate symporter	NA	NA	NA	NA
WP_138109015.1\|583014_583383_-	DUF485 domain-containing protein	NA	NA	NA	NA
WP_138109014.1\|583669_584392_+	AAA domain-containing protein	A0A2L0V0F4	Agrobacterium_phage	2.5e-27	41.1
WP_151028939.1\|584360_585410_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.8e-35	28.9
WP_024774885.1\|585548_586163_-	3'-5' exonuclease	A0A0N9SJX9	Paenibacillus_phage	2.3e-05	27.3
WP_151028940.1\|586162_587980_-	CBS domain-containing protein	NA	NA	NA	NA
WP_138109219.1\|587976_589719_-	cation acetate symporter	NA	NA	NA	NA
WP_138109220.1\|589721_589967_-	DUF4212 domain-containing protein	NA	NA	NA	NA
WP_024774889.1\|590040_590703_-	response regulator transcription factor	W8CYM9	Bacillus_phage	6.9e-16	26.8
WP_151028941.1\|590683_592267_-	histidine kinase	NA	NA	NA	NA
WP_138108878.1\|593126_593633_-	CinA family protein	B5TK85	Pseudomonas_phage	2.1e-20	43.2
WP_024774892.1\|593727_595086_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_138108879.1\|595268_597998_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	2.7e-82	28.9

DBSCAN-SWA_4

854026 : 962628

Leptospira_phage(10.53%)

protease,tRNA,integrase,transposase

attL 947340:947358|attR 958678:958696

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151028991.1\|854026_855391_+\|transposase	transposase	NA	NA	NA	NA
WP_024776040.1\|855914_856796_+	DMT family transporter	NA	NA	NA	NA
WP_119184000.1\|856857_857400_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_151028992.1\|857425_857950_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_151028993.1\|858277_859543_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_151028994.1\|860634_861657_+	putative sulfate exporter family transporter	NA	NA	NA	NA
WP_151028995.1\|861683_862424_-	thioredoxin fold domain-containing protein	NA	NA	NA	NA
WP_151028996.1\|862489_862732_-	hypothetical protein	NA	NA	NA	NA
WP_024774266.1\|862912_864130_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.4e-24	25.9
WP_151028997.1\|864332_865025_-	AEC family transporter	NA	NA	NA	NA
WP_024776033.1\|865028_865400_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024776032.1\|865532_866120_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_151028998.1\|866151_867180_+	NADH:flavin oxidoreductase/NADH oxidase	NA	NA	NA	NA
WP_024776030.1\|867214_867850_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_024776029.1\|867971_869465_+	hypothetical protein	NA	NA	NA	NA
WP_151028999.1\|869560_871153_+	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	1.7e-55	26.9
WP_024776027.1\|871196_872153_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_151029000.1\|873639_875250_-\|transposase	IS1634 family transposase	NA	NA	NA	NA
WP_151029001.1\|875561_876986_-	DUF2867 domain-containing protein	NA	NA	NA	NA
WP_024776025.1\|877053_877695_-	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_024776024.1\|877784_878282_-	protein disulfide oxidoreductase	NA	NA	NA	NA
WP_024776023.1\|878274_879936_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_151029002.1\|879932_881504_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_024776021.1\|881496_882219_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_151029003.1\|882215_883568_-	TolC family protein	NA	NA	NA	NA
WP_151029004.1\|883688_885635_-	PAS domain S-box protein	A0A1B0V854	Salmonella_phage	4.6e-15	41.4
WP_119184001.1\|885642_886308_-	flagellar type III secretion system pore protein FliP	NA	NA	NA	NA
WP_024776017.1\|886413_888192_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_024776016.1\|888188_888629_-	hypothetical protein	NA	NA	NA	NA
WP_024776015.1\|888694_888973_-	hypothetical protein	NA	NA	NA	NA
WP_151029005.1\|888975_891348_-	hypothetical protein	NA	NA	NA	NA
WP_151029006.1\|891350_892862_-	PAS domain S-box protein	NA	NA	NA	NA
WP_151029007.1\|892899_893925_-	alanine racemase	NA	NA	NA	NA
WP_151029008.1\|893938_895768_-	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_151029429.1\|895812_896394_-	nicotinamide mononucleotide transporter	NA	NA	NA	NA
WP_151029009.1\|897471_900609_-	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.7e-59	22.1
WP_151029010.1\|900610_901648_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_024776007.1\|901644_902880_-	TolC family protein	NA	NA	NA	NA
WP_024776006.1\|902979_903462_+	winged helix DNA-binding protein	NA	NA	NA	NA
WP_084031371.1\|903539_903731_+	hypothetical protein	NA	NA	NA	NA
WP_151029011.1\|904041_904776_-\|transposase	transposase	NA	NA	NA	NA
WP_151029012.1\|904872_905400_-	hypothetical protein	NA	NA	NA	NA
WP_151029013.1\|905543_906251_+	pirin family protein	NA	NA	NA	NA
WP_151029014.1\|906281_908093_-	HAMP domain-containing histidine kinase	B5LWN0	Feldmannia_species_virus	5.2e-05	25.5
WP_024775348.1\|908076_908742_-	response regulator transcription factor	NA	NA	NA	NA
WP_024775349.1\|909091_909733_+	MarC family NAAT transporter	NA	NA	NA	NA
WP_151029015.1\|909866_910058_+	YwbE family protein	NA	NA	NA	NA
WP_151029016.1\|910352_911930_+	HD domain-containing protein	NA	NA	NA	NA
WP_151029017.1\|912634_913876_+	AAA family ATPase	NA	NA	NA	NA
WP_151029018.1\|913851_916086_+	DEAD/DEAH box helicase family protein	M1H9V5	Acanthocystis_turfacea_Chlorella_virus	1.1e-20	25.4
WP_151029430.1\|916082_916640_-	recombinase family protein	A0A219YA40	Aeromonas_phage	1.1e-38	47.5
WP_151029019.1\|917015_917681_+	response regulator	NA	NA	NA	NA
WP_151029020.1\|917677_919039_+	hypothetical protein	NA	NA	NA	NA
WP_151029021.1\|919123_919489_+	YgiW/YdeI family stress tolerance OB fold protein	A0A1I9LJU6	Stx_converting_phage	2.8e-19	42.4
WP_151029022.1\|919670_920375_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_151029431.1\|920337_920592_+\|transposase	transposase	A0A218MNI5	uncultured_virus	1.1e-22	74.3
WP_151029023.1\|920659_922708_+	TonB-dependent receptor	NA	NA	NA	NA
WP_081560798.1\|922759_923248_-	hypothetical protein	NA	NA	NA	NA
WP_081560796.1\|923356_923785_-	hypothetical protein	NA	NA	NA	NA
WP_138109169.1\|923881_925042_-	hypothetical protein	NA	NA	NA	NA
WP_151029024.1\|925240_926215_+	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
WP_129076045.1\|926261_927758_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.4e-197	73.0
WP_151029025.1\|928190_928751_+	recombinase family protein	A0A0C4UR34	Shigella_phage	8.4e-39	48.0
WP_151029026.1\|930648_931668_-	hypothetical protein	NA	NA	NA	NA
WP_151029027.1\|931805_932180_-\|transposase	transposase	S5VXX4	Leptospira_phage	2.1e-09	31.4
WP_081560932.1\|932292_933045_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.1e-24	28.3
WP_151029028.1\|933075_934641_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.8e-84	38.3
WP_151029029.1\|934807_935509_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_151029030.1\|935893_936487_+	hypothetical protein	NA	NA	NA	NA
WP_151029031.1\|936519_937284_-	hypothetical protein	NA	NA	NA	NA
WP_151029032.1\|937402_938029_-	hypothetical protein	NA	NA	NA	NA
WP_151029033.1\|938148_939072_+	WYL domain-containing protein	NA	NA	NA	NA
WP_151029034.1\|939746_941003_+	AAA family ATPase	A0A2I7RNF1	Vibrio_phage	1.3e-07	29.3
WP_151029035.1\|940995_941493_+	hypothetical protein	NA	NA	NA	NA
WP_151029036.1\|941587_942301_-	hypothetical protein	NA	NA	NA	NA
WP_151029037.1\|942331_942658_-	bacteriophage CI repressor	NA	NA	NA	NA
WP_151029038.1\|942930_943326_+	hypothetical protein	NA	NA	NA	NA
WP_151029039.1\|943390_943621_+	hypothetical protein	NA	NA	NA	NA
WP_151029040.1\|944033_945893_+	hypothetical protein	NA	NA	NA	NA
WP_151029041.1\|945889_947359_+	hypothetical protein	NA	NA	NA	NA
947340:947358	attL	NA	NA	NA	NA
WP_151029042.1\|947358_947799_+	hypothetical protein	NA	NA	NA	NA
WP_151029043.1\|947798_948929_+	hypothetical protein	NA	NA	NA	NA
WP_151029044.1\|948941_949742_+	hypothetical protein	NA	NA	NA	NA
WP_151029045.1\|949738_950935_+	hypothetical protein	O80264	Vibrio_phage	1.5e-16	24.4
WP_151029046.1\|950931_952050_+	phosphoadenosine phosphosulfate reductase family protein	Q8W6P3	Burkholderia_virus	4.9e-06	25.4
WP_151029047.1\|952382_953729_+	replication endonuclease	NA	NA	NA	NA
WP_151029048.1\|953738_954074_+	hypothetical protein	NA	NA	NA	NA
WP_151029049.1\|954070_955228_+\|integrase	tyrosine-type recombinase/integrase	A0A1S5RFM8	Helicobacter_phage	5.1e-30	30.5
WP_024775352.1\|955268_955634_+	YbgC/FadM family acyl-CoA thioesterase	NA	NA	NA	NA
WP_024775353.1\|955636_956104_+	DUF1669 domain-containing protein	NA	NA	NA	NA
WP_151029050.1\|956137_957355_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_024775355.1\|957351_958527_+	DNA recombination protein RmuC	NA	NA	NA	NA
WP_151029051.1\|958523_959414_+	hypothetical protein	NA	NA	NA	NA
958678:958696	attR	NA	NA	NA	NA
WP_151029052.1\|959423_960317_-	EamA family transporter	NA	NA	NA	NA
WP_024775358.1\|960316_961534_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_024775359.1\|961533_961734_-	hypothetical protein	NA	NA	NA	NA
WP_024775360.1\|961845_962628_+\|tRNA	tRNA 2-thiocytidine biosynthesis protein TtcA	A0A0U2S5Z2	Escherichia_phage	1.5e-38	35.8

DBSCAN-SWA_5

1117814 : 1155267

Acidithiobacillus_phage(25.0%)

tRNA,integrase,transposase

attL 1144829:1144874|attR 1156257:1156302

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151028914.1\|1117814_1119107_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_151029093.1\|1121042_1121858_+	aldo/keto reductase	NA	NA	NA	NA
WP_024775059.1\|1121843_1123460_-	adenine deaminase	NA	NA	NA	NA
WP_024775060.1\|1123646_1124048_+	Sec-independent protein translocase subunit TatB	NA	NA	NA	NA
WP_024775061.1\|1124047_1124779_+	twin-arginine translocase subunit TatC	NA	NA	NA	NA
WP_024775062.1\|1124780_1125803_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_024775063.1\|1125815_1126559_+	3'-5' exonuclease	NA	NA	NA	NA
WP_151029094.1\|1127144_1128512_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	2.7e-30	34.4
WP_151029095.1\|1128921_1130211_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_119183989.1\|1130479_1131448_+	hypothetical protein	NA	NA	NA	NA
WP_024775066.1\|1131541_1132834_+	(Fe-S)-binding protein	NA	NA	NA	NA
WP_024775067.1\|1132835_1133651_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_024775068.1\|1133679_1133889_-	hypothetical protein	NA	NA	NA	NA
WP_024775069.1\|1133913_1134603_-	response regulator transcription factor	NA	NA	NA	NA
WP_024775070.1\|1134702_1137387_-	DNA polymerase I	A0A218MKQ4	uncultured_virus	1.4e-70	31.6
WP_024775071.1\|1137626_1139513_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.9e-22	37.3
WP_024775072.1\|1139596_1139995_+	hypothetical protein	NA	NA	NA	NA
WP_024775073.1\|1140078_1140804_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_024775074.1\|1140808_1142104_+	hypothetical protein	NA	NA	NA	NA
WP_024775075.1\|1142116_1142401_-	hypothetical protein	NA	NA	NA	NA
WP_151029096.1\|1142393_1143299_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_024775077.1\|1143355_1143934_+	hypothetical protein	NA	NA	NA	NA
WP_024775078.1\|1144038_1144314_+	HU family DNA-binding protein	NA	NA	NA	NA
WP_151029434.1\|1144652_1144763_-	hypothetical protein	NA	NA	NA	NA
1144829:1144874	attL	NA	NA	NA	NA
WP_024775084.1\|1145020_1146121_+\|integrase	site-specific integrase	A0A059WLJ1	Vibrio_phage	1.1e-39	33.0
WP_024775085.1\|1146236_1146467_+	hypothetical protein	NA	NA	NA	NA
WP_024775086.1\|1146453_1146744_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_151029097.1\|1147012_1148089_-	diguanylate cyclase	NA	NA	NA	NA
WP_151029098.1\|1148183_1149542_-\|transposase	transposase	NA	NA	NA	NA
WP_024775088.1\|1151965_1152307_+	hypothetical protein	NA	NA	NA	NA
WP_138154275.1\|1152299_1152710_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_151029099.1\|1152901_1153180_+	hypothetical protein	NA	NA	NA	NA
WP_046996138.1\|1153959_1155267_+\|transposase	IS1380 family transposase	NA	NA	NA	NA
1156257:1156302	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP043858

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP043858_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043858_1

39345-39461

Orphan

Consensus_repeat	Method
TACAAAATTTTGAGTTTTCATCTAAAGTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043858_1

>merge|NZ_CP043858|1|39345-39461|CRISPRCasFinder
TACAAAATTTTGAGTTTTCATCTAAAGTTGTACCACATTTTGTACAAGTAATTAAAACTTCTTTTTTTACTTCTGTTCCACAAGAATTACAAAATTTTGAGTTTTCATCTAAAGTTG

>NZ_CP043858|1|1|39345-39461|CRISPRCasFinder
TACAAAATTTTGAGTTTTCATCTAAAGTTG	TACCACATTTTGTACAAGTAATTAAAACTTCTTTTTTTACTTCTGTTCCACAAGAAT
TACAAAATTTTGAGTTTTCATCTAAAGTTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043858.1\|WP_151029468.1\|38407_39226_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043858.1\|WP_024774266.1\|34774_35992_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564
NZ_CP043858.1\|WP_151029465.1\|36242_36719_+\|DUF805-domain-containing-protein	unknown	unknown	gnl\|CDD\|377540
NZ_CP043858.1\|WP_151029471.1\|42591_42828_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043858.1\|WP_151029461.1\|31302_32373_-\|transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP043858.1\|WP_151029187.1\|32206_33256_+\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|315923
NZ_CP043858.1\|WP_151029463.1\|33547_33820_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043858.1\|WP_138154355.1\|53508_54663_+\|FMNH2-dependent-alkanesulfonate-monooxygenase	unknown	unknown	gnl\|CDD\|234821
NZ_CP043858.1\|WP_151029473.1\|46466_48074_+\|IS1634-family-transposase	unknown	unknown	gnl\|CDD\|227708
NZ_CP043858.1\|WP_151029474.1\|48314_51818_-\|DEAD/DEAH-box-helicase-family-protein	unknown	unknown	gnl\|CDD\|223627
NZ_CP043858.1\|WP_138154354.1\|54662_55433_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|183100
NZ_CP043858.1\|WP_151029472.1\|42862_43912_+\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|315923
NZ_CP043858.1\|WP_024774781.1\|44393_45683_+\|IS1380-family-transposase	unknown	unknown	gnl\|CDD\|379340
NZ_CP043858.1\|WP_024776243.1\|55429_56185_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|183055
NZ_CP043858.1\|WP_151029475.1\|52524_53493_+\|aliphatic-sulfonate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270275
NZ_CP043858.1\|WP_151029466.1\|36723_37119_+\|SHOCT-domain-containing-protein	unknown	unknown	gnl\|CDD\|378276
NZ_CP043858.1\|WP_151029467.1\|37302_38085_-\|NYN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350237
NZ_CP043858.1\|WP_151029470.1\|40842_42375_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586
NZ_CP043858.1\|WP_151029464.1\|34111_34597_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043858.1\|WP_151029462.1\|33248_33449_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP043858.1\|WP_024774266.1\|34774_35992_-\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	9.01832e-24
NZ_CP043858.1\|WP_151029465.1\|36242_36719_+\|DUF805-domain-containing-protein	gnl\|CDD\|377540	pfam05656, DUF805, Protein of unknown function (DUF805). This family consists of several bacterial proteins of unknown function.	3.73529e-37
NZ_CP043858.1\|WP_151029461.1\|31302_32373_-\|transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	7.80392e-07
NZ_CP043858.1\|WP_151029187.1\|32206_33256_+\|IS630-family-transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.26916e-33
NZ_CP043858.1\|WP_151029473.1\|46466_48074_+\|IS1634-family-transposase	gnl\|CDD\|227708	COG5421, COG5421, Transposase [DNA replication, recombination, and repair].	1.07259e-24
NZ_CP043858.1\|WP_138154354.1\|54662_55433_+\|ABC-transporter-permease-subunit	gnl\|CDD\|183100	PRK11365, ssuC, aliphatic sulfonate ABC transporter permease SsuC.	1.02119e-97
NZ_CP043858.1\|WP_151029472.1\|42862_43912_+\|IS630-family-transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.15092e-32
NZ_CP043858.1\|WP_024774781.1\|44393_45683_+\|IS1380-family-transposase	gnl\|CDD\|379340	pfam13701, DDE_Tnp_1_4, Transposase DDE domain group 1. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	3.82559e-38
NZ_CP043858.1\|WP_024776243.1\|55429_56185_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|183055	PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional.	3.53358e-125
NZ_CP043858.1\|WP_151029475.1\|52524_53493_+\|aliphatic-sulfonate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270275	cd13557, PBP2_SsuA, Substrate binding domain of sulfonate binding protein, a member of the type 2 periplasmic binding fold superfamily. This subfamily includes the sulfonate binding domains SsuA found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBPII superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	7.25358e-142
NZ_CP043858.1\|WP_151029466.1\|36723_37119_+\|SHOCT-domain-containing-protein	gnl\|CDD\|378276	pfam09851, SHOCT, Short C-terminal domain.	7.70151e-06
NZ_CP043858.1\|WP_151029467.1\|37302_38085_-\|NYN-domain-containing-protein	gnl\|CDD\|350237	cd11297, PIN_LabA-like_N_1, uncharacterized subfamily of N-terminal LabA-like PIN domains. This N-terminal LabA-like PIN domain is found in a well conserved group of mainly bacterial proteins with no defined function, which contain a C-terminal LabA_like_C domain. LabA from Synechococcus elongatus PCC 7942, (which does not contain this C-terminal domain), has been shown to play a role in cyanobacterial circadian timing. The LabA-like C-terminal domains characteristic of this subfamily may be related to the LOTUS domain family (which also co-occurs with LabA-like N-terminal domains). The function of the N-terminal domain is unknown. The LabA-like PIN domain family also includes the N-terminal domain of limkain b1, a human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Other members are the LabA-like PIN domains of human ZNF451, uncharacterized Bacillus subtilis YqxD and Escherichia coli YaiI. Curiously, a gene labeled NicB from Pseudomonas putida S16, which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls into the LabA-like PIN family. The PIN (PilT N terminus) domain belongs to a large nuclease superfamily. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	7.58508e-57
NZ_CP043858.1\|WP_151029470.1\|40842_42375_-\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	1.02145e-27
NZ_CP043858.1\|WP_151029474.1\|48314_51818_-\|DEAD/DEAH-box-helicase-family-protein	gnl\|CDD\|223627	COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair].	2.14793e-91
NZ_CP043858.1\|WP_138154355.1\|53508_54663_+\|FMNH2-dependent-alkanesulfonate-monooxygenase	gnl\|CDD\|234821	PRK00719, PRK00719, alkanesulfonate monooxygenase; Provisional.	0

>NZ_CP043858.1|WP_151029468.1|38407_39226_-|hypothetical-protein
MKILKYFVFLGLSFIYLSANSSCYDIYKSESKPDAKINKAIFVLIDETTFFNANLQEQILKNSIKYIEPGNYIYVAKFSAFIGNHYNEKVFDFNVDKPLDEKQRYNERKDSLKKIDKCLKDQIGFAKAQTIDNIKKSFLKPDENIAKSDIFYALEDFGKNVISQIEADEKIVILASDLLENSTISSFYSKGTTRLIDSKKELQIVEKNNLFSDFGNSSLYVIGTGIVTGENSKTYRDPKILMSLKSFWEEYFKNSNANLVELGQPALKNDLK
>NZ_CP043858.1|WP_151029467.1|37302_38085_-|NYN-domain-containing-protein
MENNQQRNVAMFIDCDNVSAKYIDSIFKDLSQYGRITIRKAYGDWSNRHLQGWENVLLDYNIQPYQQFAYTNNKNASDIAIVIDVMDSIYTKDIDIIALVTSDSDFTPLVARVLSDAKTVFGYGEQKTPDSLVKACSQFIYVEKFIQLQEKNQVFDNTNENKHDFKNSYKGSDYDAKKDYHLKKSLLNAVEQVSGDTGWADLKDVSLYIRRNSSFSPINHGFNKLGALIKYLDIFEVKYTNDNLTMLVKPSKKGLDMYID
>NZ_CP043858.1|WP_151029466.1|36723_37119_+|SHOCT-domain-containing-protein
MSLEILEKIEKLSELKDKGILTQEEFENKKRYLLDENNNNNEMSFTKKTEGTNWLPIPSFIFGLLAFLASFDESEWNMDEKIGVLFFISIAFILGFISISIQNNGKALSIAGIVLSILASLAILDRFEYIN
>NZ_CP043858.1|WP_151029465.1|36242_36719_+|DUF805-domain-containing-protein
MNYFLYCLKNYATFSGRATRSEYWYFTLISVLISIIITLFDVMIGTYDDVSGFGMFSSIFSLALFIPSLAVLVRRLHDTNRSGWWFFIVLIPIIGIIVLIVFLCLDSKEDNKYGINQKKNSSFFNNNSFSELEKLSELKDKGILTQEEFDRKKKEILG
>NZ_CP043858.1|WP_024774266.1|34774_35992_-|IS110-family-transposase
MYYVGVDIAKDKHYVCILDDAKELACKPFWIYSDILGLRELLKRLAELSLDMNDFIIGIESTGAFSENFYSYITDADYKVILLNSYQTSKYRDFSTLKKIKNDSIDAYVIAELLASGKYKASYISNEDYHNLKVLNRLKKSLDDKIKTIKREITTVVATVNPEIEKVFPNIFTKTAIAIIKSYPTAMDISKATPEKLTKIFRHIKGNSFNLEKAKYLIELAKSSIYTGRANESRALMIKTNIKILELYIQERDEVEEQIQILIDNQLDDDSSNIENLKSIPGVSNKTVTAILGECGDLRRFESAKAFIGFLGLYPTLYQSGKSLSTGTLAKRGIPIAKHALYMAAVSAVRHNNELHKLFRDKVSSGKSKKEALIIIAKKLASIIYSLFKYNQAYNPYRVLIQHKK
>NZ_CP043858.1|WP_151029464.1|34111_34597_+|hypothetical-protein
MKKSFILGGILSCLPLFAGNGEDTVFAAFGLVVVAFIVMFAITIFFLISQSSFAKSMRLKNRDKETSSIWIWTQLIPIWNFIAIPVTLIKLNEQFNTYILENNLLNSSTIKSYNNTWGWVWYIGSVVSIFIPFAGLISFIGVIGFWIHISNIRKSLITIRN
>NZ_CP043858.1|WP_151029463.1|33547_33820_-|hypothetical-protein
MGLDNFIQTAMNNVLKNPILSILRDINFSSILKQSNFIKRDIGKSTYLVILHFLYMFVINRKISSFMKYSNDSFLKESASTRKKIYITDF
>NZ_CP043858.1|WP_151029462.1|33248_33449_-|hypothetical-protein
MIIDDTVEIKRGKFIEGSCRNLWNNKEHRTVKGLNIVSLNYSDCYTDMMLDFSIITPPINRVNFIN
>NZ_CP043858.1|WP_151029187.1|32206_33256_+|IS630-family-transposase
MEKLDKNDARKVDSKTLQYLRDRAIKLRESGVSNIETASILGLSKITTSRWYSKYKKDGQKALKVQKTGRPKKSGKRLSDEQESRIISMLIDTTPEQLKFKFALWTREAVKQLILRELDVDMPISTVGDYLAKWQFTSKKPIKRAYERKDSATKAWLEIEYPKIKKEAKINNADVWWADETACVSLPSNLKGYAPIGSKIKPILTHTAKKFKVNMISAITNTGKSMFALYDDSIATDNFIDFLEKVIKSNDKKVFMIVDNLRVHHAKKVKEWEEENKDKIKLFYLPPYSPEFNPDEYLNQDYKSNVHKNGLPKNQKELKENTQNYMESLQKNPQKVANFFLHPSVKYAS
>NZ_CP043858.1|WP_151029461.1|31302_32373_-|transposase
MYLLYHLEVVIFDKPKILAVSILLTPLSLNFIALSRRYCNVFESTFLASFLSNFSIRNCTNNIHNISLIYRWSNNYNKNQIVNVNENYFHHKSNAYKRRVEGNNSKNNLALQMVNRVLKSGIYADYLLVDSWYAKPNFIYEIKEKGLDVIARLSKSNRIWQFTGKYNTLESLYIQTNKTKTLKLGNYNSIKYTYVSTTTTHKTLGRIKIVFIKTKDNLIPIISTNTNLSDIEIINTYKKRWNIEQGYKDLREYFQFGKEENRIYEAIIARITLSFLAYNLTSYINRVQNEPQTLGNLFRDLECQLETLAISMELFLKILEQIIESQEIVKRNKDLEQIIHMLRVYTKKQLGFMCES
>NZ_CP043858.1|WP_151029470.1|40842_42375_-|OmpA-family-protein
MNIKSLGFTKTIAVTTSCILLFGGCAAILEQNAGKIGGTAVGAGVGGVIGKQVGGDTGLAIGALIGGGIGYLIGNEIDKRRENLAKIAKEENIEVVSQNIVENNNQIVSKESNQKIDNKNVIGDSFTVFSNEEQFAINSSSLNKKAEDIFAKISSEYKGSDKKILIIGHTDDSGSSLYNQKLSEDRAKNVGDIFVLNGVKKSNIYYLGAGENNPIANNNLTEGANKNRRVEIVELKDENDIIKYASKTSNPEFFKKVEPKVVTTTKTKTEISKEKTTTSKFTKTIETENIGKIADNDSQGAIEKEKDKIKIVNSSKDIFDFNGRKVIDNNFALKTNFGESIQDSSFSIITKAQANSMTNVYQNCLADKPRAKADVKSLETNKVIYKTIDYKKGLNSVPFVTNLESTLIAINPVAVLENSSSATNFPKASFYKDYKGEKDVKPTLELMTSINTYQGTQGLIYRVFFEESNTQMKCMDIVFDEKNVNNSKGVLYYTKNNQILEKEFEIARIK
>NZ_CP043858.1|WP_151029471.1|42591_42828_+|hypothetical-protein
MGIDNFIQTAMNNVLKNPILSILRDINFSSILKQSNFIKKDIGKSPYMIILHFLYMFVINRKISSFMKYSNDITPPIN
>NZ_CP043858.1|WP_151029472.1|42862_43912_+|IS630-family-transposase
MEKLDKNDARKVDSKTLQYLRDRAIKLRESGVSNIETASILGLSKITTSRWYSKYKKDGQKALKVQKTGRPKKSGKRLSDEQESRIISMLIDTTPEQLKFKFALWTREAVKQLILRELDVDMPISTVGDYLAKWQFTSKKPIKRAYERKDSATKAWLEIEYPKIKKEAKINNADVWWADETACVSLPSNLKGYAPIGSKIKPILTHTAKKFKVNMISAITNTGKSMFALYDDSIATDNFIDFLEKVIKSNDKKVFMIVDNLRVHYAKKVKEWEEENKDKIKLFYLPPYSPEFNPDEYLNQDYKSNVHKNGLPKNQKELKENTQNYMESLQRNPQKVANFFLHPSVKYAS
>NZ_CP043858.1|WP_024774781.1|44393_45683_+|IS1380-family-transposase
MGELKIEYSDKKVTPFGGMKLLKNFIDKTRVIEDLKSVNLPIGFSNRAYDPINIIQGFWLAIFTGASRYIHADWLRYDTTLQTIFEIDKLPSQSTYSRFFHKFNIEKNSEIFPILQQKFLSQLDVGPLTIDLDSTVITRYGEQEGAKKGYNPKKPGRNSHHPIIAFIDQTKMIANTWMRSGNTSSLNNYDAFLNETFDICLKDKKVGLVRADSGFYSQEFLEWFEKRGINYIVAVKFYENIKYTIGNITKWIKITKGLDVASLRFKPDNGSERRYIIVRKLSEEYPKSGGKLLFDEPIYRYSAYVTNIELPVDQIYNIYNTRADCENRIKELKYDFGADNFCLKDFYATEASFRFIMMAYNIMALFKHEVVNSNMMLSTLRSYCFALGSWITEHSNQKVLKISLPQKRRTWMNGLFENVKQSQIPFKYT
>NZ_CP043858.1|WP_151029473.1|46466_48074_+|IS1634-family-transposase
MAVVYQTDKRSGITYAYKSISFWDKDKKQSRSKRTLIGRVDNDTQQIVPTDGRCRKDKQEKVLLKTGPVVAEISSRTFYGATYLFDKIGEKLGITNDLKNSFPDSYKKILSLVYYLILEKDSPSFRFEKWSALHKHPYAKSISSQRSSELFASIKDDAKNRFFTLQAKRKVDKEFWVYDTTSISSYSKTLSQVQYGHNKEHDPLAQINLALVFGESSMLPFYYRKLPGNIPDSKTVKHLLKELDNLGFSKVKLVMDRGFYSQENINALFKAHLKFLLSASLNLSFIRNNLDKVFNSVRSFENYNDKYELYTTTLQTTWEYSESRVYKQDIAKSSKRVYIHYYFNIEKAAEDEKTFDKKLMILKNEIESNNRIKENENLYAKYFIINSTLKKGIKVTLKSEEVAKAKRNYGYFALITNENMDSITALETYRNKDVVEKAFGNLKERLNMRRLLVSSEQSLDGKLFVQFIALIYLSYIKKQMQQNNLFKNYTLESLLDKLDLIECFEYPGKTLQVGEILQKQKDIYRFMGVEPPSSL
>NZ_CP043858.1|WP_151029474.1|48314_51818_-|DEAD/DEAH-box-helicase-family-protein
MAKIKYGQTVAGKKWYESLENNFGLDGRFVRGKSYFSKGYVKKFGFMGNRVFSKVKGTYSNYDVGFSLYTDKHKIEQIISYFTNDLHAQASILNGEISEDFFTWSREKDIDLCLDLKRTVIDFRFKDIPNYEAYCDCYDFYDSNSPCKHILALMFALAQEIDHNPLILLKLNGIEPEMILNTEELDNEVPYPIDISYSEEQKNKNIKPTTHPIEILHYEDMLPFFLSLMQSNTPFAPIDYKEVLKEFYKFNSQKLSQVLTPIHDEDIAKIERVFKESKIEIVADKTLRNNKAIIKHPLFKQGETLYKLLEPYIIDSNSLGCSISILNFTRLFLSFKSDNGGAYYRYFYQLCRIGYLLLNSNGFLPSVIKEKSKSRFFIAWIPFLSSTLNEQFEIMKENMISCVRHSQKGPFFESICGSKMFLASLFSDYVFSLDFMHKRMQKNPPEISLSFFKGNSYTQKGAGKHNTDKAVANAFSIFMLSKNIYTLEAELKLDKNNSYNISFYTHKDGEKELFCDEIKKDNSKELLKLISPITLYLPQIKTLFAKKELTLSKEEFEEFILKNASILNSLGVRITLPRELHNLLKPKLAISAKSNAPINSFLNLSSILEYDWTIAIGEHNLSIEEFKALVKEQGSLIEYKNNFILIDPNEINSLFLKASKKPKLSSLEFLREKFANNLFFDKNLEEFFNNLFKPHSVKIPKNLNSNLREYQKRGFEWGVSNLLNGFGVILADDMGLGKTIQTISIILYLYENKHAKNKSLIVVPTSLLNNWQVELSKFAPTLNYMLYYGQNRVLKDTQLVITTYDTLKRDETLKSEKFDVIVIDEAQKIKNSKTQAALSVKSIKAKYKIALSGTPVENSLTELWSIFDFTLKGYLGEISQFINYYAKPIEIEKNVAVAENLQKITSPFMIRRLKSDKNIINDLPDKIIIDEYASMMPKQAALYQNIVDTTLEKLKNSELKERSGLVFKLITELKQICNHPKNFDKISDAQSELSGKTAMLLELLEPIISRGEKVLIFTQYVQMAQILFEIIEKELLIEPLILDGSLSKKAREEVVSKFETTNEYPIFILSLKAGGVGLNLTSASNVIHYDLWFNPAVENQATDRAFRIGQKRNVFVYRFITKNSFEEKIDNMIKSKLALGEMSVAVGEKNIANMSDEEIKNLMKTDF
>NZ_CP043858.1|WP_151029475.1|52524_53493_+|aliphatic-sulfonate-ABC-transporter-substrate-binding-protein
MKNIIKKVRNIALISLLIPAIGFGKELDKKVEDEVRIGYQKYGTLILLKASGELEKRLAPLGVKVTWSEFPAGPQLLEGLNVGGVDFGTTGETPPIFAQAANAKIKYIGYEPPAPRGEAIVVQSNSSIKTVADLKGKKVVLNKGSNVHYLLVKALEKAGLKYSDVETVFLAPADARAAFERGSVDAWVIWDPFLAAAETSIGAKVIQDGTNTVNNHQFYLAEENYASKRPDVVAAIFDELKKVNDWAVTKLKEVANALAPLTGLDSITLEKALERGGYGINYLNEKVITEQQKIADTFYDLKLIPKKLDIKSVVWQPEQKNK
>NZ_CP043858.1|WP_138154355.1|53508_54663_+|FMNH2-dependent-alkanesulfonate-monooxygenase
MSLNIFWFIPTFGDSRYLGSKIESRVSDFDYVKQVAIAADTLGFDGVLVPTGRSCEDPFVVASSLIGVTQRLKFLVALRPGLLQPALAARISSTLDRFSNGRVAFNLVAGGDKEELEGDGLFQDSEERYEAAAEFIDLWKDILKASYEKNVVNFEGKHYKTVNSKLLYPPVQRPHPPLFFGGSSQKAHELAAQKVDLYITWGETPTAVKAKIEDVKAKAAKYGRTVRFGIRLHIIVRETEAEAWEAAEKLISKLDDEKINASQKALTKLDSEGQRLMSALTNNGKARTREELEISPNLWAGIGLVRGGCATALVGDPQTILKRINEYADLGIDTFVFSGYPHLEESFRVAELLFPLLPGKAKDKLLGHVQSGPFGSVETENGEN
>NZ_CP043858.1|WP_138154354.1|54662_55433_+|ABC-transporter-permease-subunit
MIKNFSKEVAITWLIPVLIILLWQLAVQSGWLSTRIMPAPLDVVNAGINLAKSGELTHHFLASLERAVLGLLIGGSIGFFLGFITGLSKVAQSLLDSTIQMIRNIPLLALVPLVVLWFGIGEVSKIFILSMAVFFPIYLNTFHGLRSVDKDLIEMGKVYGLNRFGLFKEVILPGAMPSILVGLRMSLGYMWLFLVVAETIAANVGIGYMTMNAREFLQTDIMVLGILLYAFLGKSSDVLAGFLERYTLKWHKGYQK
>NZ_CP043858.1|WP_024776243.1|55429_56185_+|ATP-binding-cassette-domain-containing-protein
MSKNLFANNSNGIFIESKNVIKKFENTQVLKELNLTINSGEFVCVVGRSGCGKSTFLRLLAGLEKVSQGEITLDGVKINGVHPDIRIMFQDSRLLPWRTVIENVALGLPKESYDLAIDALKEVGLENKANEWPANLSGGQKQRVALARALVHKPRLLLLDEPLGALDALTRIEMQTLIERIWQEHKFTVLLVTHDVSEAVILGDRVVLIEEGKITLDLEINLSRQRERGSAEFAQLEANILSRVMGTMYYI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP043858_1	1.1\|39375\|57\|NZ_CP043858\|CRISPRCasFinder	39375-39431	57	NZ_CP043858	Arcobacter cibarius strain H743 plasmid pACIB, complete sequence	39375-39431	0	1.0

1. spacer 1.1|39375|57|NZ_CP043858|CRISPRCasFinder matches to NZ_CP043858 (Arcobacter cibarius strain H743 plasmid pACIB, complete sequence) position: , mismatch: 0, identity: 1.0

taccacattttgtacaagtaattaaaacttctttttttacttctgttccacaagaat	CRISPR spacer
taccacattttgtacaagtaattaaaacttctttttttacttctgttccacaagaat	Protospacer
*********************************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

61 : 65403

Leptospira_phage(29.41%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151029445.1\|61_1420_-\|transposase	transposase	NA	NA	NA	NA
WP_024774265.1\|1938_2316_-	hypothetical protein	NA	NA	NA	NA
WP_024774264.1\|2317_3598_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_024774261.1\|4025_5351_-	hypothetical protein	A0A139ZPL2	Marinitoga_camini_virus	7.3e-41	33.0
WP_024774260.1\|5365_6877_-	replication initiation protein	NA	NA	NA	NA
WP_138109240.1\|8928_9945_-	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_024774258.1\|9957_10872_-	ParA family protein	F0PIG8	Enterococcus_phage	7.1e-11	23.1
WP_151029446.1\|11116_15916_+	RecQ family ATP-dependent DNA helicase	Q9DSV4	Diadromus_pulchellus_ascovirus	6.3e-34	28.8
WP_024774256.1\|15992_16631_-	hypothetical protein	NA	NA	NA	NA
WP_151029447.1\|16814_18431_+	hypothetical protein	NA	NA	NA	NA
WP_151029448.1\|18515_18923_+	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_024774253.1\|18940_19402_+	hypothetical protein	NA	NA	NA	NA
WP_024774252.1\|19430_19787_+	hypothetical protein	NA	NA	NA	NA
WP_151029449.1\|19978_20518_+	autotransporter domain-containing protein	NA	NA	NA	NA
WP_151029450.1\|20720_20990_-	DNA repair protein Rad50	NA	NA	NA	NA
WP_151029451.1\|21154_21373_-	hypothetical protein	NA	NA	NA	NA
WP_024774248.1\|21363_21621_-	hypothetical protein	NA	NA	NA	NA
WP_151029452.1\|21709_22759_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.7e-43	32.6
WP_151029453.1\|22841_23408_-	hypothetical protein	NA	NA	NA	NA
WP_138109117.1\|23576_24155_+\|transposase	transposase	K4I413	Acidithiobacillus_phage	2.7e-16	36.9
WP_024774245.1\|24276_24693_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_138109116.1\|24785_25472_-	response regulator transcription factor	NA	NA	NA	NA
WP_151029454.1\|25468_26125_-	GHKL domain-containing protein	A0A1V0SGX0	Hokovirus	1.4e-05	25.9
WP_151029455.1\|26125_26305_-	hypothetical protein	NA	NA	NA	NA
WP_151029456.1\|26449_27598_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_151029457.1\|27638_28682_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.3e-36	30.1
WP_151029458.1\|28711_29857_+\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_151029459.1\|30007_31042_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	3.7e-40	31.9
WP_151029460.1\|31081_31315_-	hypothetical protein	NA	NA	NA	NA
WP_151029461.1\|31302_32373_-\|transposase	transposase	NA	NA	NA	NA
WP_151029187.1\|32206_33256_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	6.2e-43	32.6
WP_151029462.1\|33248_33449_-	hypothetical protein	NA	NA	NA	NA
WP_151029463.1\|33547_33820_-	hypothetical protein	NA	NA	NA	NA
WP_151029464.1\|34111_34597_+	hypothetical protein	NA	NA	NA	NA
WP_024774266.1\|34774_35992_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.4e-24	25.9
WP_151029465.1\|36242_36719_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_151029466.1\|36723_37119_+	SHOCT domain-containing protein	NA	NA	NA	NA
WP_151029467.1\|37302_38085_-	NYN domain-containing protein	NA	NA	NA	NA
WP_151029468.1\|38407_39226_-	hypothetical protein	NA	NA	NA	NA
WP_151029469.1\|39222_40830_-	zinc-ribbon domain-containing protein	NA	NA	NA	NA
WP_151029470.1\|40842_42375_-	OmpA family protein	NA	NA	NA	NA
WP_151029471.1\|42591_42828_+	hypothetical protein	NA	NA	NA	NA
WP_151029472.1\|42862_43912_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	6.2e-43	32.6
WP_024774781.1\|44393_45683_+\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_151029473.1\|46466_48074_+\|transposase	IS1634 family transposase	NA	NA	NA	NA
WP_151029474.1\|48314_51818_-	DEAD/DEAH box helicase family protein	S5NA49	Choristoneura_rosaceana_nucleopolyhedrovirus	1.5e-37	28.9
WP_151029475.1\|52524_53493_+	aliphatic sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_138154355.1\|53508_54663_+	FMNH2-dependent alkanesulfonate monooxygenase	NA	NA	NA	NA
WP_138154354.1\|54662_55433_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_024776243.1\|55429_56185_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	8.7e-31	36.6
WP_151029476.1\|56194_57055_+	amidohydrolase family protein	NA	NA	NA	NA
WP_151029477.1\|57055_58258_+	threonine synthase	C3U2M1	Lactococcus_phage	2.0e-08	24.8
WP_151029478.1\|58355_59192_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_151029479.1\|59197_59857_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_151029480.1\|59837_60515_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_138108915.1\|60518_61259_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.7e-32	40.9
WP_151029481.1\|61611_62685_+	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_138108917.1\|62681_63602_+	cysteine synthase family protein	C3U2M1	Lactococcus_phage	2.1e-47	38.7
WP_151029482.1\|63583_64030_+	M67 family metallopeptidase	NA	NA	NA	NA
WP_024774266.1\|64185_65403_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.4e-24	25.9

DBSCAN-SWA_2

76097 : 139108

uncultured_Caudovirales_phage(17.65%)

integrase,transposase

attL 104305:104326|attR 141365:141386

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024774781.1\|76097_77387_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_138108923.1\|77559_79518_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.4e-09	34.1
WP_138154388.1\|79822_80065_-	hypothetical protein	NA	NA	NA	NA
WP_151029488.1\|80096_81470_-	sel1 repeat family protein	NA	NA	NA	NA
WP_034218870.1\|81694_82021_+	YnfA family protein	A0A2H4JF35	uncultured_Caudovirales_phage	1.3e-18	48.1
WP_138154390.1\|82385_83132_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_151029489.1\|83361_84276_+	hypothetical protein	A0A2H4J162	uncultured_Caudovirales_phage	4.8e-07	31.5
WP_024774794.1\|84596_85442_+	zinc transporter ZupT	NA	NA	NA	NA
WP_138154395.1\|85566_87852_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	1.3e-16	32.2
WP_151029490.1\|88106_88298_+	hypothetical protein	NA	NA	NA	NA
WP_151029491.1\|88807_90115_+	hypothetical protein	NA	NA	NA	NA
WP_151029593.1\|90194_90503_-	Hsp20 family protein	NA	NA	NA	NA
WP_138154423.1\|90684_91233_-	cell filamentation protein Fic	NA	NA	NA	NA
WP_151029492.1\|93517_94435_+\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	1.0e-12	25.6
WP_151029493.1\|94492_94660_+	YwbE family protein	NA	NA	NA	NA
WP_151029494.1\|95398_97240_+	PAS domain S-box protein	NA	NA	NA	NA
WP_151029495.1\|97560_98787_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.8e-92	47.0
WP_151029496.1\|98792_99074_-	hypothetical protein	NA	NA	NA	NA
WP_024776256.1\|99907_100156_+	hypothetical protein	NA	NA	NA	NA
WP_084031377.1\|100139_100478_+	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_024776258.1\|101220_101439_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	1.7e-11	55.6
WP_151029497.1\|103281_103701_-	hypothetical protein	S5VXX4	Leptospira_phage	5.2e-09	33.0
104305:104326	attL	NA	NA	NA	NA
WP_151029594.1\|104638_104905_+	hypothetical protein	NA	NA	NA	NA
WP_151029498.1\|105295_106225_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	1.1e-62	43.2
WP_151029499.1\|106534_106939_-	hypothetical protein	NA	NA	NA	NA
WP_151029500.1\|107068_108274_-	DUF4143 domain-containing protein	NA	NA	NA	NA
WP_151029501.1\|109711_110041_+	hypothetical protein	A0A1S6UA75	Serratia_phage	5.7e-19	46.2
WP_151029502.1\|110137_110629_-	hypothetical protein	NA	NA	NA	NA
WP_151029503.1\|110615_110927_-	hypothetical protein	NA	NA	NA	NA
WP_151029504.1\|110991_111306_-	hypothetical protein	NA	NA	NA	NA
WP_151029505.1\|111405_111753_+	DUF2493 domain-containing protein	A0A146JGQ8	Tokyovirus	7.1e-20	41.7
WP_151029506.1\|111781_112249_+	hypothetical protein	NA	NA	NA	NA
WP_151029507.1\|112335_112647_+	hypothetical protein	NA	NA	NA	NA
WP_151029508.1\|112660_113116_+	hypothetical protein	NA	NA	NA	NA
WP_151029509.1\|113218_114154_+	WYL domain-containing protein	NA	NA	NA	NA
WP_151029510.1\|114454_115372_+	WYL domain-containing protein	NA	NA	NA	NA
WP_151029511.1\|115455_115620_+\|transposase	transposase	NA	NA	NA	NA
WP_151029512.1\|115640_115778_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_024776254.1\|115832_116024_+	YwbE family protein	NA	NA	NA	NA
WP_151029513.1\|116303_117941_+	AAA family ATPase	A0A0R6PCP6	Moraxella_phage	1.6e-16	34.7
WP_151029514.1\|117937_118261_+	hypothetical protein	NA	NA	NA	NA
WP_151029515.1\|118321_118717_+	hypothetical protein	NA	NA	NA	NA
WP_151029516.1\|118755_119055_+	hypothetical protein	NA	NA	NA	NA
WP_024775336.1\|119141_119396_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024775337.1\|119385_120546_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_151029517.1\|120618_121542_+	WYL domain-containing protein	NA	NA	NA	NA
WP_151029518.1\|121775_122387_+	hypothetical protein	NA	NA	NA	NA
WP_109158659.1\|122401_122647_+	hypothetical protein	NA	NA	NA	NA
WP_151029519.1\|122643_123081_+	hypothetical protein	NA	NA	NA	NA
WP_151029520.1\|123119_123608_+	hypothetical protein	NA	NA	NA	NA
WP_151029521.1\|123611_124313_+	NAD-dependent deacetylase	Q6WIA8	Vibrio_phage	6.8e-30	36.3
WP_151029522.1\|124392_124863_+	hypothetical protein	A0A2I7QWX6	Vibrio_phage	3.0e-13	33.8
WP_151029523.1\|125016_127344_+	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_151029524.1\|127336_128683_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_151029525.1\|128672_130565_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_151029526.1\|130554_133686_+	UvrD-helicase domain-containing protein	A0A068EQC7	Bacillus_phage	3.0e-16	22.2
WP_151029378.1\|133890_135405_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.9e-108	46.6
WP_151029527.1\|136108_139108_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.5e-52	27.7
141365:141386	attR	NA	NA	NA	NA

DBSCAN-SWA_3

178216 : 213981

Shigella_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041963845.1\|178216_179581_-\|transposase	transposase	NA	NA	NA	NA
WP_012477453.1\|179738_179909_+	hypothetical protein	NA	NA	NA	NA
WP_012290103.1\|179982_180639_+	replication protein	NA	NA	NA	NA
WP_012477450.1\|180792_182175_+	tetracycline efflux MFS transporter Tet(L)	NA	NA	NA	NA
WP_039043705.1\|182705_184010_+	hypothetical protein	NA	NA	NA	NA
WP_151029563.1\|184224_185400_-\|transposase	transposase	NA	NA	NA	NA
WP_151029564.1\|185723_186728_-	hypothetical protein	NA	NA	NA	NA
WP_151029565.1\|186772_187699_-	hypothetical protein	NA	NA	NA	NA
WP_151029566.1\|187906_188140_-	hypothetical protein	NA	NA	NA	NA
WP_151029567.1\|188464_191011_+	TraC family protein	NA	NA	NA	NA
WP_151029568.1\|191212_191575_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_151029569.1\|191574_192825_-	HipA domain-containing protein	NA	NA	NA	NA
WP_039659221.1\|193490_193679_+	hypothetical protein	NA	NA	NA	NA
WP_151029570.1\|193830_194301_+	hypothetical protein	NA	NA	NA	NA
WP_151029571.1\|194304_195219_+	hypothetical protein	NA	NA	NA	NA
WP_151028905.1\|195673_196300_+	hypothetical protein	NA	NA	NA	NA
WP_138108970.1\|196463_196691_+	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_138108969.1\|196691_196943_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_151029572.1\|197891_198305_+	EamA family transporter	NA	NA	NA	NA
WP_151029573.1\|198356_199649_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_151029574.1\|199762_200248_+	EamA family transporter	NA	NA	NA	NA
WP_138108965.1\|200479_200923_+	hypothetical protein	NA	NA	NA	NA
WP_138108964.1\|200973_201750_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_151029575.1\|203391_203979_-	recombinase family protein	A0A0C4UR34	Shigella_phage	1.2e-38	48.0
WP_148571746.1\|204202_206317_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_151029576.1\|206332_207091_+	DUF4198 domain-containing protein	NA	NA	NA	NA
WP_151029021.1\|207215_207581_-	YgiW/YdeI family stress tolerance OB fold protein	A0A1I9LJU6	Stx_converting_phage	2.8e-19	42.4
WP_151029577.1\|207665_208583_-	hypothetical protein	NA	NA	NA	NA
WP_151029452.1\|208642_209692_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.7e-43	32.6
WP_151029578.1\|209707_210163_-	hypothetical protein	NA	NA	NA	NA
WP_066358163.1\|210159_210825_-	response regulator	NA	NA	NA	NA
WP_151029579.1\|211183_211792_-	hypothetical protein	NA	NA	NA	NA
WP_151029580.1\|211892_212597_-\|transposase	transposase	NA	NA	NA	NA
WP_151029581.1\|212715_213981_+\|transposase	IS5 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP043857

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP043858

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection