CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP032366	Bacillus wiedmannii strain SR52 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	1	0
NZ_CP032365	Bacillus wiedmannii strain SR52 chromosome, complete genome	5 crisprs	cas3,csa3,WYL,cas14k,DinG,c2c9_V-U4,DEDDh,cas14j	43	15	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

37397 : 85963

Bacillus_phage(40.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151035716.1\|37397_37766_-	hypothetical protein	A0A0S2MWG5	Cellulophaga_phage	1.8e-05	30.8
WP_151035717.1\|37817_38117_-	thioredoxin family protein	A0A0K2FLN5	Brevibacillus_phage	9.7e-10	37.1
WP_151035718.1\|38150_39194_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0K2FLD5	Brevibacillus_phage	9.6e-113	63.7
WP_151035719.1\|39190_39724_-	hypothetical protein	NA	NA	NA	NA
WP_151035720.1\|39841_41932_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A0A218KC36	Bacillus_phage	7.8e-239	59.8
WP_151035721.1\|41934_42303_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	5.7e-28	50.4
WP_151035722.1\|42361_42865_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	2.8e-41	48.8
WP_151035723.1\|42861_44718_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.1e-223	60.9
WP_151035724.1\|44819_47126_-	AAA family ATPase	A0A0K2FLP8	Brevibacillus_phage	4.7e-112	36.5
WP_151035725.1\|47154_47394_-	hypothetical protein	NA	NA	NA	NA
WP_151035726.1\|47393_47753_-	hypothetical protein	NA	NA	NA	NA
WP_151035727.1\|47839_48541_-	hypothetical protein	NA	NA	NA	NA
WP_167514920.1\|48531_48693_-	hypothetical protein	NA	NA	NA	NA
WP_151035728.1\|48858_49083_-	hypothetical protein	NA	NA	NA	NA
WP_151035729.1\|49082_49715_-	hypothetical protein	NA	NA	NA	NA
WP_151035730.1\|49849_50509_-	hypothetical protein	A0A127AYS1	Bacillus_phage	2.4e-48	47.4
WP_151035731.1\|50495_50987_-	dihydrofolate reductase	A0A218KC58	Bacillus_phage	1.8e-29	50.0
WP_151035732.1\|50983_51922_-	thymidylate synthase	A0A218KC80	Bacillus_phage	1.5e-85	50.3
WP_151035733.1\|52126_52711_-	hypothetical protein	I1TK09	Clostridium_phage	1.4e-47	56.0
WP_151035734.1\|52798_53047_-	hypothetical protein	NA	NA	NA	NA
WP_151035735.1\|53036_56474_-	PHP domain-containing protein	A0A218KC91	Bacillus_phage	9.3e-221	38.1
WP_151035736.1\|56554_58630_-	hypothetical protein	A0A127AW62	Bacillus_phage	1.7e-238	58.8
WP_151035737.1\|58741_59473_-	hypothetical protein	A0A218KC31	Bacillus_phage	9.6e-51	44.9
WP_151035739.1\|60037_60616_-	hypothetical protein	A0A076G7D9	Bacillus_phage	6.8e-60	60.9
WP_151035740.1\|60640_61027_-	hypothetical protein	NA	NA	NA	NA
WP_167514932.1\|61031_61301_-	DUF4326 domain-containing protein	A0A141HS61	Bacillus_phage	4.9e-29	64.7
WP_151035741.1\|61755_61992_-	hypothetical protein	A0A1I9S6H3	Bacillus_phage	1.1e-08	47.9
WP_167514921.1\|62008_62176_-	hypothetical protein	NA	NA	NA	NA
WP_151035742.1\|62188_62686_-	hypothetical protein	A0A0K2FL91	Brevibacillus_phage	2.3e-24	41.9
WP_151035743.1\|62682_63405_-	VWA domain-containing protein	NA	NA	NA	NA
WP_151035744.1\|63434_63674_-	hypothetical protein	NA	NA	NA	NA
WP_151035745.1\|63687_63879_-	hypothetical protein	NA	NA	NA	NA
WP_151035746.1\|63890_64100_-	hypothetical protein	NA	NA	NA	NA
WP_151035747.1\|64499_64727_-	hypothetical protein	G3BLZ2	Salmonella_phage	2.4e-08	47.3
WP_151035748.1\|64723_64993_-	hypothetical protein	A7KVB0	Bacillus_phage	5.7e-17	51.9
WP_151035749.1\|65007_65205_-	hypothetical protein	NA	NA	NA	NA
WP_151035750.1\|65207_65504_-	hypothetical protein	NA	NA	NA	NA
WP_151035751.1\|65500_65716_-	hypothetical protein	NA	NA	NA	NA
WP_151035752.1\|65736_65958_-	hypothetical protein	NA	NA	NA	NA
WP_167514922.1\|65972_66128_-	hypothetical protein	NA	NA	NA	NA
WP_167514923.1\|66140_66317_-	hypothetical protein	NA	NA	NA	NA
WP_151035753.1\|66313_66940_-	hypothetical protein	NA	NA	NA	NA
WP_151035754.1\|67149_67365_-	hypothetical protein	NA	NA	NA	NA
WP_151035755.1\|67405_67798_-	hypothetical protein	A0A024B2D8	Bacillus_phage	3.7e-09	29.5
WP_151035756.1\|67869_68544_-	YjbE family putative metal transport protein	A0A0S4KZH7	Pseudomonas_phage	1.0e-35	43.8
WP_167514924.1\|68681_68852_-	hypothetical protein	NA	NA	NA	NA
WP_151035757.1\|68981_70280_-	PD-(D/E)XK nuclease family protein	Q332G6	Clostridium_botulinum_C_phage	4.5e-43	31.2
WP_151035758.1\|70283_70910_-	thymidine kinase	A0A1W6JJU6	Lactococcus_phage	9.1e-34	41.0
WP_167514925.1\|70902_71079_-	hypothetical protein	NA	NA	NA	NA
WP_151035759.1\|72262_72448_-	hypothetical protein	NA	NA	NA	NA
WP_151035760.1\|72470_73928_-	hypothetical protein	Q332G8	Clostridium_botulinum_C_phage	3.6e-73	33.7
WP_151035761.1\|73924_74599_-	hypothetical protein	NA	NA	NA	NA
WP_151035762.1\|74671_75637_-	AAA family ATPase	Q332H0	Clostridium_botulinum_C_phage	3.0e-36	36.2
WP_151035763.1\|75745_76921_-	hypothetical protein	Q332H1	Clostridium_botulinum_C_phage	1.8e-38	30.0
WP_151035835.1\|77130_77409_-	hypothetical protein	NA	NA	NA	NA
WP_151035764.1\|77785_78388_-	hypothetical protein	NA	NA	NA	NA
WP_151035765.1\|78468_78672_-	hypothetical protein	NA	NA	NA	NA
WP_151035766.1\|78690_79242_-	hypothetical protein	A0A1B4XWK7	Tenacibaculum_phage	4.4e-16	33.3
WP_151035767.1\|79241_79832_-	hypothetical protein	A0A172Q0F5	Acinetobacter_phage	2.1e-11	30.2
WP_151035768.1\|79864_81271_-	DUF5598 domain-containg protein	E0YPK5	Mycobacterium_virus	4.1e-18	26.4
WP_151035769.1\|81291_81555_-	hypothetical protein	NA	NA	NA	NA
WP_151035770.1\|81571_82120_-	hypothetical protein	NA	NA	NA	NA
WP_151035771.1\|82132_82510_-	DUF2493 domain-containing protein	A0A2I7S0C0	Vibrio_phage	2.1e-25	47.5
WP_151035772.1\|82513_82753_-	hypothetical protein	NA	NA	NA	NA
WP_151035836.1\|83145_83697_-	hypothetical protein	A0A1D6X890	Bacillus_phage	2.5e-11	31.9
WP_151035837.1\|83775_84435_-	hypothetical protein	A0A024B055	Bacillus_phage	7.1e-13	45.1
WP_151035838.1\|84640_85963_-	hypothetical protein	A0A0H3UZH0	Geobacillus_virus	1.5e-73	39.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP032365

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP032365_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP032365_1

1192824-1193058

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP032365_1

>merge|NZ_CP032365|1|1192824-1193058|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCAATTGTATGTTTACCTTCCGCATGAGAATAAGAGCCACCTGCTGTCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTTGCTTTCGTTTTTGATCCTTCCGCATGAGAGAAAGAAGCTTTTGCGTGTGTAAGAAGTCCTTCTGCATGTGAA

>NZ_CP032365|1|1|1192824-1193058|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCAAT
TGTATGTTTACCTTCCGCATGAGAA	TAAGAGCCACCTGCTGTCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTTGCTTT
CGTTTTTGATCCTTCCGCATGAGAG	AAAGAAGCTTTTGCGTG
TGTAAGAAGTCCTTCTGCATGTGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP032365.1\|WP_001087861.1\|1200952_1201642_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|369778
NZ_CP032365.1\|WP_002108703.1\|1186742_1186934_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_001081480.1\|1189763_1190402_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP032365.1\|WP_000428854.1\|1197682_1198528_-\|macrocin-O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP032365.1\|WP_000191103.1\|1188636_1189215_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP032365.1\|WP_001059627.1\|1195841_1196777_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NZ_CP032365.1\|WP_000673190.1\|1190420_1191218_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP032365.1\|WP_000667005.1\|1193718_1194459_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP032365.1\|WP_000360672.1\|1187164_1188058_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP032365.1\|WP_151035333.1\|1191233_1192127_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP032365.1\|WP_001179998.1\|1189361_1189733_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_000100683.1\|1201638_1202325_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP032365.1\|WP_000043382.1\|1188057_1188456_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP032365.1\|WP_048567031.1\|1196783_1197542_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP032365.1\|WP_048567030.1\|1183510_1184755_+\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP032365.1\|WP_000651509.1\|1202337_1203018_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP032365.1\|WP_048567033.1\|1199712_1200807_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP032365.1\|WP_000003404.1\|1184805_1186632_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP032365.1\|WP_000654711.1\|1194533_1195694_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP032365.1\|WP_151035334.1\|1198650_1199547_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999

Protein	Function_ID	Function_description	E-value
NZ_CP032365.1\|WP_001087861.1\|1200952_1201642_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	2.11029e-18
NZ_CP032365.1\|WP_048567031.1\|1196783_1197542_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.19964e-18
NZ_CP032365.1\|WP_000428854.1\|1197682_1198528_-\|macrocin-O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	3.12028e-149
NZ_CP032365.1\|WP_000191103.1\|1188636_1189215_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	9.06465e-85
NZ_CP032365.1\|WP_001059627.1\|1195841_1196777_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.80857e-21
NZ_CP032365.1\|WP_000673190.1\|1190420_1191218_+\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP032365.1\|WP_000667005.1\|1193718_1194459_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP032365.1\|WP_000360672.1\|1187164_1188058_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	1.45504e-94
NZ_CP032365.1\|WP_151035333.1\|1191233_1192127_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	3.26845e-98
NZ_CP032365.1\|WP_001081480.1\|1189763_1190402_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.30935e-95
NZ_CP032365.1\|WP_000100683.1\|1201638_1202325_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	1.29154e-109
NZ_CP032365.1\|WP_000043382.1\|1188057_1188456_-\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	9.58133e-70
NZ_CP032365.1\|WP_048567030.1\|1183510_1184755_+\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	1.48694e-54
NZ_CP032365.1\|WP_000651509.1\|1202337_1203018_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	1.62077e-106
NZ_CP032365.1\|WP_048567033.1\|1199712_1200807_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	7.20705e-52
NZ_CP032365.1\|WP_000003404.1\|1184805_1186632_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP032365.1\|WP_000654711.1\|1194533_1195694_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	5.77301e-99
NZ_CP032365.1\|WP_151035334.1\|1198650_1199547_-\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	5.2221e-16

>NZ_CP032365.1|WP_151035333.1|1191233_1192127_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIESAEEGTLVREFLKTKGISKAALTDIKFRGGAIEVNNQHASVRHQLQAGEELRVFFPVEERSEGMIKEDIPLCIVYEDDAVLVINKEANMSTIPSREHPAGSVANALLSHYDKQHLASTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMIEREGTIDAPIGRKSDSIIERTVCENGQRAVTHFRVMDSANHKTHVSLELETGRTHQIRVHMAHIGHPLLGDNLYGGRRDVIKRQALHSTSLTFYHPILEKEMSFTTTIPSDMEEVLRHT
>NZ_CP032365.1|WP_000673190.1|1190420_1191218_+|NAD-kinase
MKFTIMSKGDQSSDTLASTMKEYLLDFGFIMDEKEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYVNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPAAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP032365.1|WP_001081480.1|1189763_1190402_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEKKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP032365.1|WP_001179998.1|1189361_1189733_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENNEIEVKELSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWESMHEAMNNDIVMFVRVNDVEMELENLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP032365.1|WP_000191103.1|1188636_1189215_-|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFDTLCKSFSIEVFTKQVNHYFETPGFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQIVTEDEARMMMKTNVIIPGAVMDQLHKLQIPVSTLTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLKQHDIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP032365.1|WP_000043382.1|1188057_1188456_-|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEV
>NZ_CP032365.1|WP_000360672.1|1187164_1188058_-|DsbA-family-protein
MDKQEATHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLQGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACARDSDIDVEEFKKDLHSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSQQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP032365.1|WP_002108703.1|1186742_1186934_-|hypothetical-protein
MKKTYILLILLAVIVSFFLYILSLLQAFPKIIAFPLLFGVIVIALSYFNHKKRFKGFNYKNHL
>NZ_CP032365.1|WP_000003404.1|1184805_1186632_+|oligoendopeptidase-F
MSEQNTTKTLPNRSEIEESNTWRLEDIFQTDAEWEKEFQAIKGLLPKLTEFKGKLGDSADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSIAEDTLQTFLTENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLVESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLNVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLYTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEN
>NZ_CP032365.1|WP_048567030.1|1183510_1184755_+|competence-protein
MIPMFIAKRENGEKIHLLYHHDEELLHRMRKMEIFFCIACGKEVQMKLGKQKSWHFAHKKMDACLAFYEAESMYHMHGKELLYRWFKRQNFPVYIEHYLPEIQQRPDIFIERAGRTIAIEYQCANLSIEQLYKRTYSYWRAGIQVIWIIGGNQLKRQSAYWMKFSSLMAFSLQSYPQPFLIFFCSKQKSFMKCAFLTSFSTSVSFSHIIYLPTETTTFEMLFSPVSFRKETLGEEWKKRKSYFRQNALPIWNYNHKSLLRLLYQCKCTPANFPSEIGVPLPSSFAFQTNPFIWQAFLYIKCIGELTVGDCISLQYVCSYVKTYTKRRMLPYFSRHIWKVAVAEYMTFLCYAGVLQKVGTYKYRKKREVVMLKTEEEVIKYDEICLTYALSLFEAKYNMREGKGDIIKTDREGIT
>NZ_CP032365.1|WP_000667005.1|1193718_1194459_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKFDIIGDIHGCFQEFQDLTTKLGYNWNSDLPFHPDQRKLAFVGDITDRGPHSLRMIEIVWELVINKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHKQNIIKEKFITLYEQSPLYHVLDEKRLIVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAQEYKGKAWIVYGHTPVKEPRFVNHTVNIDTGAVFGGKLTGLRYPEMETVSVPSSLSFVHEKFRPIS
>NZ_CP032365.1|WP_000654711.1|1194533_1195694_-|rod-shape-determining-protein-RodA
MKDPNSQYQIDYVLLFILFAIGTVSCFAIASAQASLPPFLQNVNFVLKQIQWYFIGFIAIGFIMIIDFDRYQKIAWYLYSFALVLLIGLELQVPGAVTIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFFRTIHDDFLLLGKICATSLPPLLLVAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLVSGIFVAGVTLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIISLFFLLIFRMIHIALESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFK
>NZ_CP032365.1|WP_001059627.1|1195841_1196777_-|glycosyltransferase-family-2-protein
MNNIKNPPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIVGDDSTNNETEKLIYRHYLHKHKHITYIRNASTLGQFHNALMLLEQSNGEYINFLMDDDTFYNNKIEKMMFHFQQDLNKNLALITSYRTWIDDNGDIIEQHPSMKKLYDEDTLLNGKDFGNRMLLAGQNIIGEPTIVLFRKSLLTEPFGTLNGRKYGCSVDMASWISLLSKGDAMYITEPLSSFRLHTGQQVRHKFLEGCEDFSQLVLTSKKYGFLQDAKYYKKGLIRAYGWYKNATKFYDLFPNLIPDKNTHARLSYCLNIITKELRAI
>NZ_CP032365.1|WP_048567031.1|1196783_1197542_-|class-I-SAM-dependent-methyltransferase
MNENEKKITLIPPPELVQYVGGNFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYLSDEGTYYGFDLFNTGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVCEIARVLKKDGRCFITFFLINPESSYYLNAGLSTLGFYHQIDNCYVLNKDIPNFAVAYPEEDIRALLNKHGLEIQSPPHYGSWCSRTEHTSYQDIILTQKTSER
>NZ_CP032365.1|WP_000428854.1|1197682_1198528_-|macrocin-O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYVENHNLKIVDPNVSKSERQGGKDWPRAAHSMVGRKRMNQLHEAMETVVRENIEGDFIETGVWRGGSCIFMNGFLQANNITDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPVEKIAIARLDGDMYESTMDSLVNLYDKVSTGGYIIIDDYGLVTCAEAVTDFRNERNLKAPITKIDDFGIYWRKE
>NZ_CP032365.1|WP_151035334.1|1198650_1199547_-|hypothetical-protein
MSNNNYSDGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGLTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGATGATGPTGPTGPTGPTGPTGPTGPSGLGLPAGLYAFNSATVSLALGINDPVPFNTVGSQFGTAISQMDADTFVISETGFYKITVIAYTAAVSLLGSLGIQVNGVNVPGAGTSLISLGAPIVIQAITQITTTPSLVEAVVTGIGLSLALGTSASIIIEKIA
>NZ_CP032365.1|WP_048567033.1|1199712_1200807_+|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEDTIGRCLDAVEKIVDEIIIVDTGSIDRTKEIVAQYTSNIYDFPWINDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKKELDSNVDAVSMPYHLVMDSNGKPLYCTKRYRLVKREKEFQWFGKVHEYLAIFGEIFNSNVAITHKKEKKVTNRNLKIFQDAVAAGEELSPRDLFYYANESMDNQKYDDAVLLYETFLNQDEGWYEEKIYACGKLGDCYAKLGMWEKAVESCVKSFRYDVPRGENCTRIGYIYMDQQKYNEAIFWFKLATEVTMATESPFHSPASYTWIPYLQMCICYSKLGEQDKAYYYNELAASYVPNNAAIEYNRKYFRSVFDEQYK
>NZ_CP032365.1|WP_001087861.1|1200952_1201642_+|methyltransferase-domain-containing-protein
MNSPKNSLYEEKSGHYYNAVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEKAKEKLDHVILGDIETMDMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNISHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDHKMYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
>NZ_CP032365.1|WP_000100683.1|1201638_1202325_+|streptomycin-biosynthesis-protein-StrF
MSTADKTILFVTCINDRKMYAQCARHILQLPVPPGYTIQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIVNVGFLYGLLQLFQEHEHLGMIGMVGAQYVPPNGTWNVGRGVVGKVIGYMNDLYYMASQEKPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDFYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYEKYRKIFVEHYMSDVNQDE
>NZ_CP032365.1|WP_000651509.1|1202337_1203018_+|streptomycin-biosynthesis-protein-StrF
MKDHTILVVVCINNEELFEQCERQIQNLFVPPGYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTYLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRQNYQLLNLDQLFYKNQSFMSVQAIDGLLMATQYDIPWREDLFQGFHFYDVSQSLEFQKAGYLIGIPNQANLWCIHYNGDEFDADTYEKYRKVFVEHYKDILSPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP032365_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP032365_2

3425382-3425485

TypeV-U4,TypeI-A?

Consensus_repeat	Method
CAAGTTTAGGTTTCTTTTGAGAATGT	CRISPRCasFinder

1 spacers

c2c9_V-U4,csa3

The CRISPR arrays of NZ_CP032365_2

>merge|NZ_CP032365|2|3425382-3425485|CRISPRCasFinder
CAAGTTTAGGTTTCTTTTGAGAATGTGGTATATTTACATGTCCCGAAGCAGCCACGGATTGTCTCCTTTCCTTCCTTGACAATTTAGGTTTCTTTTGAGAATGT

>NZ_CP032365|2|2|3425382-3425485|CRISPRCasFinder
CAAGTTTAGGTTTCTTTTGAGAATGT	GGTATATTTACATGTCCCGAAGCAGCCACGGATTGTCTCCTTTCCTTCCTTG
ACAATTTAGGTTTCTTTTGAGAATGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP032365.1\|WP_000831433.1\|3411275_3413018_-\|amidohydrolase	unknown	unknown	gnl\|CDD\|238625
NZ_CP032365.1\|WP_000351722.1\|3421707_3422550_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_CP032365.1\|WP_000288085.1\|3415077_3415836_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133382
NZ_CP032365.1\|WP_000724910.1\|3417229_3418387_-\|agmatine-deiminase-family-protein	unknown	unknown	gnl\|CDD\|377332
NZ_CP032365.1\|WP_000435527.1\|3415874_3416852_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377332
NZ_CP032365.1\|WP_000275779.1\|3434274_3434880_-\|FMN-binding-negative-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377290
NZ_CP032365.1\|WP_000417242.1\|3426124_3426778_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_000813618.1\|3435021_3435549_-\|GrpB-family-protein	unknown	unknown	gnl\|CDD\|377252
NZ_CP032365.1\|WP_001226338.1\|3423876_3424821_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176543
NZ_CP032365.1\|WP_000571880.1\|3429522_3429867_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP032365.1\|WP_000164934.1\|3431062_3432529_+\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NZ_CP032365.1\|WP_151035493.1\|3420389_3421622_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341028
NZ_CP032365.1\|WP_000599316.1\|3413312_3414443_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	c2c9_V-U4	-	gnl\|CDD\|223747
NZ_CP032365.1\|WP_001172043.1\|3435572_3435920_-\|DUF4260-domain-containing-protein	unknown	unknown	gnl\|CDD\|379455
NZ_CP032365.1\|WP_000495320.1\|3432833_3433946_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|376220
NZ_CP032365.1\|WP_001208321.1\|3422552_3423062_+\|DUF3916-domain-containing-protein	unknown	unknown	gnl\|CDD\|372464
NZ_CP032365.1\|WP_000839988.1\|3427386_3429006_-\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|366675
NZ_CP032365.1\|WP_151035492.1\|3418668_3419796_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP032365.1\|WP_000646394.1\|3429885_3430884_+\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NZ_CP032365.1\|WP_033658719.1\|3426794_3427046_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274783

Protein	Function_ID	Function_description	E-value
NZ_CP032365.1\|WP_000831433.1\|3411275_3413018_-\|amidohydrolase	gnl\|CDD\|238625	cd01300, YtcJ_like, YtcJ_like metal dependent amidohydrolases. YtcJ is a Bacillus subtilis ORF of unknown function. The Arabidopsis homolog LAF3 has been identified as a factor required for photochrome A signalling.	6.86e-121
NZ_CP032365.1\|WP_000351722.1\|3421707_3422550_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.96037e-89
NZ_CP032365.1\|WP_000288085.1\|3415077_3415836_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133382	cd01107, HTH_BmrR, Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator. Helix-turn-helix (HTH) multidrug-efflux transporter transcription regulator, BmrR and YdfL of Bacillus subtilis, and related proteins; N-terminal domain. Bmr is a membrane protein which causes the efflux of a variety of toxic substances and antibiotics. BmrR is comprised of two distinct domains that harbor a regulatory (effector-binding) site and an active (DNA-binding) site. The conserved N-terminal domain contains a winged HTH motif that mediates DNA binding, while the C-terminal domain binds coactivating, toxic compounds. BmrR shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.	9.04082e-31
NZ_CP032365.1\|WP_000724910.1\|3417229_3418387_-\|agmatine-deiminase-family-protein	gnl\|CDD\|377332	pfam04371, PAD_porph, Porphyromonas-type peptidyl-arginine deiminase. Peptidyl-arginine deiminase (PAD) enzymes catalyze the deimination of the guanidino group from carboxy-terminal arginine residues of various peptides to produce ammonia. PAD from Porphyromonas gingivalis (PPAD) appears to be evolutionarily unrelated to mammalian PAD (pfam03068), which is a metalloenzyme. PPAD is thought to belong to the same superfamily as aminotransferase and arginine deiminase, and to form an alpha/beta propeller structure. This family has previously been named PPADH (Porphyromonas peptidyl-arginine deiminase homologs). The predicted catalytic residues in PPAD are Asp130, Asp187, His236, Asp238 and Cys351. These are absolutely conserved with the exception of Asp187 which is absent in two family members. PPAD is also able to catalyze the deimination of free L-arginine, but has primarily peptidyl-arginine specificity. It may have a FMN cofactor.	1.36272e-112
NZ_CP032365.1\|WP_000435527.1\|3415874_3416852_-\|hypothetical-protein	gnl\|CDD\|377332	pfam04371, PAD_porph, Porphyromonas-type peptidyl-arginine deiminase. Peptidyl-arginine deiminase (PAD) enzymes catalyze the deimination of the guanidino group from carboxy-terminal arginine residues of various peptides to produce ammonia. PAD from Porphyromonas gingivalis (PPAD) appears to be evolutionarily unrelated to mammalian PAD (pfam03068), which is a metalloenzyme. PPAD is thought to belong to the same superfamily as aminotransferase and arginine deiminase, and to form an alpha/beta propeller structure. This family has previously been named PPADH (Porphyromonas peptidyl-arginine deiminase homologs). The predicted catalytic residues in PPAD are Asp130, Asp187, His236, Asp238 and Cys351. These are absolutely conserved with the exception of Asp187 which is absent in two family members. PPAD is also able to catalyze the deimination of free L-arginine, but has primarily peptidyl-arginine specificity. It may have a FMN cofactor.	1.07739e-14
NZ_CP032365.1\|WP_000275779.1\|3434274_3434880_-\|FMN-binding-negative-transcriptional-regulator	gnl\|CDD\|377290	pfam04299, FMN_bind_2, Putative FMN-binding domain. In Bacillus subtilis, family member PAI 2/ORF-2 was found to be essential for growth. The SUPERFAMILY database finds that this domain is related to FMN-binding domains, suggesting this protein is also FMN-binding.	9.17608e-71
NZ_CP032365.1\|WP_000813618.1\|3435021_3435549_-\|GrpB-family-protein	gnl\|CDD\|377252	pfam04229, GrpB, GrpB protein. This family has been suggested to belong to the nucleotidyltransferase superfamily. It occurs at the C-terminus of dephospho-CoA kinase (CoaE) in a number of cases, where it plays a role in the proper folding of the enzyme.	3.04911e-58
NZ_CP032365.1\|WP_001226338.1\|3423876_3424821_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176543	cd08601, GDPD_SaGlpQ_like, Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	2.52849e-149
NZ_CP032365.1\|WP_000571880.1\|3429522_3429867_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	7.69179e-15
NZ_CP032365.1\|WP_000164934.1\|3431062_3432529_+\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NZ_CP032365.1\|WP_151035493.1\|3420389_3421622_-\|MFS-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.55329e-98
NZ_CP032365.1\|WP_000599316.1\|3413312_3414443_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.80344e-25
NZ_CP032365.1\|WP_001172043.1\|3435572_3435920_-\|DUF4260-domain-containing-protein	gnl\|CDD\|379455	pfam14079, DUF4260, Domain of unknown function (DUF4260). This family of integral membrane proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 114 and 126 amino acids in length. There is a conserved GLK sequence motif.	1.058e-49
NZ_CP032365.1\|WP_000495320.1\|3432833_3433946_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	1.13741e-19
NZ_CP032365.1\|WP_001208321.1\|3422552_3423062_+\|DUF3916-domain-containing-protein	gnl\|CDD\|372464	pfam13079, DUF3916, Protein of unknown function (DUF3916). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 170 amino acids in length. There is a single completely conserved residue S that may be functionally important.	1.20765e-71
NZ_CP032365.1\|WP_000839988.1\|3427386_3429006_-\|FAD-dependent-monooxygenase	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	2.05945e-104
NZ_CP032365.1\|WP_151035492.1\|3418668_3419796_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	5.26588e-59
NZ_CP032365.1\|WP_000646394.1\|3429885_3430884_+\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	4.70801e-149
NZ_CP032365.1\|WP_033658719.1\|3426794_3427046_-\|hypothetical-protein	gnl\|CDD\|274783	TIGR03789, pdsO, proteobacterial sortase system peptidoglycan-associated protein. A newly defined histidine kinase (TIGR03785) and response regulator (TIGR03787) gene pair occurs exclusively in Proteobacteria, mostly of marine origin, nearly all of which contain a subfamily 6 sortase (TIGR03784) and its single dedicated target protein (TIGR03788) adjacent to to the sortase. This protein family shows up in only in those species with the histidine kinase/response regulator gene pair, and often adjacent to that pair. It belongs to the pfam00691 domain family, which is the peptidoglycan-associated region of flagellar motor protein MotB, OmpA (whose N-terminal region forms an outer membrane beta barrel), and peptidoglycan-associated lipoprotein Pal. Its function is unknown. We assign the gene symbol pdsO, for Proteobacterial Dedicated Sortase system OmpA family protein. [Protein fate, Protein and peptide secretion and trafficking].	0.00556001

>NZ_CP032365.1|WP_001226338.1|3423876_3424821_-|glycerophosphodiester-phosphodiesterase
MRKIISVLVIFFMTGSIFAGGAVHAKAEGKHEWNTNKFLNIAHRGASGHAPEHTFASYDLVKKMKADYLELDIQLTKDGQLIAMHDTAVDRTTNGTGEVRDKTLSEIKSLDAGSWFNKAYPEKAKQEYVGQKVPTLEEIFQKYGRSMKYYIETKSPDVYPGMEEKLLALLNKYNLVGQNMSSSRVMIQSFSKDSLTKIHSMNKNIPLVQLLWYYPNENNEIVEWSGITHEPKSVTNDDFQEIKKYAVGIGPNLRNDNGELIIDESYMKMARKNGLLIHPYTINEKPDMRLLIKWGATGMFTNYPDRLHSVLKEK
>NZ_CP032365.1|WP_001208321.1|3422552_3423062_+|DUF3916-domain-containing-protein
MREKKIRGMKRKINTMIKRIEENTKTFPSAFCDDEYWYMPLPVSQAFIESHKTPRKVKRLCIQTLLNQAQHLIKIKPSDTHTYRVVTLISIENLWDSQIIVFKNEGYFHNFFNRNSEFQKWILLSNESDFWEAWRISICPTVQMLHFQEVIYDEDAIYEKEIWFVGELS
>NZ_CP032365.1|WP_000351722.1|3421707_3422550_+|LysR-family-transcriptional-regulator
MDIKDLTVFYEVAKESNISHAAKNLNYVQSGVTMRMKQLENELDVPLFYRNGKGVTLTSNGEILLTYAKQIIHLMDQSIKAVQSNGTEPKGTLKIGCTESTTAVRLPSILTAYYEKHPKVELILETNTTEQLIRLVLERKLDGAFIAGSTQHAELHTSVFREEELVLISKKPLSSFKDIGDMNLLAFSHGCYYRSLLEDWLQEEDISPKRVLEFGTIEAILACVKSGMGVAIMMKSILKEHEHDLSFNPLPNRFKKVPTTFITRNDIYHSAALQKFMEMI
>NZ_CP032365.1|WP_151035493.1|3420389_3421622_-|MFS-transporter
MEVDGGIILLIEERVNRNYKWMMLIAATIAQTTATLITYGVGVLVLFWKEEYALTNTESGLLVSVVNVGPLFCMLFVGRLLDQYNEKLLISISSFLLGGSLLLTNIVSGFNGLLFVLLLVGMFYSVSQPGGSKVILKWFSKENRGFAMGIRQAGIPIGGALAGVLIPFLTIQYNVTYAINSMACICIIGGLLFFMFYKEPYAQEEVRKEHIKISFWTQLKVVICKKELYPIYITGICMISLQMVLVGHFMKFLVREQSITSIVAGTVFSVMFFSGMIGRVALAAISDLFYKGNRHIPLFIAVCASIGLILLLVMCIHTVTSGVLYGISALLGFFSIGWFSLFIIEVAELASEERVGITVSLALTFNQIAIIVAPVLFGYIVDEKGYTYAWLCIVVLLCISAVSLYSKNKK
>NZ_CP032365.1|WP_151035492.1|3418668_3419796_-|serine-hydrolase
MLKKWLIVFFIFAIFCGSVVALIHVNKGKKYDIKAFSNLNSKQKDGMQEVDANEKKRYEVVAGKLDQYLKEKGFNGSVLVASKDHVILRKGYGYANVKDKVVTTPRTKYRIGSITKTVVAISIMQLKEKGKLNIEDNVNKYISSFPADKNITLRNLLTHTSGLPDQGQGRVDAASRLKLVTWIGAQKLQFPAGTGWKYTDYNYMVLAYIVEKISNKPLAEYVKENIFTPVEMHESGMGATLPEDIFLAEGYTKKDNELIAAPRLKMNWLYGCGEMYTTVEDMKRLDEAIMDGKLLSKQSVLDMFTASPVRKYGFSFYTNPDYYHNHGVLAGWNTFNNFNRDKRTFVILFSNVQNDMNDTFNQDFRKMANDLIEGK
>NZ_CP032365.1|WP_000724910.1|3417229_3418387_-|agmatine-deiminase-family-protein
MKKIVKFCLMATLSTTIISGCSFEGNNENAKGKESEKVEVQKNAGKYTMPDEKDKHEGTWLQWPHEFTYGEEYKQEVEPIWIKMASALTEGEKVHIVAYDEEEKERINKLLIDKGLNMDKIDFFISPTDDVWARDSGPIFVYDNNKNLKILDPAFNGWGKKTPYKNDARIRENVSKQSGIERIDWGKFVLEGGAIELDSNGTALLTRSAVTNKNRNPDLSEKDIETYISDLGVTNFIWLDGVPNLDITDFHIDGFAKFHGKSTIVTMKEDDLAEWGLSNKDMDALLDAKNASGQKYKYEYLPLSKDKVTLENGKVLDYKGSYINYYIGNTVVLVPNYNDPNDKIANDTIQKLYPDRKVVGIDVRELYKNGGMIHCVTQQQPIQLK
>NZ_CP032365.1|WP_000435527.1|3415874_3416852_-|hypothetical-protein
MEQKHNGIIFTAIPDKSNAYYRPFYEDLIYFNEYLNENKAFTDQLISLSVEEQGFHTSSFEYDDIWLRDVAPVVTSHLVKFKYRPNYLPKDQGRYLDQQFNKWLKKNDFEYVKSPLILDGGNLIWNKKDTVILTERIFDDNYEWTEEEIIEQLEWDLDVSRVIIIPAEEGDVLAHADGMVKFIDEHTMFISDFLGDHEFRYNVQEIIQEQMPEAEFIVVPSSYTEKGQYDQEIASAKGLYINMLETCETIYVPKFGLAKDREVLRYIQQHTEKQAIQIHVGEISTMGGAINCLTWYCPHHLLPSKMKSLKNQNGDFSVRKIFDWF
>NZ_CP032365.1|WP_000288085.1|3415077_3415836_-|MerR-family-transcriptional-regulator
MYTITEFSRICKMSTRMLRHYDKEDILKPAYVNPENGYRYYEQGQLEIALKIKKLREYKFPLPKIKIILQSSDQDSFVKHMQAQIIELSHEVKQNLQVISEMNEMVSMNNGLNIARNRNYDIFIGMRNEITVIAQRLQINIDDMDDYFYDLYEKVQKSNFQIVGSPSTVFYDEEYIPNQSEIELRIPVMHRNNKDVVQEYEIKKLNPHQIVTTMHYGSYDYIGYAYIALEKWIERNGYVIEDSPYEVYVKGN
>NZ_CP032365.1|WP_000599316.1|3413312_3414443_-|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MILAKKVRLIPTPEQEKVLRNHAGAARFAYNYCKRMSDRYYKLFGKSVSQLALQKRFTKIKKQKRYEWLNDINAQVPKQASKDFDTARKNSFKKYKNGYHTSYKSKKDLIQGFYANYERLIIGKKVVHIQSIGEVKTSQQLPRNKKPSNPRVTFDGRHWWMSVGFQEDFELQELTNESIGVDVGLKELFVASNGMKERNINKDAKVKKLLKRKKSTQRDMSRRFKKGVKIQSAGYEKAKAEHLRLSRKITNIRNNHIHQATAKLVKTKPMRIVVEDLSISSLLKNKKLSKAFSFQKLNFFFQCLSYKCEKYGIEYVKADKWFASSKICSCCGGKYDHSVQPEGQWSLKIREWDCVGCNSHHDRDVNAAINLSRWVK
>NZ_CP032365.1|WP_000831433.1|3411275_3413018_-|amidohydrolase
MKRTIMIVCLILSVTWVSACTPGVGEGENGSFVLPNQLPKNVVFKNGTIYTSNGKQDIVEAVAVKEGKITFVGSNKDVEGFINEDTKVVDLQGRFILPGFVDNHNHIFEAKSPAAGNCSVSSDASLQKQRSYLKACKKDVKDGEWISGTGFSLEELLKDMDEKSEQQTPLQVLDELFPNNPVLIMERTSHSVWVNSKALELAGINKDTKDPQGGRIIRDPETGEPFGILYDTAGDIVMEKAWNSQPNLFEKNYEGLLDGLDEVAKNGITTVGDGRLYWKRGWLDVWNKVNDEKKLTSRVVLRPWVYPNLNEAEQMEYFKKIKRDDVSSRMLINQVKMYSDGISINSTAKILEKYKFEWFKGTPYGLNYIPEEKMKWWLSELNKIGYGALIHTIGDGGVRESLNAIEAAKKEGANQPYTLTHVEMVEDSDINRFAKLGISADFQVGHDFAEDPKQSWASTYFSDQQMKRIMPLGRIWKTGANVSLSSDWDVNELNPLVTISNALSIDEKGLSDVYAAIDAYTIKPAKALGLDTITGSIEVGKSADMVLLNEDITKMSADKIPNAKVLVTVLQGEVVYHKEK
>NZ_CP032365.1|WP_000417242.1|3426124_3426778_-|hypothetical-protein
MEKYHGKSTEQIIQKLMPGSVRSSVVMVWVVINFMILTPFLFPPTFTIYLYVILPFLFIANIWGGWVFFCKPNEPRLVHILYNGFMGITFSFGSFIVIQKIAYTFIEIETPLFFIVTFVLYIFTIYKLISIGVKSFLKRLNNEENDNIKISPIVYLSGLGYVIGQICIGTLSQNGLATVLILVFSLLAVVCSVYGVYIWVYVDLKRKEMDGMHNGQI
>NZ_CP032365.1|WP_033658719.1|3426794_3427046_-|hypothetical-protein
MGVGTTAVSAFAGAKAGALVGTFLGGPIGTVAGACIGFGVSIGASIVTDGIKFNKGDWNHDGKQDSIKDRVKSGIGAVLDKIF
>NZ_CP032365.1|WP_000839988.1|3427386_3429006_-|FAD-dependent-monooxygenase
MKSNDVPVLIVGGGLSGLASALFLAKHNINYLLLERHQSTAIHPKAGGITFRTMELFRELGLEQRIRLAGKALENCRGRIAVHTIAEANKEELAQMRANQYGNDEKLLQKIEGISPSKQTACYQIILEEMMLQKARTLGGELSFYHELVSYEQNEHGVIATIRNRETEEESIIHCDYVIAADGANSKIREQLGISTEGRGTIGGYYMNIYFEADLSVFIQGDAFGFTMVLHPEVLGALIPVDNERKWIYHVSYDPLKGEGPEDFTIERCKQIIQTAIGSTNVEPEIVSVLPWEATESTATKFQDNRIFLVGDSAHIMPPTGGFGSNIGIQDAHNLAWKLAAVIKGKANPKLLETYHKERYPVAKLTTDYASSLLFHAANREEGSLNNMDGLAVTVGYQYCSEAIIDDSVTPHRMDSVELNGRPGTRAPHFFGTYDGKEISILDLLGNDFVLLTIAENRTWAECVQNVSSTLGINIKFYSVGLRGDFIAQEDIFSKLYGIENGGAVLIRPDGFIGWRSEKEVVNLDVVLEEVMVNLLCDF
>NZ_CP032365.1|WP_000571880.1|3429522_3429867_+|winged-helix-turn-helix-transcriptional-regulator
MIEMNKQEQLNVIKKDFIDSQKVLLAIGDETRQAILLVLMETECQTGLRVGEITKQTHLSRPAVSHHLRILREAGIILMRKEGTKNFYYIDIRTKLGVLKNLVLDIEKLLHNFY
>NZ_CP032365.1|WP_000646394.1|3429885_3430884_+|NADP-dependent-oxidoreductase
MKAMIIDKYGKFPMLMAEVPTPEINEYEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPLILGNDFSGVIVQVGSKVTHFKVGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEEAASIPLVGLTSYQALHDIMHLQKGQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGANLVTSLGADEIINYKTENFEEILKDYDAVFDTIGGTTLEKSFNIIKSGGNIVSVSGMPNARFGKEFGSGFFKTLLFSLASKKITALEKKHNAQYSFLFMKPSGDQLRTIANYIEDGKIKPVIDRVFPFEDAQKAMEYSEAGRAKGKIIVKIK
>NZ_CP032365.1|WP_000164934.1|3431062_3432529_+|YdiU-family-protein
MTKNNEVGWNLDNSYATLPQSFYTDIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEDAHPLAQAYAGHQFGHFNMLGDGRALLIGEQITPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTSLLQEVIKGQASLIAKWQLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEVEEEALKIAQDEISKFSVQYENQWFIGMKKKLGLFNNEEQDHSLIEQLLKMMEKYKADYTNTFRSLTLDTIENTALFKSPEFKEWYKLWQSRLERQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALSNPYAYSTEQEEYCVPPVPTNRPYRTFCGT
>NZ_CP032365.1|WP_000495320.1|3432833_3433946_+|tetratricopeptide-repeat-protein
MFTSTKSEQITQLLNEWYIEIRSRHINNATRLKEQIDIKINELKTTSQEIGQDQNLLLYYSLLDFRYNYLIDNLGVSKASFNQVESFEIPTNNFLSYYYHFFKAIHSDAVGNYVLAKEHYYKAEASLQYVPDELEKAEFYYKLGYSYYDNQQALQAIKEVTKAKDMFSNQSGYELNTAFCDNILGLACTYLKEWELAEEHFTAAMDQFQKISEKRFILMVRHNLGWMYATQNLSALAIRYLSEVVEQSPTHYKAIYVKAKEHYKINQPDIAHDLIEKGINICNKLEQKEYQHRNFILREMNNNSPAEELEKVILAGISYFNNEELYDNVQEYYETLATKFHEENQHSKASEYFYLALQARQKSFEKGALK
>NZ_CP032365.1|WP_000275779.1|3434274_3434880_-|FMN-binding-negative-transcriptional-regulator
MYIPKYFAIEDEKMKYEIMEQNSFATLFSQHNGEPYATHLPLLLNKETLTLHGHFARPNEQWKDSGNQQVLAIFQGPHSYISPSWYETNNAVPTWNYVAVHVYGELEIVEDEQELIDSLQDLVHTYENPKSTYSLDDVDPNYMGGLSKGIVGFKIKISKIEGKAKLSQNHSVERRKLVVEELEKVGSEGSKGIAKSMRSFL
>NZ_CP032365.1|WP_000813618.1|3435021_3435549_-|GrpB-family-protein
MKQRITIEEYNTKWESEFNKLQTIINDAMEELVLSVEHVGSTAVKGLVAKPILDIDIVIEDYEIFHEVVKGLETIGYYHQADWSFEGREVFGRKNAFVPWNGESTVWMEHHLYVCDKNSEELRRHIAFRDYLREHEDVAAEYGRLKKELARESKNRASYSEGKTAFITSILKEIN
>NZ_CP032365.1|WP_001172043.1|3435572_3435920_-|DUF4260-domain-containing-protein
MQKRIVHFEGLVVFLATIYTYSIYEFSWIIFWVFLLAPDLSMLAYGINNRVGANIYNLCHTYIISILIAIIGVYFKIDTVIMIGLIWTAHIGMDRMFGYGLKYETDFKDTHIQRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP032365_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP032365_3

3717233-3719473

Orphan

Consensus_repeat	Method
NGGTAACACNGGCGCTAC	CRT

57 spacers

The CRISPR arrays of NZ_CP032365_3

>merge|NZ_CP032365|3|3717233-3719473|CRT
AGGTAACACAGGCGCTACTGGCGCTACTGGTGCCACTGGGCCTCAAGGTAACACGGGCGCTACCGGTGCTACTGGGCCTCAAGGTAACACGGGCTCTACTGGTGCCACTGGACCTCAGGGTAACACAGGCGCTACCGGACCTCAGGGCGTTCAAGGTAACACAGGCGCTACTGGTGCTACTGGGCCTCAAGGTAACACGGGCTCTACTGGTGCCACTGGACCTCAGGGTAACACGGGCGCTACCGGTGCTACTGGACCTCAGGGCGTTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCGAGGTAACACAGGCGCTACCGGACCTCAAGGTGCTCAAGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGCGCTACCGGACCTCAGGGCGTTCAAGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGTGCTACCGGTGCCACTGGACCTCGAGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGCGCTACTGGTGCTACTGGGCCTCAAGGTAACACGGGCTCTACTGGTGCCACTGGACCTCAGGGTAACACGGGCGCTACCGGTGCTACTGGGCCTCAAGGTAACACGGGCGCTACCGGTGCTACTGGACCTCAGGGCGTTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGTGCTACCGGTGCCACTGGACCTCGAGGTAACACAGGCGCTACCGGACCTCAAGGTGCTCAAGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGCGCTACCGGACCTCAGGGCGTTCAAGGTAACACAGGCGCTACCGGTGCTACTGGACCTCAAGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGCGCTACCGGTGCTACTGGACCTCAGGGTAACACAGGTGCTACCGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACGGGCGCTACCGGTGCTACTGGACCTCAGGGCGTTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACGGGCGCTACCGGTGCTACTGGACCTCAGGGCGTTCAAGGTAACACGGGCGCTACCGGGCCTCAGGGTATTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGCGCTACCGGTGCTACTGGACCTCAAGGTAACACGGGCGCTACCGGGCCTCAGGGTATTCAAGGTAACACGGGCGCTACCGGGCCTCAGGGTATTCAAGGTAACACGGGCGCTACTGGACCTCAGGGTGCTCAAGGTAACACAGGCGCTACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACCGGGCCTCAGGGTATTCAAGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGACCTCAAGGTGTTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGTGCTACCGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGTGCTACCGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGTGCTACCGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGCGCTACCGGTGCTACTGGACCTCAAGGTAACACGGGCGCTACCGGGCCTCAGGGTATTCAAGGTAACACGGGCGCTACTGGACCTCAGGGTGCTCAAGGTAACACAGGCGCTACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACCGGGCCTCAGGGTATTCAAGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGACCTCAAGGTGTTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAGGGTAACACGGGCGCTAC

>NZ_CP032365|3|1|3717233-3719473|CRT
AGGTAACACAGGCGCTAC	TGGCGCTACTGGTGCCACTGGGCCTCA
AGGTAACACGGGCGCTAC	CGGTGCTACTGGGCCTCA
AGGTAACACGGGCTCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGCGCTAC	CGGACCTCAGGGCGTTCA
AGGTAACACAGGCGCTAC	TGGTGCTACTGGGCCTCA
AGGTAACACGGGCTCTAC	TGGTGCCACTGGACCTCA
GGGTAACACGGGCGCTAC	CGGTGCTACTGGACCTCAGGGCGTTCA
AGGTAACACGGGCGCTAC	TGGTGCCACTGGACCTCG
AGGTAACACAGGCGCTAC	CGGACCTCAAGGTGCTCA
AGGTAACACAGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGCGCTAC	CGGACCTCAGGGCGTTCA
AGGTAACACAGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGTGCTAC	CGGTGCCACTGGACCTCG
AGGTAACACAGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGCGCTAC	TGGTGCTACTGGGCCTCA
AGGTAACACGGGCTCTAC	TGGTGCCACTGGACCTCA
GGGTAACACGGGCGCTAC	CGGTGCTACTGGGCCTCA
AGGTAACACGGGCGCTAC	CGGTGCTACTGGACCTCAGGGCGTTCA
AGGTAACACGGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGTGCTAC	CGGTGCCACTGGACCTCG
AGGTAACACAGGCGCTAC	CGGACCTCAAGGTGCTCA
AGGTAACACAGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGCGCTAC	CGGACCTCAGGGCGTTCA
AGGTAACACAGGCGCTAC	CGGTGCTACTGGACCTCA
AGGTAACACAGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGCGCTAC	CGGTGCTACTGGACCTCA
GGGTAACACAGGTGCTAC	CGGTGCCACTGGACCTCAAGGTGTTCA
AGGTAACACGGGCGCTAC	TGGTGCCACTGGACCTCAAGGTGTTCA
AGGTAACACGGGCGCTAC	CGGTGCTACTGGACCTCAGGGCGTTCA
AGGTAACACGGGCGCTAC	TGGTGCCACTGGACCTCAAGGTGTTCA
AGGTAACACGGGCGCTAC	CGGTGCTACTGGACCTCAGGGCGTTCA
AGGTAACACGGGCGCTAC	CGGGCCTCAGGGTATTCA
AGGTAACACGGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGCGCTAC	CGGTGCTACTGGACCTCA
AGGTAACACGGGCGCTAC	CGGGCCTCAGGGTATTCA
AGGTAACACGGGCGCTAC	CGGGCCTCAGGGTATTCA
AGGTAACACGGGCGCTAC	TGGACCTCAGGGTGCTCA
AGGTAACACAGGCGCTAC	TGGACCTCAAGGTGCTCA
AGGTAACACAGGTGCTAC	CGGGCCTCAGGGTATTCAAGGACCTCA
AGGTAACACGGGCGCTAC	TGGCGCTACCGGACCTCAAGGTGTTCA
AGGTAACACGGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGTGCTAC	CGGTGCCACTGGACCTCAAGGTGTTCA
AGGTAACACGGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGTGCTAC	CGGTGCCACTGGACCTCAAGGTGTTCA
AGGTAACACGGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGTGCTAC	CGGTGCCACTGGACCTCAAGGTGTTCA
AGGTAACACGGGCGCTAC	TGGTGCCACTGGACCTCA
GGGTAACACAGGCGCTAC	CGGTGCTACTGGACCTCA
AGGTAACACGGGCGCTAC	CGGGCCTCAGGGTATTCA
AGGTAACACGGGCGCTAC	TGGACCTCAGGGTGCTCA
AGGTAACACAGGCGCTAC	TGGACCTCAAGGTGCTCA
AGGTAACACAGGTGCTAC	CGGGCCTCAGGGTATTCAAGGACCTCA
AGGTAACACGGGCGCTAC	TGGCGCTACCGGACCTCAAGGTGTTCA
AGGTAACACGGGCGCTAC	TGGTGCCACTGGACCTCAGGGTAACACAGGCGCTACTGGTGCCACTGGACCTCA
GGGTAACACGGGCGCTAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP032365.1\|WP_000704620.1\|3723788_3725648_-\|PTS-transporter-subunit-EIIA	unknown	unknown	gnl\|CDD\|182066
NZ_CP032365.1\|WP_000181498.1\|3714269_3714407_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_074651352.1\|3729620_3729959_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_074651371.1\|3726572_3727379_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP032365.1\|WP_000460296.1\|3710915_3712187_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP032365.1\|WP_000312271.1\|3713546_3714170_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP032365.1\|WP_001179097.1\|3727480_3728644_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP032365.1\|WP_000450306.1\|3715656_3716622_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308
NZ_CP032365.1\|WP_000228316.1\|3728760_3729303_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NZ_CP032365.1\|WP_000391404.1\|3712179_3713454_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP032365.1\|WP_000656785.1\|3710350_3710740_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP032365.1\|WP_000814419.1\|3722201_3722447_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_167514913.1\|3707704_3708853_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP032365.1\|WP_000734618.1\|3722509_3723442_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NZ_CP032365.1\|WP_000640837.1\|3725661_3726573_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP032365.1\|WP_000438186.1\|3714437_3715394_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP032365.1\|WP_078182958.1\|3707498_3707666_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_000813896.1\|3720820_3721045_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP032365.1\|WP_000135336.1\|3708967_3710302_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP032365.1\|WP_000504945.1\|3721066_3722020_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626

Protein	Function_ID	Function_description	E-value
NZ_CP032365.1\|WP_000704620.1\|3723788_3725648_-\|PTS-transporter-subunit-EIIA	gnl\|CDD\|182066	PRK09765, PRK09765, PTS system 2-O-a-mannosyl-D-glycerate specific transporter subunit IIABC; Provisional.	7.86227e-144
NZ_CP032365.1\|WP_074651371.1\|3726572_3727379_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	1.17015e-80
NZ_CP032365.1\|WP_000460296.1\|3710915_3712187_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP032365.1\|WP_000312271.1\|3713546_3714170_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	5.30813e-60
NZ_CP032365.1\|WP_001179097.1\|3727480_3728644_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP032365.1\|WP_000450306.1\|3715656_3716622_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	1.18739e-12
NZ_CP032365.1\|WP_000228316.1\|3728760_3729303_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	1.75148e-56
NZ_CP032365.1\|WP_000391404.1\|3712179_3713454_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP032365.1\|WP_000656785.1\|3710350_3710740_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.85689e-23
NZ_CP032365.1\|WP_167514913.1\|3707704_3708853_+\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	5.34946e-47
NZ_CP032365.1\|WP_000734618.1\|3722509_3723442_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	2.81281e-35
NZ_CP032365.1\|WP_000640837.1\|3725661_3726573_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	4.65134e-143
NZ_CP032365.1\|WP_000438186.1\|3714437_3715394_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	3.42759e-156
NZ_CP032365.1\|WP_000813896.1\|3720820_3721045_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP032365.1\|WP_000135336.1\|3708967_3710302_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP032365.1\|WP_000504945.1\|3721066_3722020_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	8.46059e-166

>NZ_CP032365.1|WP_000450306.1|3715656_3716622_+|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISSDEEKRLKHIITSLEGLSEKQRPVRPLLMDRNVAILNLLIDYGLSLQELTALTMHHVHFETNTFSIPATAGVERTITLTNEDKKQLYTYYKSIPEPVRPKYHSHDPLFIAFDFNRGTYRWVYENDAPKGLTEIAIQKMIRLEVSRANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKVSLKRYYQYAENRKNALS
>NZ_CP032365.1|WP_000438186.1|3714437_3715394_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISSETTTKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEIGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFSDYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDTYDKYDLIGISSCDLMLEEETHST
>NZ_CP032365.1|WP_000181498.1|3714269_3714407_+|hypothetical-protein
MTNHVNKGAQKSSVGQIGHDSNSAHEKSAKMERFHKSYQEKAKKE
>NZ_CP032365.1|WP_000312271.1|3713546_3714170_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTKERSVHK
>NZ_CP032365.1|WP_000391404.1|3712179_3713454_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRVDEIKKQLAGVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYVGHEKTVKRLLSELEISHIPIITLYNKKDELHQNFIPFPKSDFLMTSAFEQSDLLHIKEAIETKMKEEMNRYQVEIPPSEGKLLTLLKTETLLTKMEFLEEKFVYDCVGYIFAHSSLNVQLKRFLVEEGENKNV
>NZ_CP032365.1|WP_000460296.1|3710915_3712187_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGLVDFGAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NZ_CP032365.1|WP_000656785.1|3710350_3710740_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKVNQTETVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP032365.1|WP_000135336.1|3708967_3710302_-|type-I-glutamate--ammonia-ligase
MARYTREDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLFPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFDGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALITLQSNEVVCGALGDHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP032365.1|WP_167514913.1|3707704_3708853_+|site-specific-integrase
MMASFRKFGDVWEFRVRFKDPYTQKYKEKSKRGFKTKKEAQLAAAEEEKKLLNGLEVEITPTSLKHYLRDWLKLFKQDNVRKNTFILHERNIEKHIIPYFQNMNLKELKPMMYQKFINSLTDQGYSKRTVQIIHGTMNNAMKKAVSLKKIENNPCEEVVISNKNNKEREGLKYMRSEDITLFLKTSYQYNYIYYIFFKALLNTGMRKGEAAALQWKDINLKEHTITISKTLDFTAKTKEELFGDTKTFTSKRTIMIPKSLVDELLAHKKWQNANKLVLQDAYEHELDLVFSRVDGNFLPKSTLFNAFSRILKKANLPRLEIHSLRHTHAVLLLESGASMKYIQDRLGHKSIEITANVYSHISDKINKDSISGFEAYMNNVLG
>NZ_CP032365.1|WP_078182958.1|3707498_3707666_+|hypothetical-protein
MIIDLNAEREKRKKRTIKQEEFKKIPIVEKIHIVDGEIKYEISGYKETPVKWLDD
>NZ_CP032365.1|WP_000813896.1|3720820_3721045_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP032365.1|WP_000504945.1|3721066_3722020_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKEEMDGIPHYMVDIKNPEESFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDTIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQLEKQENELLYDVSLIGLTMDREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFEDRVSLEEAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTGGEKTSEILRYIEGKLQLKSNNSK
>NZ_CP032365.1|WP_000814419.1|3722201_3722447_+|hypothetical-protein
MKQSTINFSSLTKDLILATATKEQNCSQEELYFALNCLLRSFHSTLQETTLHPENKNTEYIQNQFCSAYKIITGKTIYPFQ
>NZ_CP032365.1|WP_000734618.1|3722509_3723442_-|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPTVESKLVGKMLSGNKLDVINTENGWAKIKLNGKEAFVSAEFTKSTYYVTAGVLNVRAGANTDSEILGKLNKDDVIETTNQVQNEWLQFDYNGKTGYVHMPFLTGTVPVIEKKEVVTQEEAPVRVNTPVKNNKVVKNKESVKNVESSKPVAKQQSTTKQVTKSTETSAPAGGREITVEATAYTAHPSENGTYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSADSWGRKSVKVKVIK
>NZ_CP032365.1|WP_000704620.1|3723788_3725648_-|PTS-transporter-subunit-EIIA
MKITELLKRDTVIMNLTASNKEAVIDELVEKLDGANRLNSKAEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDEEELLRLFDEKENEKEEEDIEVAKPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNALTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEALLNRAVKQDAPIFKGIKEDGKTESTEKEKGLGIYKHLMNGVSNMLPFVVGGGILIALAFWIGGIKAEGPLAELLMSIGGGKTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAHANAGFLGGLIAGFLAGYVVLGLKKLFSGLPAQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGGMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPIRVIVSCVVGSSVAGALSMLFQITLPAPHGGLFVIALVNKPVLYIFSIFIGTVISALMMGIWKKKVK
>NZ_CP032365.1|WP_000640837.1|3725661_3726573_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSFDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENVALGFTGGFTGRFIKDVLQAEGVTTNFVQVDGDSRINVKIKGQEETELNGQGPSVTNGQFEQLMKQIESMRQGDCVVLAGSLPASIPTTFYESIAAFGAEKGIRVVVDASGSALHHVIKNKPFLIKPNHHELGELFGVEISTVEDILPYGRKLVEQGVEHVIVSMAGDGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCEKEKVEELLSQVIVTKR
>NZ_CP032365.1|WP_074651371.1|3726572_3727379_-|DeoR/GlpR-transcriptional-regulator
MVDFCDRFHYTVIKEEVNKMLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIANYAASIVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTFANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADK
>NZ_CP032365.1|WP_001179097.1|3727480_3728644_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKDINAEVFELTGVEPNPRVSTVRKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKAFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPVHTASVPKDQTIYGMVDIMSHVLEQYFHHGTNTALQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVLDENVSRFKQFAIRVFHVETDGKTDREVALEGIEALRQFWTSIEAPVTLADYAIGENEIYLMADKAMAYGEFGNFKKLNKDDVLSIYKASL
>NZ_CP032365.1|WP_000228316.1|3728760_3729303_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NZ_CP032365.1|WP_074651352.1|3729620_3729959_-|hypothetical-protein
MVKKEGGMTMEEYVLELYNLLYTTEWQDIVSFLGIMFCMKIVIVYMEEQGMFYSFSSPFDVQREPLPNYAKVNYEQFPFVIFFMIQFITAIVKKKESDDEECHSTCNIATAF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP032365_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP032365_4

4973076-4973204

Orphan

Consensus_repeat	Method
AGCTACATCGGTTTCTTCCTACCGAACATATATCTTAAACAAACGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP032365_4

>merge|NZ_CP032365|4|4973076-4973204|CRISPRCasFinder
AGCTACATCGGTTTCTTCCTACCGAACATATATCTTAAACAAACGTTTGATTAACTCCCTATTTTTCTCTGTTCACCCTTGAGCTACATCGGTTTCTTCCTACCGAACATACATCTTAAACAAACGTTT

>NZ_CP032365|4|3|4973076-4973204|CRISPRCasFinder
AGCTACATCGGTTTCTTCCTACCGAACATATATCTTAAACAAACGTTT	GATTAACTCCCTATTTTTCTCTGTTCACCCTTG
AGCTACATCGGTTTCTTCCTACCGAACATACATCTTAAACAAACGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP032365.1\|WP_001002985.1\|4979919_4980168_-\|spore-coat-protein	unknown	unknown	gnl\|CDD\|377935
NZ_CP032365.1\|WP_001232989.1\|4980510_4981224_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP032365.1\|WP_000920744.1\|4974915_4975317_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_151035620.1\|4977686_4978700_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|379113
NZ_CP032365.1\|WP_000781217.1\|4970618_4970963_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_001180550.1\|4980181_4980367_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_000601756.1\|4969060_4970086_-\|methionine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224058
NZ_CP032365.1\|WP_000218969.1\|4972455_4972821_-\|arsenate-reductase-family-protein	unknown	unknown	gnl\|CDD\|239334
NZ_CP032365.1\|WP_000475827.1\|4974060_4974300_-\|DUF3937-family-protein	unknown	unknown	gnl\|CDD\|372461
NZ_CP032365.1\|WP_000929162.1\|4965663_4966449_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NZ_CP032365.1\|WP_000026896.1\|4972030_4972414_-\|glycine-cleavage-system-protein-GcvH	unknown	unknown	gnl\|CDD\|234918
NZ_CP032365.1\|WP_000722406.1\|4966687_4967494_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP032365.1\|WP_000735093.1\|4967565_4968378_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP032365.1\|WP_000826870.1\|4976312_4976840_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_000640866.1\|4971429_4971774_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224572
NZ_CP032365.1\|WP_001022082.1\|4975453_4975843_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_033658943.1\|4973565_4973946_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_000713746.1\|4976983_4977631_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239481
NZ_CP032365.1\|WP_000568171.1\|4971117_4971417_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_CP032365.1\|WP_000359548.1\|4968402_4969068_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922

Protein	Function_ID	Function_description	E-value
NZ_CP032365.1\|WP_000026896.1\|4972030_4972414_-\|glycine-cleavage-system-protein-GcvH	gnl\|CDD\|234918	PRK01202, PRK01202, glycine cleavage system protein GcvH.	6.96592e-70
NZ_CP032365.1\|WP_001232989.1\|4980510_4981224_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	6.29391e-17
NZ_CP032365.1\|WP_001002985.1\|4979919_4980168_-\|spore-coat-protein	gnl\|CDD\|377935	pfam07875, Coat_F, Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.	5.77062e-15
NZ_CP032365.1\|WP_151035620.1\|4977686_4978700_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|379113	pfam13303, PTS_EIIC_2, Phosphotransferase system, EIIC. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The sugar-specific permease of the PTS consists of three domains (IIA, IIB and IIC). The IIC domain catalyzes the transfer of a phosphoryl group from IIB to the sugar substrate.	1.43278e-86
NZ_CP032365.1\|WP_000601756.1\|4969060_4970086_-\|methionine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224058	COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism].	1.97418e-176
NZ_CP032365.1\|WP_000218969.1\|4972455_4972821_-\|arsenate-reductase-family-protein	gnl\|CDD\|239334	cd03036, ArsC_like, Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine.	1.79515e-60
NZ_CP032365.1\|WP_000475827.1\|4974060_4974300_-\|DUF3937-family-protein	gnl\|CDD\|372461	pfam13073, DUF3937, Protein of unknown function (DUF3937). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.	2.93356e-27
NZ_CP032365.1\|WP_000929162.1\|4965663_4966449_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	5.15323e-150
NZ_CP032365.1\|WP_000713746.1\|4976983_4977631_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239481	cd03386, PAP2_Aur1_like, PAP2_like proteins, Aur1_like subfamily. Yeast Aur1p or Ipc1p is necessary for the addition of inositol phosphate to ceramide, an essential step in yeast sphingolipid synthesis, and is the target of several antifungal compounds such as aureobasidin.	3.86858e-16
NZ_CP032365.1\|WP_000722406.1\|4966687_4967494_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	4.5786e-112
NZ_CP032365.1\|WP_000735093.1\|4967565_4968378_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	3.06943e-112
NZ_CP032365.1\|WP_000640866.1\|4971429_4971774_-\|hypothetical-protein	gnl\|CDD\|224572	COG1658, COG1658, Small primase-like proteins (Toprim domain) [DNA replication, recombination, and repair].	1.63089e-22
NZ_CP032365.1\|WP_000568171.1\|4971117_4971417_-\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	7.24813e-19
NZ_CP032365.1\|WP_000359548.1\|4968402_4969068_-\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	6.24647e-98

>NZ_CP032365.1|WP_000218969.1|4972455_4972821_-|arsenate-reductase-family-protein
MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASEDEMYELLASDGMLIKRPIVTNGTNVTLGFNEEQFESVWKKYQ
>NZ_CP032365.1|WP_000026896.1|4972030_4972414_-|glycine-cleavage-system-protein-GcvH
MSIPNNLRYSEEHEWVKTEGNEVVIGITHFAQGELGDIVFVELPEVGATIEADEPFGSVESVKTVSELYAPVSGKVVAVNEELSDQPELVNESPYEGAWMVKVELSDASQVEKLLTAEKYAEMTNQD
>NZ_CP032365.1|WP_000640866.1|4971429_4971774_-|hypothetical-protein
MIYVEKVIIVEGKSDRRKIESIIREPVEIVCTNGTIGLSKMDELIDQFFDKEVYVLVDADDAGEKLRKQFRKEFPQAEHIYIDRSYREVATAPSSHLANVLWGADIDVYTEYLR
>NZ_CP032365.1|WP_000568171.1|4971117_4971417_-|thioredoxin-family-protein
MIDWTGAEATALIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEDLKIGMLDLNYAPHLAKEYGIESVPCLLVFENGTLMKKIYAFHSVEYLYTELK
>NZ_CP032365.1|WP_000781217.1|4970618_4970963_-|hypothetical-protein
MKLYSLLQSFVNYANGQYHLEPLLRQGEKTVNFRFGDESCSLQISRDYIELLHEERGTEQIVCVDEEDVKQLVNGNVRLQMLMNDGRVQYSGTYRTMLLVESMFHICKPMSVGA
>NZ_CP032365.1|WP_000601756.1|4969060_4970086_-|methionine-ABC-transporter-ATP-binding-protein
MILLENVKKIYKAKSGDVTAVDNANLKIDKGEIFGVIGYSGAGKSSLIRLFNQLEKPTSGQITIANRVISAITGSELRKARQEIGMIFQHFNLLWSRTVRENIEFPLEIAGVDKAKRRKRVDELIHLVGLEGRGDAYPSQLSGGQKQRVGIARALANNPQVLLCDEATSALDPETTDQILDLLLDINKRLGLTIVLITHEMHVIRKICNRVAVMEKGKIVETGPVLDVFRNPQKDITKRFVQQLTDSEDTNETIESLIEKYPDGKVVRLQFIGEAVERPVLQRLMQRSDIEVSILQGNIAQTNNGSYGSLVVHLNGEETAIQQAIEGIHQDQVELEVIAHG
>NZ_CP032365.1|WP_000359548.1|4968402_4969068_-|ABC-transporter-permease
MDKLLTNIDWNQMLEATGETLYMTAIAALATFVLGLILGLLLFMTAKDNLWENKSVNTAIGAFVNIFRSIPFIILIILLIPFTKILLGTILGASAALPALIIGAAPFYARMVEIALREIDKGVIEASKAMGAKTSTIILKVLIPESLPALVSGITVTTIALVGYTAMAGVVGAGGLGTLAYLEGFQRGNNDVTIVATICVLLVVFFIQWIGDSVTTRIDKR
>NZ_CP032365.1|WP_000735093.1|4967565_4968378_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKLLLTALISTSIFGLAACGGKDKDEKKLVVGASNVPHAEILEKAKPLLEKKGIELEVKKFQDYVLPNKSLADKDLDANYFQHIPYLEKEMKDKKYDFEIAGKIHLEPIGVYSQKYKSLKELPDGATIIMSNSVTDHGRGLAILQKEGILKIKDGVDPVSATPKDIADNPKNLKFKTDIEPGLLPQVYNNKEGDAVLINSNYAIDAKLNPEKDAIAIEGDDSPYANVLVVRKGDKDKKGIKELVEVLHSKEIEDFINKEYKGAVVPVKE
>NZ_CP032365.1|WP_000722406.1|4966687_4967494_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKILLSVVTALSVFTLAACGGKEENKLVVGASNVPHAVILEKAQPILEKKGIKLEIKKFQDYVLPNKALADKEIDANYFQHIPYLDKEIQEKGYKIVNAGKIHLEPMGIYSKKYKSLKELPDGGTVIMSNNVAERGRMLALLQKGGVIKLKDGVDVVKATVKDVVENPKNLKFKTDVEPGLSPKLYENNEGDALFINSNYAIDAKLNPTKDAIAIEGSDSPYANIIAVRKGDEKKKEIKELVEVLHSKEIQDFINKEYKGAVLPVSE
>NZ_CP032365.1|WP_000929162.1|4965663_4966449_-|Fe-S-cluster-assembly-ATPase-SufC
MAGSTLTVKDLHVSIDGKEILKGVNLEVKGGEIHAIMGPNGTGKSTLSSAIMGHPKYEVTEGSIIIDGEDVLEMEVDERAQAGLFLAMQYPSEISGVTNADFLRSAINARREEGDEISLMKFIRTLDKNMEFLEMDPEMAQRYLNEGFSGGEKKRNEILQLMMIEPKIAILDEIDSGLDIDALKVVSKGINQMRGEEFGCLMITHYQRLLNYITPDFVHVMMNGRIVKSGGPELAQRLEAEGYDWIKKELGIEDETAEQEA
>NZ_CP032365.1|WP_033658943.1|4973565_4973946_-|hypothetical-protein
MITLRKFLISYAASLLTFIIIWFLIPYISDPSYSNENGLPNIVGFIVILIIFGSVLDLVACLIGEVLYRNIKQCRKFRVGIPVFIGLSLIYIFILSLFTITSAYASSLVAPIIMGSLAFYVVRRKI
>NZ_CP032365.1|WP_000475827.1|4974060_4974300_-|DUF3937-family-protein
MFKNKKLIRFGLTLLVCLFVIDFTIGYFQAYLESAGIKWIISETWRTILLDAPEGILVILGAIALYDFTKETSPKDASI
>NZ_CP032365.1|WP_000920744.1|4974915_4975317_-|hypothetical-protein
MLKTIKNTLLFVLCLVVLSGCFTREGTIVGGKVHGSSDSVSGSISGDYRKFTGYATQDRKVKKGENWIFSFTDKTKQGTIKAYVLDSNDNTILEVTSGNNKNNIKVSKDDTYKVKIITEEHGGEFEISWKKEK
>NZ_CP032365.1|WP_001022082.1|4975453_4975843_+|hypothetical-protein
MNIKIVDISDKLLDGYKVLVQVDSNQFIAEWDGDKPEKHENYNVEIHIDNEFIWNTNITFSDKNANAIIQNSKGFKVIAKLDYNSEDSLATLNIYDSIILIDVEGIEQDIANEWVEMQCTSIKIFNTNF
>NZ_CP032365.1|WP_000826870.1|4976312_4976840_-|hypothetical-protein
MKRLSYFLFFILICLVGAGCAKDKEGEKLEYNGRALVIGVIGEKPKDTFRNIKFEEMKLEELEKKSKEVDGFLIMKDHFQEASTDQYKNVFSSLKKPVFFIGLQDKSYSIFTTKGIEYNSARKDVNAMYTQGFANIGSGEGQQWAVGLSNGGNTEESIHNMYIVVFQTIADYLNR
>NZ_CP032365.1|WP_000713746.1|4976983_4977631_+|phosphatase-PAP2-family-protein
MKKFKLSSFLPLSYILLLVLVSPLYDVLNKSAVHAVDVTTVVDDWIPFVKAFIIPYLLWFPYLYGALIYYCFADRKQYYATLSSVILGKLACFSIYYFWQTTVPRPTVVGSDVFSELVRYIYSIDQPVNCFPSIHVLTTFVIMLAAFKRREQHAFEYYILTFFGTLIILSTLFTKQHAFVDAISGMTLASILYFGVQLLLAKETVRVPVKQNHKM
>NZ_CP032365.1|WP_151035620.1|4977686_4978700_-|PTS-sugar-transporter-subunit-IIC
MKEYIMSRVFKASAGIAQGIFVSLGIGLLIENIGRIVDIPLLITIGVVAKSLMAPAIGAGIAFMLGANGLVIFSAMVAGAIGAGSISITEAGLIIKTGEPIGALLTATLAVYIGKRLSGKTALDMMLVPFAAILGSGLVGIWLSHNITPVLNTVGAFIKDSSAGSPFIASIVIAVVWGLLLISPASSAALAIALSLDGVAGGAALAGCVAQFIGFSVISAKENNLGGILAQALCTPKVQLPNITKNPMILVPTVVASAIVGPVSALIFQLEAGKEIAGLGLSSLIAPINLISSEGWEVVPAMVITYIIIPVAVSYILYIALKKAGRIQSGDMTVPQS
>NZ_CP032365.1|WP_001002985.1|4979919_4980168_-|spore-coat-protein
MNEKDMVNDYLAGLNASLTSYANYIAQSDNEQLHQTLIQIRNQDEMRQRNMYEYAKQKSYYKPAAPANPMIVQQLKGQLSAE
>NZ_CP032365.1|WP_001180550.1|4980181_4980367_-|hypothetical-protein
MQNLTELEVENLRHLIGGHATIINKLDQYAQACTDPQLKQMLQKDAQDARNTKQQLMTFLG
>NZ_CP032365.1|WP_001232989.1|4980510_4981224_-|CPBP-family-intramembrane-metalloprotease
MRKTVLDAYNAEREVDNITYKNLVVTIASILGFSLLGGLFLALALGIFGEEVLRAHLEGYYLLLFDAAVVTIVLFAYKPVLHFIKNIWDVSVLKNGKTYLYLLIGFIIIALTQYVMLELFSFESAEQQRDQLGSLGLQNSLQSIIYVLSVAIITPIKEEILYRGILYRFFEKKYSFLVGIIISSFIFGILHGGFPVTAMIMGIVFAMLYKKTQSIVPSIILHIVWNLLVSISMIVSL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP032365_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP032365_5

5238454-5238587

Orphan

Consensus_repeat	Method
TTCTCTTCTTTTTGAGACTTGTC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP032365_5

>merge|NZ_CP032365|5|5238454-5238587|CRISPRCasFinder
TTTTCTTCTTTCTTCGGCTCTTCTTTTTTGTCACTAGTCGAACCGCTTGTTGGTTTCTCTTCTTTTTGAGACTTGTCTTCTGTTTTATTTTCTGGTTTCGTGCTCGTTGACTTCTCTTCTTTTTGAGATTTGTC

>NZ_CP032365|5|4|5238454-5238587|CRISPRCasFinder
TTTTCTTCTTTCTTCGGCTCTTC	TTTTTTGTCACTAGTCGAACCGCTTGTTGGT
TTCTCTTCTTTTTGAGACTTGTC	TTCTGTTTTATTTTCTGGTTTCGTGCTCGTTGAC
TTCTCTTCTTTTTGAGATTTGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP032365.1\|WP_000457990.1\|5236382_5237384_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237563
NZ_CP032365.1\|WP_033658933.1\|5245270_5245981_-\|YwmB-family-TATA-box-binding-protein	unknown	unknown	gnl\|CDD\|370056
NZ_CP032365.1\|WP_000008907.1\|5238125_5238260_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP032365.1\|WP_000672644.1\|5242699_5243719_-\|stage-II-sporulation-protein-D	unknown	unknown	gnl\|CDD\|274332
NZ_CP032365.1\|WP_151035649.1\|5231657_5232425_-\|tyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|226870
NZ_CP032365.1\|WP_001185972.1\|5241196_5242204_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP032365.1\|WP_000144454.1\|5239469_5240174_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925
NZ_CP032365.1\|WP_000411269.1\|5243926_5245231_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NZ_CP032365.1\|WP_000170857.1\|5240173_5241016_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP032365.1\|WP_151035647.1\|5228095_5228689_-\|sugar-transferase	unknown	unknown	gnl\|CDD\|376775
NZ_CP032365.1\|WP_000940744.1\|5246026_5246263_-\|DUF1146-domain-containing-protein	unknown	unknown	gnl\|CDD\|227173
NZ_CP032365.1\|WP_088082079.1\|5246475_5247996_-\|NADH-quinone-oxidoreductase-subunit-NuoN	unknown	unknown	gnl\|CDD\|235603
NZ_CP032365.1\|WP_151035652.1\|5234245_5234923_-\|polysaccharide-biosynthesis-tyrosine-autokinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP032365.1\|WP_000931959.1\|5235289_5235724_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	unknown	unknown	gnl\|CDD\|234568
NZ_CP032365.1\|WP_000998945.1\|5247997_5249500_-\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NZ_CP032365.1\|WP_151035651.1\|5233225_5233969_-\|capsular-biosynthesis-protein	unknown	unknown	gnl\|CDD\|226453
NZ_CP032365.1\|WP_000544012.1\|5237545_5237818_-\|sporulation-transcriptional-regulator-SpoIIID	unknown	unknown	gnl\|CDD\|378813
NZ_CP032365.1\|WP_151035648.1\|5228747_5230562_-\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|224011
NZ_CP032365.1\|WP_151035650.1\|5232534_5233236_-\|polysaccharide-biosynthesis-tyrosine-autokinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP032365.1\|WP_074651571.1\|5249496_5251359_-\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836

Protein	Function_ID	Function_description	E-value
NZ_CP032365.1\|WP_000457990.1\|5236382_5237384_-\|rod-shape-determining-protein	gnl\|CDD\|237563	PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional.	0
NZ_CP032365.1\|WP_033658933.1\|5245270_5245981_-\|YwmB-family-TATA-box-binding-protein	gnl\|CDD\|370056	pfam08680, DUF1779, TATA-box binding. TATA-box_bdg is a family of bacterial proteins. YwmB from Bacillus subtilis contains a circularly permuted TATA-box binding protein-like fold. Jian-Xiang Liu, Qi Xie, Jun Lin. Protein Structural Data Mining and Evolutionary Bioinformatic Analysis on Domains of TATA-box Binding Protein-like Fold. Life Science Journal 2014; 11(2): 298-302 (not yet in PubMed 27-02-2014).	3.32616e-34
NZ_CP032365.1\|WP_000672644.1\|5242699_5243719_-\|stage-II-sporulation-protein-D	gnl\|CDD\|274332	TIGR02870, Stage_II_sporulation_protein_D, stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination].	8.91625e-136
NZ_CP032365.1\|WP_151035649.1\|5231657_5232425_-\|tyrosine-protein-phosphatase	gnl\|CDD\|226870	COG4464, CapC, Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	4.5386e-106
NZ_CP032365.1\|WP_001185972.1\|5241196_5242204_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.29227e-31
NZ_CP032365.1\|WP_000144454.1\|5239469_5240174_-\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	3.97068e-05
NZ_CP032365.1\|WP_000411269.1\|5243926_5245231_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NZ_CP032365.1\|WP_000170857.1\|5240173_5241016_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	4.46247e-90
NZ_CP032365.1\|WP_151035647.1\|5228095_5228689_-\|sugar-transferase	gnl\|CDD\|376775	pfam02397, Bac_transf, Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.	2.96611e-82
NZ_CP032365.1\|WP_000940744.1\|5246026_5246263_-\|DUF1146-domain-containing-protein	gnl\|CDD\|227173	COG4836, COG4836, Predicted membrane protein [Function unknown].	9.96402e-24
NZ_CP032365.1\|WP_088082079.1\|5246475_5247996_-\|NADH-quinone-oxidoreductase-subunit-NuoN	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	2.72519e-151
NZ_CP032365.1\|WP_151035652.1\|5234245_5234923_-\|polysaccharide-biosynthesis-tyrosine-autokinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	4.82551e-83
NZ_CP032365.1\|WP_000931959.1\|5235289_5235724_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	gnl\|CDD\|234568	PRK00006, fabZ, 3-hydroxyacyl-ACP dehydratase FabZ.	5.26499e-95
NZ_CP032365.1\|WP_000998945.1\|5247997_5249500_-\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	3.1736e-180
NZ_CP032365.1\|WP_151035651.1\|5233225_5233969_-\|capsular-biosynthesis-protein	gnl\|CDD\|226453	COG3944, COG3944, Capsular polysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane].	4.60504e-84
NZ_CP032365.1\|WP_000544012.1\|5237545_5237818_-\|sporulation-transcriptional-regulator-SpoIIID	gnl\|CDD\|378813	pfam12116, SpoIIID, Stage III sporulation protein D. This stage III sporulation protein is a small DNA-binding family that is essential for gene expression of the mother-cell compartment during sporulation. The domain is found in bacteria and viruses, and is about 40 amino acids in length. It has a conserved RGG sequence motif.	1.17272e-38
NZ_CP032365.1\|WP_151035648.1\|5228747_5230562_-\|polysaccharide-biosynthesis-protein	gnl\|CDD\|224011	COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	0
NZ_CP032365.1\|WP_151035650.1\|5232534_5233236_-\|polysaccharide-biosynthesis-tyrosine-autokinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	5.70198e-81
NZ_CP032365.1\|WP_074651571.1\|5249496_5251359_-\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0

>NZ_CP032365.1|WP_000008907.1|5238125_5238260_-|hypothetical-protein
MSFLFVLSTAIILLFVLFTLYYYIASKKEVPHHQLLEEELEREE
>NZ_CP032365.1|WP_000544012.1|5237545_5237818_-|sporulation-transcriptional-regulator-SpoIIID
MHDYIKERTIKIGKYIVETRKTVRVIAKEFGVSKSTVHKDLTERLPEINPELANEVKEILDYHKSIRHLRGGEATKQKYRKEDVEKPVRQ
>NZ_CP032365.1|WP_000457990.1|5236382_5237384_-|rod-shape-determining-protein
MFARDIGIDLGTANVLIHVKGKGIVLNEPSVVAIDRNTGKVLAVGEEARSMVGRTPGNIVAIRPLKDGVIADFEITEAMLKYFINKLDVKSFFSKPRILICCPTNITSVEQKAIREAAERSGGKTVFLEEEPKVAAVGAGMEIFQPSGNMVVDIGGGTTDIAVLSMGDIVTSSSIKMAGDKFDMEILNYVKRKYKLLIGERTSENIKIKVGTVFPGARSEELEIRGRDMVTGLPRTITVCSEEITEALKEDAAIIVQAAKGVLERTPPELSADIIDRGVILTGGGALLHGIDMLLAEELKVPVLIAENPMQCVAVGTGIMLENIDKLPKRALR
>NZ_CP032365.1|WP_000931959.1|5235289_5235724_-|3-hydroxyacyl-ACP-dehydratase-FabZ
MLNIEQIKEIIPHRYPFLLVDKILEVDEGKRAVGIKNVSANEEFFNGHFPDYAVMPGVLIVEALAQVGAVAVLKKEENRGRLAFFAGIDNCRFKKQVRPGDQLRLEVEMTRVRGPIGKGKAIATVDGEVACEAEITFAIGDKKE
>NZ_CP032365.1|WP_151035652.1|5234245_5234923_-|polysaccharide-biosynthesis-tyrosine-autokinase
MFGRKKRKPLRQLITHKEPKSRVAEQYRNIRTNIEFTSVDNHVRSIIVTSADPGDGKTTTIANLAVVFGQQGKKVLLIGADLRKPTIQNLFAIHSSNGLTNLLSGQAKLMQCIQKTDIENVHLMAAGPIPPNPAELLSSRGMDELLLEAYNMFDIILIDTPPVLAVTDAQILANKCDGIVLVVRSEKTEKDKIVKAKQILDKASGKLLGVVLNDKREEKEQYGYY
>NZ_CP032365.1|WP_151035651.1|5233225_5233969_-|capsular-biosynthesis-protein
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAMIQAGEVQTNIQLTNTYKVIIKSPVILDQVNEKLNLNMTAQALTGKINVANEKDSQVISVTAEDKDPKLARDIANATADVFKGEVAKIMNVDNVTVLSKAEVAENQSPIKPRPMLNVVIAFVVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKVRGQTIGS
>NZ_CP032365.1|WP_151035650.1|5232534_5233236_-|polysaccharide-biosynthesis-tyrosine-autokinase
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQLDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDLVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETGVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>NZ_CP032365.1|WP_151035649.1|5231657_5232425_-|tyrosine-protein-phosphatase
MIDLHCHILPGIDDGAQTVTDSLVMAQKAIEEGIHTIVATPHHQNGKYINERTSILHQVKQLNDELQQHNIPLTILPGQEVRLYGDILEDYEAGKIVTLNETNKYIFIEFPSNHVPRYAEQLLYELRVKGMIPIIVHPERNAELIERPDKLYNLVNKGALTQVTAGSLLGKFGKKIKKFSLQLVEHNLTHMIASDAHNTTSRGFYLAESYELIEKEFGVSVMNDLRENPYLIISGKAIYKEDPEQIRRKKLFGIF
>NZ_CP032365.1|WP_151035648.1|5228747_5230562_-|polysaccharide-biosynthesis-protein
MSYRKRLSLLILLDSFIVLTAVYLSYWFIHPNVLSKIPTTVIVSSITLLCSHHIFAAIYKLYNKAWEYASIGELKQIFKAITLSIIVTAIVQQIINHDIYVRILAIAWMLHLLLIGGSRFVWRMFRDTYITKATNKKRTLIVGAGSAGTMVVRQLQHNKEADLYPIAFVDDDRNKQKLEIYNVPVVGTTNHIEEVVEDNDIEHIIIAIPSLNRKQINEIFEKCRKTKAKTQIVPMLEDLLDGKVSVNEVRDVQVEDLLGREPIQLDDAGIGEKITGKTILVTGAGGSIGSEICRQVMKYKPGKIVLLGHGENSIYNIEMEMRVTYKGTVEITTEIADVQDRNKIFEIIDKHRPYIVYHAAAHKHVPLMERNPEEAVKNNIFGTKNVAEAADTFKVNTFVMVSTDKAVNPTNVMGATKRFAEMLVQHLAAVSNNTRFVAVRFGNVLGSRGSVIPLFKKQIQKGGPVTVTHPEMVRYFMTIPEASRLVIQAGTLAKGGELFVLDMGDPVKIVDLAKNLITLSGYSIEEIGIEFTGLRPGEKMYEELLNEGEIHPEQIFPKIHIGKAVLMDQSILRQFMNDFEKMSKKDIRERLLDIANNYVLKEEF
>NZ_CP032365.1|WP_151035647.1|5228095_5228689_-|sugar-transferase
MIYKLYMKRIIDFIISLLGLIVLSPIVLILIFCIKIDSKGPVLFKQRRIGKEKNEFYILKFRTMRIDTPKDTPTHLLEDPEKYITKVGKFLRKTSLDELPQILNIIKGEMSIVGPRPALWNQYDLIQERDKYEANDILPGLTGWAQVNGRDELPIDIKASLDGEYAKKLSIVFDVQIFFKTLISVVKSEGVKEGKGK
>NZ_CP032365.1|WP_000144454.1|5239469_5240174_-|ABC-transporter-permease
MTFSMRRVSAIFRKEVQDFKTNSQVLLMASLPIIFAFIFSRFGEGQAGVGIITLMSFLFVAGFVQSMVIAEEKEKHTLRVLMLSPASSVEVLLGKSILTACLTLGISIVNLFILDQLSGNLLLLAFIFLCGTILFILIGTVIGLLAESVPQTSLIGMPILMTMYLAVQFEPMVENKVIKTMISYLPTSHLEKAIKILVEGAGFSSISGHMLNVGVWLVISLIACLIVYKKKQLD
>NZ_CP032365.1|WP_000170857.1|5240173_5241016_-|ABC-transporter-ATP-binding-protein
MTLAIEMKDVMKSFNEKTALRNVNIEVKQGEIFGFLGPSGSGKTTTVKILTSQLLHSVGTVRVLGKDITGPSSIDYKRIGILTDNSGLYERLSIYDNLLLFCDLYDCKKERIDEVLAQVNLLDDKKTPVKKLSKGMKQRVTLARAILHKPDILFLDEPTSALDPVNVQNIHKILKDLNKEGTTIFLTTHNMNEAETLCNRIAFLCGGEIVALDTPENLRLQYAKDQIQVVLKDKQKEVVQKDELGAKRISEWMKKGELLSIHSHEPTLGDIFIEVTGRGL
>NZ_CP032365.1|WP_001185972.1|5241196_5242204_-|ATP-binding-cassette-domain-containing-protein
MALLELRQLGKTNQLPAVELKVEKGQCVVLQCNNHTAKVLHRIIIGEEEASTGNVLFEGESIGKKKYSHIGFCFLKDEAYDRLKVKEYFKFLIGLYESKMSTEEVVQYVGLLDKLNVKIEKLSFSEKRRLHIGRVMIHNPDLVILEEPEQNVDTESTIIIRKAIMKMKEQGKAIFITSSFLSDALSLTEDVYILNNDGVKKIEIEQEEIEEVDEEKVVQMIPQMKLERIPAKVNDKIILLDPMEIHFIETQNGVTHIHVREGDFVCALTLSELEARLTGFGFFRCHRSYLVNLQRVREVITWTRNSFSLILDDERKSSIPLSKGRMDELKGVIGL
>NZ_CP032365.1|WP_000672644.1|5242699_5243719_-|stage-II-sporulation-protein-D
MKFSKPLFITVALLIALVIIVPAALVIPFAKAKVGEEAASKTPPAIESIPAPGKVDTAVQVAVYRDRQKKVETLPMEEYVTGVVASEMNASFEIEALKAQALAARTFVVQRMLSGGKKNNADVTDTVKDQVYKSKEELKKQWGNNYENNLKKIEEAVSKTAGQVLTYDGKPISASFFSTSNGRTENAADYWGNDYPYLKSVDSPWDQASPKFTSEQTFTVADFQKRLGVKVLADGKVGNIQDLTEGKRVKDVAFQGKTLTGKQVREKLDLRSSDFTWKQEGDKIVVTTKGFGHGVGMSQYGANGMAAEGKKYTDIVAHYYKGVEIKSMNDYEGKLMVKK
>NZ_CP032365.1|WP_000411269.1|5243926_5245231_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRHLNAEVVFENNQVTIDASKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIGSRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKGTTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGGNHSIIPDRIEAGTFMVAAAITGGDILIENAVPEHLRSITAKMEEMGVKVIEENEGVRVIGPDKLKAVDIKTMPHPGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNSLQGAEVGATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVDFHKKLAALGATIERVNEKVEEVKEQEVSDLHA
>NZ_CP032365.1|WP_033658933.1|5245270_5245981_-|YwmB-family-TATA-box-binding-protein
MKLKLKAILIVVISVVLFLVGYREMKPISDEQKMESMIATLEKNDAKVEKWSWLARETKTISNIHMFQKLLNDVKDKANIQKWELEQSPDGYKATSYKKFSSYEERVVVTWSKENTKENTFIIFEVSGAKWDPKYIQKTNKIFSEKPIIYTCVQGVLNDKIEGVLQNKTNQFLKDLSARAIEQIEERAFVSVSAYNKKWDDALSTNREKINVQIAIRSTDNKDTIVVGTPIITSEY
>NZ_CP032365.1|WP_000940744.1|5246026_5246263_-|DUF1146-domain-containing-protein
MAHLLGQQALIAIVSHLLFITITWWALQGVHIERLMKSGKVMQTRVLLILITIAIGTSVSNFFLDYLGYSKSLTYLVK
>NZ_CP032365.1|WP_088082079.1|5246475_5247996_-|NADH-quinone-oxidoreductase-subunit-NuoN
MDMNTLLSLSWHLMVPEFIILGAAILLSICDLFFKLNHRYVALSAIAAVILAIVSLITLYGEPTGDILNGSFVLDGFSKGFKTLLLGGAALILCTAMSDDKKNPIEDKGEYYYLFLMALLGAMFMASSIDFITLFVGLELLSLSSYILVGIRKRNRASNEAAMKYVINGGIGTAITLFGMSYLYGITGSTNIVDMQKVFAGELAGGIQLLLALAFLLLLVGLSFKIATVPFHMWAPDVYEGAATPVTAFLGTISKIAGFLLIIRLFLMVFASVSVQGDMQSLYGRMSIYIAVLASITMIIGNVIALKQYNVKRLFAYSGIAHAGYLLVPLVALSPFTMDSMWFYMLAYMLMNIGAFAIIHGLILQSNKENITIFTGLYKRSPFTAIVMTIFILSLAGIPGTAGFIGKINIFLGALHVEPAHYVLASIMMGTTVISFVYYFRILQQMFFRTGGVEEKIRLPLNIKVVMSLCAISIVILGIMPMIGYNFFYEYFPLMKDFFFLGNVVQ
>NZ_CP032365.1|WP_000998945.1|5247997_5249500_-|NADH-quinone-oxidoreductase-subunit-M
MNDLLLTFFIFSPLLGILLLVLTPKKESRTVRALGLFGTALPFGIAIVLACTYASGKSLSLFDEKVEWIKFGDFAAVDKRWFSIYYELGIDGLSLVMMVLTALLAMLAAIAAFTIKRNLKAFYMLLLMLEIGMFGVFAAQNLMLFFIFFEITLPPMFLLIGKWGKLSSEKAAYSYLIYNGIGSAILLIVFSVLFAKTGTTNITELKEILTSVGAGGGMAVSSSLQFGLFLAIMIAFAIKLPVFPLHRWMVNVHIEAHPAVVMLHAGVLLKIGAYGMIRFGKGLFPEYFREFATLIAILGVINLLYGAFLALIQTDFRKVLAYSSISHMGIVLMGLAALNAPGIQGALFQVVSHGLIAALLFFLLGVIEQRFGTSDITALGGLAKSVPVLSGFFLAGGMASLGLPGMSGFVSEFLAFLGLFQGEPVIAAVGVLGIILTAVYVLRATLQVTFGKKEWEAKADIHGWEYVPILLLIFCIIAIGVMPEILGDPLQNTLKTLGVK
>NZ_CP032365.1|WP_074651571.1|5249496_5251359_-|NADH-quinone-oxidoreductase-subunit-L
MIDYAWLIPLFPLVSFFLLLIFGKKIREGSSVLSIFLVFLSFIFAVLVLVERFSKVGLKHKWVWLRTGDIDISFGFEVTALGALMLFIVTLVSLLVHVYSKGYMKGDERLPTFYAYLGLFTFAMLGLVISPNLLQLYIFWELVGLGSFLLIGFYFFKEEAKAAAKKAFIMTRIGDVGLFIGMILLFWHAGSFEYDAIFRAIRTGDLTPTMITITAILIFIGAMGKSGQFPLHTWLPDAMEGPTPVSALIHAATMVAAGVYLVATMFPLFSASAVAMQTVAIVGAFTAIFAASIGLVQTDIKRVLAYSTVSQLGYMMLALGSAGYVAGVFHLTTHAFFKALLFLAAGSVIHAVHTQDINKMGGLQKKMKVTGALFLIGTLAISGVPLLSGFFSKDEILAVTWMNGNYVLFILAVIAAFLTAFYMFRLYFLVFTGEAKTKEDVHESPRVMTYPMIVLGVLAVVAGYMNTPWFGTFLGDWLTKDVAFKVREAHGPVWIMLVATLVSLAGIALAYFIYGKKSISRDWAGGDGTPLYNLLKEKYYVDELYNMTVLPITKGIAHVLRLFEVYVVEGIAVLIGSLVKGISGLGSRLQNGNVQVYGTVTAVSLAVLVIILLYTGGDLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP032365_3	3.3\|3717332\|18\|NZ_CP032365\|CRT	3717332-3717349	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.3\|3717332\|18\|NZ_CP032365\|CRT	3717332-3717349	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.3\|3717332\|18\|NZ_CP032365\|CRT	3717332-3717349	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.3\|3717332\|18\|NZ_CP032365\|CRT	3717332-3717349	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.4\|3717368\|18\|NZ_CP032365\|CRT	3717368-3717385	18	NZ_CP032365.1	3719636-3719653	0	1.0
NZ_CP032365_3	3.4\|3717368\|18\|NZ_CP032365\|CRT	3717368-3717385	18	NZ_CP032365.1	3719933-3719950	0	1.0
NZ_CP032365_3	3.4\|3717368\|18\|NZ_CP032365\|CRT	3717368-3717385	18	NZ_CP032365.1	3720113-3720130	0	1.0
NZ_CP032365_3	3.5\|3717404\|18\|NZ_CP032365\|CRT	3717404-3717421	18	NZ_CP032365.1	3719555-3719572	0	1.0
NZ_CP032365_3	3.6\|3717440\|18\|NZ_CP032365\|CRT	3717440-3717457	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.6\|3717440\|18\|NZ_CP032365\|CRT	3717440-3717457	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.6\|3717440\|18\|NZ_CP032365\|CRT	3717440-3717457	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.6\|3717440\|18\|NZ_CP032365\|CRT	3717440-3717457	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.9\|3717557\|18\|NZ_CP032365\|CRT	3717557-3717574	18	NZ_CP032365.1	3719600-3719617	0	1.0
NZ_CP032365_3	3.10\|3717593\|18\|NZ_CP032365\|CRT	3717593-3717610	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.10\|3717593\|18\|NZ_CP032365\|CRT	3717593-3717610	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.10\|3717593\|18\|NZ_CP032365\|CRT	3717593-3717610	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.10\|3717593\|18\|NZ_CP032365\|CRT	3717593-3717610	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.11\|3717629\|18\|NZ_CP032365\|CRT	3717629-3717646	18	NZ_CP032365.1	3719636-3719653	0	1.0
NZ_CP032365_3	3.11\|3717629\|18\|NZ_CP032365\|CRT	3717629-3717646	18	NZ_CP032365.1	3719933-3719950	0	1.0
NZ_CP032365_3	3.11\|3717629\|18\|NZ_CP032365\|CRT	3717629-3717646	18	NZ_CP032365.1	3720113-3720130	0	1.0
NZ_CP032365_3	3.12\|3717665\|18\|NZ_CP032365\|CRT	3717665-3717682	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.12\|3717665\|18\|NZ_CP032365\|CRT	3717665-3717682	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.12\|3717665\|18\|NZ_CP032365\|CRT	3717665-3717682	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.12\|3717665\|18\|NZ_CP032365\|CRT	3717665-3717682	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.13\|3717701\|18\|NZ_CP032365\|CRT	3717701-3717718	18	NZ_CP032365.1	3720077-3720094	0	1.0
NZ_CP032365_3	3.14\|3717737\|18\|NZ_CP032365\|CRT	3717737-3717754	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.14\|3717737\|18\|NZ_CP032365\|CRT	3717737-3717754	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.14\|3717737\|18\|NZ_CP032365\|CRT	3717737-3717754	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.14\|3717737\|18\|NZ_CP032365\|CRT	3717737-3717754	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.15\|3717773\|18\|NZ_CP032365\|CRT	3717773-3717790	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.15\|3717773\|18\|NZ_CP032365\|CRT	3717773-3717790	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.15\|3717773\|18\|NZ_CP032365\|CRT	3717773-3717790	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.15\|3717773\|18\|NZ_CP032365\|CRT	3717773-3717790	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.16\|3717809\|18\|NZ_CP032365\|CRT	3717809-3717826	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.16\|3717809\|18\|NZ_CP032365\|CRT	3717809-3717826	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.16\|3717809\|18\|NZ_CP032365\|CRT	3717809-3717826	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.16\|3717809\|18\|NZ_CP032365\|CRT	3717809-3717826	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.17\|3717845\|18\|NZ_CP032365\|CRT	3717845-3717862	18	NZ_CP032365.1	3719555-3719572	0	1.0
NZ_CP032365_3	3.18\|3717881\|18\|NZ_CP032365\|CRT	3717881-3717898	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.18\|3717881\|18\|NZ_CP032365\|CRT	3717881-3717898	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.18\|3717881\|18\|NZ_CP032365\|CRT	3717881-3717898	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.18\|3717881\|18\|NZ_CP032365\|CRT	3717881-3717898	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.21\|3717998\|18\|NZ_CP032365\|CRT	3717998-3718015	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.21\|3717998\|18\|NZ_CP032365\|CRT	3717998-3718015	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.21\|3717998\|18\|NZ_CP032365\|CRT	3717998-3718015	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.21\|3717998\|18\|NZ_CP032365\|CRT	3717998-3718015	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.22\|3718034\|18\|NZ_CP032365\|CRT	3718034-3718051	18	NZ_CP032365.1	3720077-3720094	0	1.0
NZ_CP032365_3	3.23\|3718070\|18\|NZ_CP032365\|CRT	3718070-3718087	18	NZ_CP032365.1	3719600-3719617	0	1.0
NZ_CP032365_3	3.24\|3718106\|18\|NZ_CP032365\|CRT	3718106-3718123	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.24\|3718106\|18\|NZ_CP032365\|CRT	3718106-3718123	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.24\|3718106\|18\|NZ_CP032365\|CRT	3718106-3718123	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.24\|3718106\|18\|NZ_CP032365\|CRT	3718106-3718123	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.25\|3718142\|18\|NZ_CP032365\|CRT	3718142-3718159	18	NZ_CP032365.1	3719636-3719653	0	1.0
NZ_CP032365_3	3.25\|3718142\|18\|NZ_CP032365\|CRT	3718142-3718159	18	NZ_CP032365.1	3719933-3719950	0	1.0
NZ_CP032365_3	3.25\|3718142\|18\|NZ_CP032365\|CRT	3718142-3718159	18	NZ_CP032365.1	3720113-3720130	0	1.0
NZ_CP032365_3	3.26\|3718178\|18\|NZ_CP032365\|CRT	3718178-3718195	18	NZ_CP032365.1	3720041-3720058	0	1.0
NZ_CP032365_3	3.27\|3718214\|18\|NZ_CP032365\|CRT	3718214-3718231	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.27\|3718214\|18\|NZ_CP032365\|CRT	3718214-3718231	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.27\|3718214\|18\|NZ_CP032365\|CRT	3718214-3718231	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.27\|3718214\|18\|NZ_CP032365\|CRT	3718214-3718231	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.28\|3718250\|18\|NZ_CP032365\|CRT	3718250-3718267	18	NZ_CP032365.1	3720041-3720058	0	1.0
NZ_CP032365_3	3.29\|3718286\|27\|NZ_CP032365\|CRT	3718286-3718312	27	NZ_CP032365.1	3719762-3719788	0	1.0
NZ_CP032365_3	3.29\|3718286\|27\|NZ_CP032365\|CRT	3718286-3718312	27	NZ_CP032365.1	3720185-3720211	0	1.0
NZ_CP032365_3	3.35\|3718547\|18\|NZ_CP032365\|CRT	3718547-3718564	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.35\|3718547\|18\|NZ_CP032365\|CRT	3718547-3718564	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.35\|3718547\|18\|NZ_CP032365\|CRT	3718547-3718564	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.35\|3718547\|18\|NZ_CP032365\|CRT	3718547-3718564	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.36\|3718583\|18\|NZ_CP032365\|CRT	3718583-3718600	18	NZ_CP032365.1	3720041-3720058	0	1.0
NZ_CP032365_3	3.40\|3718727\|18\|NZ_CP032365\|CRT	3718727-3718744	18	NZ_CP032365.1	3719717-3719734	0	1.0
NZ_CP032365_3	3.40\|3718727\|18\|NZ_CP032365\|CRT	3718727-3718744	18	NZ_CP032365.1	3719825-3719842	0	1.0
NZ_CP032365_3	3.43\|3718853\|18\|NZ_CP032365\|CRT	3718853-3718870	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.43\|3718853\|18\|NZ_CP032365\|CRT	3718853-3718870	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.43\|3718853\|18\|NZ_CP032365\|CRT	3718853-3718870	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.43\|3718853\|18\|NZ_CP032365\|CRT	3718853-3718870	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.44\|3718889\|18\|NZ_CP032365\|CRT	3718889-3718906	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.44\|3718889\|18\|NZ_CP032365\|CRT	3718889-3718906	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.44\|3718889\|18\|NZ_CP032365\|CRT	3718889-3718906	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.44\|3718889\|18\|NZ_CP032365\|CRT	3718889-3718906	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.45\|3718925\|27\|NZ_CP032365\|CRT	3718925-3718951	27	NZ_CP032365.1	3719762-3719788	0	1.0
NZ_CP032365_3	3.45\|3718925\|27\|NZ_CP032365\|CRT	3718925-3718951	27	NZ_CP032365.1	3720185-3720211	0	1.0
NZ_CP032365_3	3.46\|3718970\|18\|NZ_CP032365\|CRT	3718970-3718987	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.46\|3718970\|18\|NZ_CP032365\|CRT	3718970-3718987	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.46\|3718970\|18\|NZ_CP032365\|CRT	3718970-3718987	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.46\|3718970\|18\|NZ_CP032365\|CRT	3718970-3718987	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.47\|3719006\|27\|NZ_CP032365\|CRT	3719006-3719032	27	NZ_CP032365.1	3719762-3719788	0	1.0
NZ_CP032365_3	3.47\|3719006\|27\|NZ_CP032365\|CRT	3719006-3719032	27	NZ_CP032365.1	3720185-3720211	0	1.0
NZ_CP032365_3	3.48\|3719051\|18\|NZ_CP032365\|CRT	3719051-3719068	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.48\|3719051\|18\|NZ_CP032365\|CRT	3719051-3719068	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.48\|3719051\|18\|NZ_CP032365\|CRT	3719051-3719068	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.48\|3719051\|18\|NZ_CP032365\|CRT	3719051-3719068	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.49\|3719087\|27\|NZ_CP032365\|CRT	3719087-3719113	27	NZ_CP032365.1	3719762-3719788	0	1.0
NZ_CP032365_3	3.49\|3719087\|27\|NZ_CP032365\|CRT	3719087-3719113	27	NZ_CP032365.1	3720185-3720211	0	1.0
NZ_CP032365_3	3.50\|3719132\|18\|NZ_CP032365\|CRT	3719132-3719149	18	NZ_CP032365.1	3719708-3719725	0	1.0
NZ_CP032365_3	3.50\|3719132\|18\|NZ_CP032365\|CRT	3719132-3719149	18	NZ_CP032365.1	3719897-3719914	0	1.0
NZ_CP032365_3	3.50\|3719132\|18\|NZ_CP032365\|CRT	3719132-3719149	18	NZ_CP032365.1	3720005-3720022	0	1.0
NZ_CP032365_3	3.50\|3719132\|18\|NZ_CP032365\|CRT	3719132-3719149	18	NZ_CP032365.1	3720149-3720166	0	1.0
NZ_CP032365_3	3.51\|3719168\|18\|NZ_CP032365\|CRT	3719168-3719185	18	NZ_CP032365.1	3720041-3720058	0	1.0
NZ_CP032365_3	3.54\|3719276\|18\|NZ_CP032365\|CRT	3719276-3719293	18	NZ_CP032365.1	3719717-3719734	0	1.0
NZ_CP032365_3	3.54\|3719276\|18\|NZ_CP032365\|CRT	3719276-3719293	18	NZ_CP032365.1	3719825-3719842	0	1.0
NZ_CP032365_3	3.2\|3717296\|18\|NZ_CP032365\|CRT	3717296-3717313	18	NZ_CP032365.1	3720041-3720058	1	0.944
NZ_CP032365_3	3.3\|3717332\|18\|NZ_CP032365\|CRT	3717332-3717349	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.6\|3717440\|18\|NZ_CP032365\|CRT	3717440-3717457	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.10\|3717593\|18\|NZ_CP032365\|CRT	3717593-3717610	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.12\|3717665\|18\|NZ_CP032365\|CRT	3717665-3717682	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.14\|3717737\|18\|NZ_CP032365\|CRT	3717737-3717754	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.15\|3717773\|18\|NZ_CP032365\|CRT	3717773-3717790	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.16\|3717809\|18\|NZ_CP032365\|CRT	3717809-3717826	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.18\|3717881\|18\|NZ_CP032365\|CRT	3717881-3717898	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.19\|3717917\|18\|NZ_CP032365\|CRT	3717917-3717934	18	NZ_CP032365.1	3720041-3720058	1	0.944
NZ_CP032365_3	3.21\|3717998\|18\|NZ_CP032365\|CRT	3717998-3718015	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.24\|3718106\|18\|NZ_CP032365\|CRT	3718106-3718123	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.26\|3718178\|18\|NZ_CP032365\|CRT	3718178-3718195	18	NZ_CP032365.1	3719762-3719779	1	0.944
NZ_CP032365_3	3.26\|3718178\|18\|NZ_CP032365\|CRT	3718178-3718195	18	NZ_CP032365.1	3719816-3719833	1	0.944
NZ_CP032365_3	3.26\|3718178\|18\|NZ_CP032365\|CRT	3718178-3718195	18	NZ_CP032365.1	3720185-3720202	1	0.944
NZ_CP032365_3	3.27\|3718214\|18\|NZ_CP032365\|CRT	3718214-3718231	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.28\|3718250\|18\|NZ_CP032365\|CRT	3718250-3718267	18	NZ_CP032365.1	3719762-3719779	1	0.944
NZ_CP032365_3	3.28\|3718250\|18\|NZ_CP032365\|CRT	3718250-3718267	18	NZ_CP032365.1	3719816-3719833	1	0.944
NZ_CP032365_3	3.28\|3718250\|18\|NZ_CP032365\|CRT	3718250-3718267	18	NZ_CP032365.1	3720185-3720202	1	0.944
NZ_CP032365_3	3.29\|3718286\|27\|NZ_CP032365\|CRT	3718286-3718312	27	NZ_CP032365.1	3719816-3719842	1	0.963
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	NZ_CP032365.1	3719708-3719734	1	0.963
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	NZ_CP032365.1	3719708-3719734	1	0.963
NZ_CP032365_3	3.35\|3718547\|18\|NZ_CP032365\|CRT	3718547-3718564	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.36\|3718583\|18\|NZ_CP032365\|CRT	3718583-3718600	18	NZ_CP032365.1	3719762-3719779	1	0.944
NZ_CP032365_3	3.36\|3718583\|18\|NZ_CP032365\|CRT	3718583-3718600	18	NZ_CP032365.1	3719816-3719833	1	0.944
NZ_CP032365_3	3.36\|3718583\|18\|NZ_CP032365\|CRT	3718583-3718600	18	NZ_CP032365.1	3720185-3720202	1	0.944
NZ_CP032365_3	3.39\|3718691\|18\|NZ_CP032365\|CRT	3718691-3718708	18	NZ_CP032365.1	3719717-3719734	1	0.944
NZ_CP032365_3	3.39\|3718691\|18\|NZ_CP032365\|CRT	3718691-3718708	18	NZ_CP032365.1	3719825-3719842	1	0.944
NZ_CP032365_3	3.40\|3718727\|18\|NZ_CP032365\|CRT	3718727-3718744	18	NZ_CP032365.1	3719672-3719689	1	0.944
NZ_CP032365_3	3.40\|3718727\|18\|NZ_CP032365\|CRT	3718727-3718744	18	NZ_CP032365.1	3719771-3719788	1	0.944
NZ_CP032365_3	3.40\|3718727\|18\|NZ_CP032365\|CRT	3718727-3718744	18	NZ_CP032365.1	3720194-3720211	1	0.944
NZ_CP032365_3	3.40\|3718727\|18\|NZ_CP032365\|CRT	3718727-3718744	18	NZ_CP032365.1	3720230-3720247	1	0.944
NZ_CP032365_3	3.43\|3718853\|18\|NZ_CP032365\|CRT	3718853-3718870	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.44\|3718889\|18\|NZ_CP032365\|CRT	3718889-3718906	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.45\|3718925\|27\|NZ_CP032365\|CRT	3718925-3718951	27	NZ_CP032365.1	3719816-3719842	1	0.963
NZ_CP032365_3	3.46\|3718970\|18\|NZ_CP032365\|CRT	3718970-3718987	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.47\|3719006\|27\|NZ_CP032365\|CRT	3719006-3719032	27	NZ_CP032365.1	3719816-3719842	1	0.963
NZ_CP032365_3	3.48\|3719051\|18\|NZ_CP032365\|CRT	3719051-3719068	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.49\|3719087\|27\|NZ_CP032365\|CRT	3719087-3719113	27	NZ_CP032365.1	3719816-3719842	1	0.963
NZ_CP032365_3	3.50\|3719132\|18\|NZ_CP032365\|CRT	3719132-3719149	18	NZ_CP032365.1	3719969-3719986	1	0.944
NZ_CP032365_3	3.51\|3719168\|18\|NZ_CP032365\|CRT	3719168-3719185	18	NZ_CP032365.1	3719762-3719779	1	0.944
NZ_CP032365_3	3.51\|3719168\|18\|NZ_CP032365\|CRT	3719168-3719185	18	NZ_CP032365.1	3719816-3719833	1	0.944
NZ_CP032365_3	3.51\|3719168\|18\|NZ_CP032365\|CRT	3719168-3719185	18	NZ_CP032365.1	3720185-3720202	1	0.944
NZ_CP032365_3	3.53\|3719240\|18\|NZ_CP032365\|CRT	3719240-3719257	18	NZ_CP032365.1	3719717-3719734	1	0.944
NZ_CP032365_3	3.53\|3719240\|18\|NZ_CP032365\|CRT	3719240-3719257	18	NZ_CP032365.1	3719825-3719842	1	0.944
NZ_CP032365_3	3.54\|3719276\|18\|NZ_CP032365\|CRT	3719276-3719293	18	NZ_CP032365.1	3719672-3719689	1	0.944
NZ_CP032365_3	3.54\|3719276\|18\|NZ_CP032365\|CRT	3719276-3719293	18	NZ_CP032365.1	3719771-3719788	1	0.944
NZ_CP032365_3	3.54\|3719276\|18\|NZ_CP032365\|CRT	3719276-3719293	18	NZ_CP032365.1	3720194-3720211	1	0.944
NZ_CP032365_3	3.54\|3719276\|18\|NZ_CP032365\|CRT	3719276-3719293	18	NZ_CP032365.1	3720230-3720247	1	0.944
NZ_CP032365_3	3.57\|3719402\|54\|NZ_CP032365\|CRT	3719402-3719455	54	NZ_CP032365.1	3719969-3720022	2	0.963
NZ_CP032365_3	3.57\|3719402\|54\|NZ_CP032365\|CRT	3719402-3719455	54	NZ_CP032365.1	3720005-3720058	2	0.963
NZ_CP032365_3	3.57\|3719402\|54\|NZ_CP032365\|CRT	3719402-3719455	54	NZ_CP032365.1	3720149-3720202	2	0.963

1. spacer 3.3|3717332|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

2. spacer 3.3|3717332|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

3. spacer 3.3|3717332|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

4. spacer 3.3|3717332|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

5. spacer 3.4|3717368|18|NZ_CP032365|CRT matches to position: 3719636-3719653, mismatch: 0, identity: 1.0

cggacctcagggcgttca	CRISPR spacer
cggacctcagggcgttca	Protospacer
******************

6. spacer 3.4|3717368|18|NZ_CP032365|CRT matches to position: 3719933-3719950, mismatch: 0, identity: 1.0

cggacctcagggcgttca	CRISPR spacer
cggacctcagggcgttca	Protospacer
******************

7. spacer 3.4|3717368|18|NZ_CP032365|CRT matches to position: 3720113-3720130, mismatch: 0, identity: 1.0

cggacctcagggcgttca	CRISPR spacer
cggacctcagggcgttca	Protospacer
******************

8. spacer 3.5|3717404|18|NZ_CP032365|CRT matches to position: 3719555-3719572, mismatch: 0, identity: 1.0

tggtgctactgggcctca	CRISPR spacer
tggtgctactgggcctca	Protospacer
******************

9. spacer 3.6|3717440|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

10. spacer 3.6|3717440|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

11. spacer 3.6|3717440|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

12. spacer 3.6|3717440|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

13. spacer 3.9|3717557|18|NZ_CP032365|CRT matches to position: 3719600-3719617, mismatch: 0, identity: 1.0

cggacctcaaggtgctca	CRISPR spacer
cggacctcaaggtgctca	Protospacer
******************

14. spacer 3.10|3717593|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

15. spacer 3.10|3717593|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

16. spacer 3.10|3717593|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

17. spacer 3.10|3717593|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

18. spacer 3.11|3717629|18|NZ_CP032365|CRT matches to position: 3719636-3719653, mismatch: 0, identity: 1.0

cggacctcagggcgttca	CRISPR spacer
cggacctcagggcgttca	Protospacer
******************

19. spacer 3.11|3717629|18|NZ_CP032365|CRT matches to position: 3719933-3719950, mismatch: 0, identity: 1.0

cggacctcagggcgttca	CRISPR spacer
cggacctcagggcgttca	Protospacer
******************

20. spacer 3.11|3717629|18|NZ_CP032365|CRT matches to position: 3720113-3720130, mismatch: 0, identity: 1.0

cggacctcagggcgttca	CRISPR spacer
cggacctcagggcgttca	Protospacer
******************

21. spacer 3.12|3717665|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

22. spacer 3.12|3717665|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

23. spacer 3.12|3717665|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

24. spacer 3.12|3717665|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

25. spacer 3.13|3717701|18|NZ_CP032365|CRT matches to position: 3720077-3720094, mismatch: 0, identity: 1.0

cggtgccactggacctcg	CRISPR spacer
cggtgccactggacctcg	Protospacer
******************

26. spacer 3.14|3717737|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

27. spacer 3.14|3717737|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

28. spacer 3.14|3717737|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

29. spacer 3.14|3717737|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

30. spacer 3.15|3717773|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

31. spacer 3.15|3717773|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

32. spacer 3.15|3717773|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

33. spacer 3.15|3717773|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

34. spacer 3.16|3717809|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

35. spacer 3.16|3717809|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

36. spacer 3.16|3717809|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

37. spacer 3.16|3717809|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

38. spacer 3.17|3717845|18|NZ_CP032365|CRT matches to position: 3719555-3719572, mismatch: 0, identity: 1.0

tggtgctactgggcctca	CRISPR spacer
tggtgctactgggcctca	Protospacer
******************

39. spacer 3.18|3717881|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

40. spacer 3.18|3717881|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

41. spacer 3.18|3717881|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

42. spacer 3.18|3717881|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

43. spacer 3.21|3717998|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

44. spacer 3.21|3717998|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

45. spacer 3.21|3717998|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

46. spacer 3.21|3717998|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

47. spacer 3.22|3718034|18|NZ_CP032365|CRT matches to position: 3720077-3720094, mismatch: 0, identity: 1.0

cggtgccactggacctcg	CRISPR spacer
cggtgccactggacctcg	Protospacer
******************

48. spacer 3.23|3718070|18|NZ_CP032365|CRT matches to position: 3719600-3719617, mismatch: 0, identity: 1.0

cggacctcaaggtgctca	CRISPR spacer
cggacctcaaggtgctca	Protospacer
******************

49. spacer 3.24|3718106|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

50. spacer 3.24|3718106|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

51. spacer 3.24|3718106|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

52. spacer 3.24|3718106|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

53. spacer 3.25|3718142|18|NZ_CP032365|CRT matches to position: 3719636-3719653, mismatch: 0, identity: 1.0

cggacctcagggcgttca	CRISPR spacer
cggacctcagggcgttca	Protospacer
******************

54. spacer 3.25|3718142|18|NZ_CP032365|CRT matches to position: 3719933-3719950, mismatch: 0, identity: 1.0

cggacctcagggcgttca	CRISPR spacer
cggacctcagggcgttca	Protospacer
******************

55. spacer 3.25|3718142|18|NZ_CP032365|CRT matches to position: 3720113-3720130, mismatch: 0, identity: 1.0

cggacctcagggcgttca	CRISPR spacer
cggacctcagggcgttca	Protospacer
******************

56. spacer 3.26|3718178|18|NZ_CP032365|CRT matches to position: 3720041-3720058, mismatch: 0, identity: 1.0

cggtgctactggacctca	CRISPR spacer
cggtgctactggacctca	Protospacer
******************

57. spacer 3.27|3718214|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

58. spacer 3.27|3718214|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

59. spacer 3.27|3718214|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

60. spacer 3.27|3718214|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

61. spacer 3.28|3718250|18|NZ_CP032365|CRT matches to position: 3720041-3720058, mismatch: 0, identity: 1.0

cggtgctactggacctca	CRISPR spacer
cggtgctactggacctca	Protospacer
******************

62. spacer 3.29|3718286|27|NZ_CP032365|CRT matches to position: 3719762-3719788, mismatch: 0, identity: 1.0

cggtgccactggacctcaaggtgttca	CRISPR spacer
cggtgccactggacctcaaggtgttca	Protospacer
***************************

63. spacer 3.29|3718286|27|NZ_CP032365|CRT matches to position: 3720185-3720211, mismatch: 0, identity: 1.0

cggtgccactggacctcaaggtgttca	CRISPR spacer
cggtgccactggacctcaaggtgttca	Protospacer
***************************

64. spacer 3.35|3718547|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

65. spacer 3.35|3718547|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

66. spacer 3.35|3718547|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

67. spacer 3.35|3718547|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

68. spacer 3.36|3718583|18|NZ_CP032365|CRT matches to position: 3720041-3720058, mismatch: 0, identity: 1.0

cggtgctactggacctca	CRISPR spacer
cggtgctactggacctca	Protospacer
******************

69. spacer 3.40|3718727|18|NZ_CP032365|CRT matches to position: 3719717-3719734, mismatch: 0, identity: 1.0

tggacctcaaggtgctca	CRISPR spacer
tggacctcaaggtgctca	Protospacer
******************

70. spacer 3.40|3718727|18|NZ_CP032365|CRT matches to position: 3719825-3719842, mismatch: 0, identity: 1.0

tggacctcaaggtgctca	CRISPR spacer
tggacctcaaggtgctca	Protospacer
******************

71. spacer 3.43|3718853|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

72. spacer 3.43|3718853|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

73. spacer 3.43|3718853|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

74. spacer 3.43|3718853|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

75. spacer 3.44|3718889|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

76. spacer 3.44|3718889|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

77. spacer 3.44|3718889|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

78. spacer 3.44|3718889|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

79. spacer 3.45|3718925|27|NZ_CP032365|CRT matches to position: 3719762-3719788, mismatch: 0, identity: 1.0

cggtgccactggacctcaaggtgttca	CRISPR spacer
cggtgccactggacctcaaggtgttca	Protospacer
***************************

80. spacer 3.45|3718925|27|NZ_CP032365|CRT matches to position: 3720185-3720211, mismatch: 0, identity: 1.0

cggtgccactggacctcaaggtgttca	CRISPR spacer
cggtgccactggacctcaaggtgttca	Protospacer
***************************

81. spacer 3.46|3718970|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

82. spacer 3.46|3718970|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

83. spacer 3.46|3718970|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

84. spacer 3.46|3718970|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

85. spacer 3.47|3719006|27|NZ_CP032365|CRT matches to position: 3719762-3719788, mismatch: 0, identity: 1.0

cggtgccactggacctcaaggtgttca	CRISPR spacer
cggtgccactggacctcaaggtgttca	Protospacer
***************************

86. spacer 3.47|3719006|27|NZ_CP032365|CRT matches to position: 3720185-3720211, mismatch: 0, identity: 1.0

cggtgccactggacctcaaggtgttca	CRISPR spacer
cggtgccactggacctcaaggtgttca	Protospacer
***************************

87. spacer 3.48|3719051|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

88. spacer 3.48|3719051|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

89. spacer 3.48|3719051|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

90. spacer 3.48|3719051|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

91. spacer 3.49|3719087|27|NZ_CP032365|CRT matches to position: 3719762-3719788, mismatch: 0, identity: 1.0

cggtgccactggacctcaaggtgttca	CRISPR spacer
cggtgccactggacctcaaggtgttca	Protospacer
***************************

92. spacer 3.49|3719087|27|NZ_CP032365|CRT matches to position: 3720185-3720211, mismatch: 0, identity: 1.0

cggtgccactggacctcaaggtgttca	CRISPR spacer
cggtgccactggacctcaaggtgttca	Protospacer
***************************

93. spacer 3.50|3719132|18|NZ_CP032365|CRT matches to position: 3719708-3719725, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

94. spacer 3.50|3719132|18|NZ_CP032365|CRT matches to position: 3719897-3719914, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

95. spacer 3.50|3719132|18|NZ_CP032365|CRT matches to position: 3720005-3720022, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

96. spacer 3.50|3719132|18|NZ_CP032365|CRT matches to position: 3720149-3720166, mismatch: 0, identity: 1.0

tggtgccactggacctca	CRISPR spacer
tggtgccactggacctca	Protospacer
******************

97. spacer 3.51|3719168|18|NZ_CP032365|CRT matches to position: 3720041-3720058, mismatch: 0, identity: 1.0

cggtgctactggacctca	CRISPR spacer
cggtgctactggacctca	Protospacer
******************

98. spacer 3.54|3719276|18|NZ_CP032365|CRT matches to position: 3719717-3719734, mismatch: 0, identity: 1.0

tggacctcaaggtgctca	CRISPR spacer
tggacctcaaggtgctca	Protospacer
******************

99. spacer 3.54|3719276|18|NZ_CP032365|CRT matches to position: 3719825-3719842, mismatch: 0, identity: 1.0

tggacctcaaggtgctca	CRISPR spacer
tggacctcaaggtgctca	Protospacer
******************

100. spacer 3.2|3717296|18|NZ_CP032365|CRT matches to position: 3720041-3720058, mismatch: 1, identity: 0.944

cggtgctactgggcctca	CRISPR spacer
cggtgctactggacctca	Protospacer
************.*****

101. spacer 3.3|3717332|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

102. spacer 3.6|3717440|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

103. spacer 3.10|3717593|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

104. spacer 3.12|3717665|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

105. spacer 3.14|3717737|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

106. spacer 3.15|3717773|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

107. spacer 3.16|3717809|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

108. spacer 3.18|3717881|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

109. spacer 3.19|3717917|18|NZ_CP032365|CRT matches to position: 3720041-3720058, mismatch: 1, identity: 0.944

cggtgctactgggcctca	CRISPR spacer
cggtgctactggacctca	Protospacer
************.*****

110. spacer 3.21|3717998|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

111. spacer 3.24|3718106|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

112. spacer 3.26|3718178|18|NZ_CP032365|CRT matches to position: 3719762-3719779, mismatch: 1, identity: 0.944

cggtgctactggacctca	CRISPR spacer
cggtgccactggacctca	Protospacer
******.***********

113. spacer 3.26|3718178|18|NZ_CP032365|CRT matches to position: 3719816-3719833, mismatch: 1, identity: 0.944

cggtgctactggacctca	CRISPR spacer
cggtgccactggacctca	Protospacer
******.***********

114. spacer 3.26|3718178|18|NZ_CP032365|CRT matches to position: 3720185-3720202, mismatch: 1, identity: 0.944

cggtgctactggacctca	CRISPR spacer
cggtgccactggacctca	Protospacer
******.***********

115. spacer 3.27|3718214|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

116. spacer 3.28|3718250|18|NZ_CP032365|CRT matches to position: 3719762-3719779, mismatch: 1, identity: 0.944

cggtgctactggacctca	CRISPR spacer
cggtgccactggacctca	Protospacer
******.***********

117. spacer 3.28|3718250|18|NZ_CP032365|CRT matches to position: 3719816-3719833, mismatch: 1, identity: 0.944

cggtgctactggacctca	CRISPR spacer
cggtgccactggacctca	Protospacer
******.***********

118. spacer 3.28|3718250|18|NZ_CP032365|CRT matches to position: 3720185-3720202, mismatch: 1, identity: 0.944

cggtgctactggacctca	CRISPR spacer
cggtgccactggacctca	Protospacer
******.***********

119. spacer 3.29|3718286|27|NZ_CP032365|CRT matches to position: 3719816-3719842, mismatch: 1, identity: 0.963

cggtgccactggacctcaaggtgttca	CRISPR spacer
cggtgccactggacctcaaggtgctca	Protospacer
***********************.***

120. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to position: 3719708-3719734, mismatch: 1, identity: 0.963

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgccactggacctcaaggtgctca	Protospacer
***********************.***

121. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to position: 3719708-3719734, mismatch: 1, identity: 0.963

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgccactggacctcaaggtgctca	Protospacer
***********************.***

122. spacer 3.35|3718547|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

123. spacer 3.36|3718583|18|NZ_CP032365|CRT matches to position: 3719762-3719779, mismatch: 1, identity: 0.944

cggtgctactggacctca	CRISPR spacer
cggtgccactggacctca	Protospacer
******.***********

124. spacer 3.36|3718583|18|NZ_CP032365|CRT matches to position: 3719816-3719833, mismatch: 1, identity: 0.944

cggtgctactggacctca	CRISPR spacer
cggtgccactggacctca	Protospacer
******.***********

125. spacer 3.36|3718583|18|NZ_CP032365|CRT matches to position: 3720185-3720202, mismatch: 1, identity: 0.944

cggtgctactggacctca	CRISPR spacer
cggtgccactggacctca	Protospacer
******.***********

126. spacer 3.39|3718691|18|NZ_CP032365|CRT matches to position: 3719717-3719734, mismatch: 1, identity: 0.944

tggacctcagggtgctca	CRISPR spacer
tggacctcaaggtgctca	Protospacer
*********.********

127. spacer 3.39|3718691|18|NZ_CP032365|CRT matches to position: 3719825-3719842, mismatch: 1, identity: 0.944

tggacctcagggtgctca	CRISPR spacer
tggacctcaaggtgctca	Protospacer
*********.********

128. spacer 3.40|3718727|18|NZ_CP032365|CRT matches to position: 3719672-3719689, mismatch: 1, identity: 0.944

tggacctcaaggtgctca	CRISPR spacer
tggacctcaaggtgttca	Protospacer
**************.***

129. spacer 3.40|3718727|18|NZ_CP032365|CRT matches to position: 3719771-3719788, mismatch: 1, identity: 0.944

tggacctcaaggtgctca	CRISPR spacer
tggacctcaaggtgttca	Protospacer
**************.***

130. spacer 3.40|3718727|18|NZ_CP032365|CRT matches to position: 3720194-3720211, mismatch: 1, identity: 0.944

tggacctcaaggtgctca	CRISPR spacer
tggacctcaaggtgttca	Protospacer
**************.***

131. spacer 3.40|3718727|18|NZ_CP032365|CRT matches to position: 3720230-3720247, mismatch: 1, identity: 0.944

tggacctcaaggtgctca	CRISPR spacer
tggacctcaaggtgttca	Protospacer
**************.***

132. spacer 3.43|3718853|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

133. spacer 3.44|3718889|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

134. spacer 3.45|3718925|27|NZ_CP032365|CRT matches to position: 3719816-3719842, mismatch: 1, identity: 0.963

cggtgccactggacctcaaggtgttca	CRISPR spacer
cggtgccactggacctcaaggtgctca	Protospacer
***********************.***

135. spacer 3.46|3718970|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

136. spacer 3.47|3719006|27|NZ_CP032365|CRT matches to position: 3719816-3719842, mismatch: 1, identity: 0.963

cggtgccactggacctcaaggtgttca	CRISPR spacer
cggtgccactggacctcaaggtgctca	Protospacer
***********************.***

137. spacer 3.48|3719051|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

138. spacer 3.49|3719087|27|NZ_CP032365|CRT matches to position: 3719816-3719842, mismatch: 1, identity: 0.963

cggtgccactggacctcaaggtgttca	CRISPR spacer
cggtgccactggacctcaaggtgctca	Protospacer
***********************.***

139. spacer 3.50|3719132|18|NZ_CP032365|CRT matches to position: 3719969-3719986, mismatch: 1, identity: 0.944

tggtgccactggacctca	CRISPR spacer
tggtgccactggatctca	Protospacer
*************.****

140. spacer 3.51|3719168|18|NZ_CP032365|CRT matches to position: 3719762-3719779, mismatch: 1, identity: 0.944

cggtgctactggacctca	CRISPR spacer
cggtgccactggacctca	Protospacer
******.***********

141. spacer 3.51|3719168|18|NZ_CP032365|CRT matches to position: 3719816-3719833, mismatch: 1, identity: 0.944

cggtgctactggacctca	CRISPR spacer
cggtgccactggacctca	Protospacer
******.***********

142. spacer 3.51|3719168|18|NZ_CP032365|CRT matches to position: 3720185-3720202, mismatch: 1, identity: 0.944

cggtgctactggacctca	CRISPR spacer
cggtgccactggacctca	Protospacer
******.***********

143. spacer 3.53|3719240|18|NZ_CP032365|CRT matches to position: 3719717-3719734, mismatch: 1, identity: 0.944

tggacctcagggtgctca	CRISPR spacer
tggacctcaaggtgctca	Protospacer
*********.********

144. spacer 3.53|3719240|18|NZ_CP032365|CRT matches to position: 3719825-3719842, mismatch: 1, identity: 0.944

tggacctcagggtgctca	CRISPR spacer
tggacctcaaggtgctca	Protospacer
*********.********

145. spacer 3.54|3719276|18|NZ_CP032365|CRT matches to position: 3719672-3719689, mismatch: 1, identity: 0.944

tggacctcaaggtgctca	CRISPR spacer
tggacctcaaggtgttca	Protospacer
**************.***

146. spacer 3.54|3719276|18|NZ_CP032365|CRT matches to position: 3719771-3719788, mismatch: 1, identity: 0.944

tggacctcaaggtgctca	CRISPR spacer
tggacctcaaggtgttca	Protospacer
**************.***

147. spacer 3.54|3719276|18|NZ_CP032365|CRT matches to position: 3720194-3720211, mismatch: 1, identity: 0.944

tggacctcaaggtgctca	CRISPR spacer
tggacctcaaggtgttca	Protospacer
**************.***

148. spacer 3.54|3719276|18|NZ_CP032365|CRT matches to position: 3720230-3720247, mismatch: 1, identity: 0.944

tggacctcaaggtgctca	CRISPR spacer
tggacctcaaggtgttca	Protospacer
**************.***

149. spacer 3.57|3719402|54|NZ_CP032365|CRT matches to position: 3719969-3720022, mismatch: 2, identity: 0.963

tggtgccactggacctcagggtaacacaggcgctactggtgccactggacctca	CRISPR spacer
tggtgccactggatctcaaggtaacacaggcgctactggtgccactggacctca	Protospacer
*************.****.***********************************

150. spacer 3.57|3719402|54|NZ_CP032365|CRT matches to position: 3720005-3720058, mismatch: 2, identity: 0.963

tggtgccactggacctcagggtaacacaggcgctactggtgccactggacctca	CRISPR spacer
tggtgccactggacctcagggtaacacaggcgctaccggtgctactggacctca	Protospacer
************************************.*****.***********

151. spacer 3.57|3719402|54|NZ_CP032365|CRT matches to position: 3720149-3720202, mismatch: 2, identity: 0.963

tggtgccactggacctcagggtaacacaggcgctactggtgccactggacctca	CRISPR spacer
tggtgccactggacctcagggtaacacaggtgctaccggtgccactggacctca	Protospacer
******************************.*****.*****************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	NC_020910	Octadecabacter arcticus 238 plasmid pOA238_160, complete sequence	128539-128565	3	0.889
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	MN693092	Marine virus AFVG_25M37, complete genome	19117-19143	4	0.852
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	MN693092	Marine virus AFVG_25M37, complete genome	19117-19143	4	0.852
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_028925	Enterobacteria phage vB_EcoM_VR25, complete genome	109980-110006	4	0.852
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_028925	Enterobacteria phage vB_EcoM_VR25, complete genome	109689-109715	4	0.852
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_028925	Enterobacteria phage vB_EcoM_VR25, complete genome	110439-110465	4	0.852
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_028957	Enterobacteria phage vB_EcoM_VR26, complete genome	110120-110146	4	0.852
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_028957	Enterobacteria phage vB_EcoM_VR26, complete genome	109829-109855	4	0.852
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	KJ510415	Mycobacterium phage Phantastic, complete genome	2696-2722	4	0.852
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_028925	Enterobacteria phage vB_EcoM_VR25, complete genome	109980-110006	4	0.852
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_028925	Enterobacteria phage vB_EcoM_VR25, complete genome	109689-109715	4	0.852
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_028925	Enterobacteria phage vB_EcoM_VR25, complete genome	110439-110465	4	0.852
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_028957	Enterobacteria phage vB_EcoM_VR26, complete genome	110120-110146	4	0.852
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_028957	Enterobacteria phage vB_EcoM_VR26, complete genome	109829-109855	4	0.852
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	KJ510415	Mycobacterium phage Phantastic, complete genome	2696-2722	4	0.852
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019086	Synechococcus phage ACG-2014f isolate Syn7803US17, complete genome	14662-14688	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019106	Synechococcus phage ACG-2014f isolate Syn7803US50, complete genome	14444-14470	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019107	Synechococcus phage ACG-2014f isolate Syn7803US52, complete genome	14431-14457	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019142	Synechococcus phage ACG-2014f isolate Syn7803C11, complete genome	14431-14457	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019149	Synechococcus phage ACG-2014f isolate Syn7803C21, complete genome	14444-14470	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019159	Synechococcus phage ACG-2014f isolate Syn7803C34, complete genome	14662-14688	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019123	Synechococcus phage ACG-2014f isolate Syn7803US7, complete genome	14441-14467	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019111	Synechococcus phage ACG-2014f isolate Syn7803US57, complete genome	14431-14457	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019148	Synechococcus phage ACG-2014f isolate Syn7803C19, complete genome	14444-14470	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019090	Synechococcus phage ACG-2014f isolate Syn7803US24, complete genome	14650-14676	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019146	Synechococcus phage ACG-2014f isolate Syn7803C16, complete genome	14427-14453	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019093	Synechococcus phage ACG-2014f isolate Syn7803US30, complete genome	14444-14470	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019151	Synechococcus phage ACG-2014f isolate Syn7803C24, complete genome	14430-14456	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019155	Synechococcus phage ACG-2014f isolate Syn7803C29, complete genome	14431-14457	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019147	Synechococcus phage ACG-2014f isolate Syn7803C17, complete genome	14429-14455	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019100	Synechococcus phage ACG-2014f isolate Syn7803US40, complete genome	14444-14470	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019101	Synechococcus phage ACG-2014f isolate Syn7803US42, complete genome	15527-15553	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019085	Synechococcus phage ACG-2014f isolate Syn7803US13, complete genome	14431-14457	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019091	Synechococcus phage ACG-2014f isolate Syn7803US26, complete genome	14431-14457	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	KJ019144	Synechococcus phage ACG-2014f isolate Syn7803C14, complete genome	14431-14457	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	NZ_LR723678	Arsenite-oxidising bacterium NT-25 plasmid 2	174350-174376	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	NZ_FO082821	Rhizobium sp. NT-26 plasmid NT26_p1, complete sequence	255571-255597	5	0.815
NZ_CP032365_3	3.29\|3718286\|27\|NZ_CP032365\|CRT	3718286-3718312	27	MN693092	Marine virus AFVG_25M37, complete genome	19117-19143	5	0.815
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29804-29830	5	0.815
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3675-3701	5	0.815
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181182-181208	5	0.815
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179864-179890	5	0.815
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182283-182309	5	0.815
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29804-29830	5	0.815
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3675-3701	5	0.815
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181182-181208	5	0.815
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179864-179890	5	0.815
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182283-182309	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	GU070616	Salmonella phage PVP-SE1, complete genome	52406-52432	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	MT986028	Arthrobacter phage Thunderclap, complete genome	5438-5464	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	MN234217	Arthrobacter phage Ichor, complete genome	5408-5434	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	KU160639	Arthrobacter phage Anansi, complete genome	5417-5443	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	KU160638	Arthrobacter phage Amigo, complete genome	5408-5434	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	KU160647	Arthrobacter phage Gorgeous, complete genome	5417-5443	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	KU160666	Arthrobacter phage SorJuana, complete genome	5417-5443	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	KU160663	Arthrobacter phage Rings, complete genome	5539-5565	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	MT310874	Arthrobacter phage Boersma, complete genome	5408-5434	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	JX181824	Salmonella phage SSE-121, complete genome	14903-14929	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	MN234164	Arthrobacter phage Yeezus, complete genome	5407-5433	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	MN234224	Arthrobacter phage Jaek, complete genome	5408-5434	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_018511	Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence	885-911	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NZ_CP009345	Bacillus thuringiensis HD1002 plasmid 6, complete sequence	1990-2016	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	AF246223	Mycoplasma virus P1, complete genome	8393-8419	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_002515	Mycoplasma phage P1, complete genome	8393-8419	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_001446	Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence	3724-3750	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_014260	Enterobacteria phage IME08, complete genome	109038-109064	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_048106	Synechococcus phage S-CBWM1, complete genome	57789-57815	5	0.815
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	HM071924	Enterobacteria phage IME08, complete sequence	109038-109064	5	0.815
NZ_CP032365_3	3.42\|3718808\|27\|NZ_CP032365\|CRT	3718808-3718834	27	MN693092	Marine virus AFVG_25M37, complete genome	19117-19143	5	0.815
NZ_CP032365_3	3.45\|3718925\|27\|NZ_CP032365\|CRT	3718925-3718951	27	MN693092	Marine virus AFVG_25M37, complete genome	19117-19143	5	0.815
NZ_CP032365_3	3.47\|3719006\|27\|NZ_CP032365\|CRT	3719006-3719032	27	MN693092	Marine virus AFVG_25M37, complete genome	19117-19143	5	0.815
NZ_CP032365_3	3.49\|3719087\|27\|NZ_CP032365\|CRT	3719087-3719113	27	MN693092	Marine virus AFVG_25M37, complete genome	19117-19143	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	GU070616	Salmonella phage PVP-SE1, complete genome	52406-52432	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	MT986028	Arthrobacter phage Thunderclap, complete genome	5438-5464	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	MN234217	Arthrobacter phage Ichor, complete genome	5408-5434	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	KU160639	Arthrobacter phage Anansi, complete genome	5417-5443	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	KU160638	Arthrobacter phage Amigo, complete genome	5408-5434	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	KU160647	Arthrobacter phage Gorgeous, complete genome	5417-5443	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	KU160666	Arthrobacter phage SorJuana, complete genome	5417-5443	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	KU160663	Arthrobacter phage Rings, complete genome	5539-5565	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	MT310874	Arthrobacter phage Boersma, complete genome	5408-5434	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	JX181824	Salmonella phage SSE-121, complete genome	14903-14929	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	MN234164	Arthrobacter phage Yeezus, complete genome	5407-5433	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	MN234224	Arthrobacter phage Jaek, complete genome	5408-5434	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_018511	Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence	885-911	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NZ_CP009345	Bacillus thuringiensis HD1002 plasmid 6, complete sequence	1990-2016	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	AF246223	Mycoplasma virus P1, complete genome	8393-8419	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_002515	Mycoplasma phage P1, complete genome	8393-8419	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_001446	Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence	3724-3750	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_014260	Enterobacteria phage IME08, complete genome	109038-109064	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_048106	Synechococcus phage S-CBWM1, complete genome	57789-57815	5	0.815
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	HM071924	Enterobacteria phage IME08, complete sequence	109038-109064	5	0.815
NZ_CP032365_3	3.56\|3719357\|27\|NZ_CP032365\|CRT	3719357-3719383	27	MN693092	Marine virus AFVG_25M37, complete genome	19117-19143	5	0.815
NZ_CP032365_3	3.1\|3717251\|27\|NZ_CP032365\|CRT	3717251-3717277	27	MF417887	Uncultured Caudovirales phage clone 7S_3, partial genome	22131-22157	6	0.778
NZ_CP032365_3	3.7\|3717476\|27\|NZ_CP032365\|CRT	3717476-3717502	27	MF668279	Arthrobacter phage Nellie, complete genome	27479-27505	6	0.778
NZ_CP032365_3	3.7\|3717476\|27\|NZ_CP032365\|CRT	3717476-3717502	27	NC_041875	Arthrobacter phage Jasmine, complete genome	29354-29380	6	0.778
NZ_CP032365_3	3.7\|3717476\|27\|NZ_CP032365\|CRT	3717476-3717502	27	MF668273	Arthrobacter phage GurgleFerb, complete genome	27478-27504	6	0.778
NZ_CP032365_3	3.7\|3717476\|27\|NZ_CP032365\|CRT	3717476-3717502	27	MH450114	Arthrobacter phage Brad, complete genome	27477-27503	6	0.778
NZ_CP032365_3	3.7\|3717476\|27\|NZ_CP032365\|CRT	3717476-3717502	27	MF668266	Arthrobacter phage Adat, complete genome	27479-27505	6	0.778
NZ_CP032365_3	3.20\|3717953\|27\|NZ_CP032365\|CRT	3717953-3717979	27	MF668279	Arthrobacter phage Nellie, complete genome	27479-27505	6	0.778
NZ_CP032365_3	3.20\|3717953\|27\|NZ_CP032365\|CRT	3717953-3717979	27	NC_041875	Arthrobacter phage Jasmine, complete genome	29354-29380	6	0.778
NZ_CP032365_3	3.20\|3717953\|27\|NZ_CP032365\|CRT	3717953-3717979	27	MF668273	Arthrobacter phage GurgleFerb, complete genome	27478-27504	6	0.778
NZ_CP032365_3	3.20\|3717953\|27\|NZ_CP032365\|CRT	3717953-3717979	27	MH450114	Arthrobacter phage Brad, complete genome	27477-27503	6	0.778
NZ_CP032365_3	3.20\|3717953\|27\|NZ_CP032365\|CRT	3717953-3717979	27	MF668266	Arthrobacter phage Adat, complete genome	27479-27505	6	0.778
NZ_CP032365_3	3.29\|3718286\|27\|NZ_CP032365\|CRT	3718286-3718312	27	HQ615693	Synechococcus phage S-CRM01, complete genome	25959-25985	6	0.778
NZ_CP032365_3	3.29\|3718286\|27\|NZ_CP032365\|CRT	3718286-3718312	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3675-3701	6	0.778
NZ_CP032365_3	3.29\|3718286\|27\|NZ_CP032365\|CRT	3718286-3718312	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29804-29830	6	0.778
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	MN693099	Marine virus AFVG_25M184, complete genome	13864-13890	6	0.778
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13201-13227	6	0.778
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	HQ615693	Synechococcus phage S-CRM01, complete genome	25959-25985	6	0.778
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13204-13230	6	0.778
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13201-13227	6	0.778
NZ_CP032365_3	3.31\|3718376\|27\|NZ_CP032365\|CRT	3718376-3718402	27	MF668279	Arthrobacter phage Nellie, complete genome	27479-27505	6	0.778
NZ_CP032365_3	3.31\|3718376\|27\|NZ_CP032365\|CRT	3718376-3718402	27	NC_041875	Arthrobacter phage Jasmine, complete genome	29354-29380	6	0.778
NZ_CP032365_3	3.31\|3718376\|27\|NZ_CP032365\|CRT	3718376-3718402	27	MF668273	Arthrobacter phage GurgleFerb, complete genome	27478-27504	6	0.778
NZ_CP032365_3	3.31\|3718376\|27\|NZ_CP032365\|CRT	3718376-3718402	27	MH450114	Arthrobacter phage Brad, complete genome	27477-27503	6	0.778
NZ_CP032365_3	3.31\|3718376\|27\|NZ_CP032365\|CRT	3718376-3718402	27	MF668266	Arthrobacter phage Adat, complete genome	27479-27505	6	0.778
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	MN693099	Marine virus AFVG_25M184, complete genome	13864-13890	6	0.778
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13201-13227	6	0.778
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	HQ615693	Synechococcus phage S-CRM01, complete genome	25959-25985	6	0.778
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13204-13230	6	0.778
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13201-13227	6	0.778
NZ_CP032365_3	3.33\|3718466\|27\|NZ_CP032365\|CRT	3718466-3718492	27	MF668279	Arthrobacter phage Nellie, complete genome	27479-27505	6	0.778
NZ_CP032365_3	3.33\|3718466\|27\|NZ_CP032365\|CRT	3718466-3718492	27	NC_041875	Arthrobacter phage Jasmine, complete genome	29354-29380	6	0.778
NZ_CP032365_3	3.33\|3718466\|27\|NZ_CP032365\|CRT	3718466-3718492	27	MF668273	Arthrobacter phage GurgleFerb, complete genome	27478-27504	6	0.778
NZ_CP032365_3	3.33\|3718466\|27\|NZ_CP032365\|CRT	3718466-3718492	27	MH450114	Arthrobacter phage Brad, complete genome	27477-27503	6	0.778
NZ_CP032365_3	3.33\|3718466\|27\|NZ_CP032365\|CRT	3718466-3718492	27	MF668266	Arthrobacter phage Adat, complete genome	27479-27505	6	0.778
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_028957	Enterobacteria phage vB_EcoM_VR26, complete genome	110156-110182	6	0.778
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_024210	Escherichia phage e4/1c, complete genome	7544-7570	6	0.778
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3059-3085	6	0.778
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2908-2934	6	0.778
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	409-435	6	0.778
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	192-218	6	0.778
NZ_CP032365_3	3.41\|3718763\|27\|NZ_CP032365\|CRT	3718763-3718789	27	NC_031065	Salmonella phage vB_SnwM_CGG4-1, complete genome	98982-99008	6	0.778
NZ_CP032365_3	3.45\|3718925\|27\|NZ_CP032365\|CRT	3718925-3718951	27	HQ615693	Synechococcus phage S-CRM01, complete genome	25959-25985	6	0.778
NZ_CP032365_3	3.45\|3718925\|27\|NZ_CP032365\|CRT	3718925-3718951	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3675-3701	6	0.778
NZ_CP032365_3	3.45\|3718925\|27\|NZ_CP032365\|CRT	3718925-3718951	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29804-29830	6	0.778
NZ_CP032365_3	3.47\|3719006\|27\|NZ_CP032365\|CRT	3719006-3719032	27	HQ615693	Synechococcus phage S-CRM01, complete genome	25959-25985	6	0.778
NZ_CP032365_3	3.47\|3719006\|27\|NZ_CP032365\|CRT	3719006-3719032	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3675-3701	6	0.778
NZ_CP032365_3	3.47\|3719006\|27\|NZ_CP032365\|CRT	3719006-3719032	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29804-29830	6	0.778
NZ_CP032365_3	3.49\|3719087\|27\|NZ_CP032365\|CRT	3719087-3719113	27	HQ615693	Synechococcus phage S-CRM01, complete genome	25959-25985	6	0.778
NZ_CP032365_3	3.49\|3719087\|27\|NZ_CP032365\|CRT	3719087-3719113	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3675-3701	6	0.778
NZ_CP032365_3	3.49\|3719087\|27\|NZ_CP032365\|CRT	3719087-3719113	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29804-29830	6	0.778
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_028957	Enterobacteria phage vB_EcoM_VR26, complete genome	110156-110182	6	0.778
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_024210	Escherichia phage e4/1c, complete genome	7544-7570	6	0.778
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3059-3085	6	0.778
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2908-2934	6	0.778
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	409-435	6	0.778
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	192-218	6	0.778
NZ_CP032365_3	3.55\|3719312\|27\|NZ_CP032365\|CRT	3719312-3719338	27	NC_031065	Salmonella phage vB_SnwM_CGG4-1, complete genome	98982-99008	6	0.778
NZ_CP032365_3	3.29\|3718286\|27\|NZ_CP032365\|CRT	3718286-3718312	27	MN693189	Marine virus AFVG_25M326, complete genome	18918-18944	7	0.741
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29495-29521	7	0.741
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3984-4010	7	0.741
NZ_CP032365_3	3.30\|3718331\|27\|NZ_CP032365\|CRT	3718331-3718357	27	MN693189	Marine virus AFVG_25M326, complete genome	18918-18944	7	0.741
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29495-29521	7	0.741
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3984-4010	7	0.741
NZ_CP032365_3	3.32\|3718421\|27\|NZ_CP032365\|CRT	3718421-3718447	27	MN693189	Marine virus AFVG_25M326, complete genome	18918-18944	7	0.741
NZ_CP032365_3	3.45\|3718925\|27\|NZ_CP032365\|CRT	3718925-3718951	27	MN693189	Marine virus AFVG_25M326, complete genome	18918-18944	7	0.741
NZ_CP032365_3	3.47\|3719006\|27\|NZ_CP032365\|CRT	3719006-3719032	27	MN693189	Marine virus AFVG_25M326, complete genome	18918-18944	7	0.741
NZ_CP032365_3	3.49\|3719087\|27\|NZ_CP032365\|CRT	3719087-3719113	27	MN693189	Marine virus AFVG_25M326, complete genome	18918-18944	7	0.741

1. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to NC_020910 (Octadecabacter arcticus 238 plasmid pOA238_160, complete sequence) position: , mismatch: 3, identity: 0.889

tggcgctactggtgccactg--ggcctca	CRISPR spacer
tggcgctactggtgccactgctggccc--	Protospacer
********************  ****.

2. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 4, identity: 0.852

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggtgctac	Protospacer
******.****************.*

3. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 4, identity: 0.852

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggtgctac	Protospacer
******.****************.*

4. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_028925 (Enterobacteria phage vB_EcoM_VR25, complete genome) position: , mismatch: 4, identity: 0.852

cgggcctcagggtattcaaggacctca	CRISPR spacer
cggtcctcaaggtattcaaggacctgt	Protospacer
*** *****.***************

5. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_028925 (Enterobacteria phage vB_EcoM_VR25, complete genome) position: , mismatch: 4, identity: 0.852

cgggcctcagggtattcaaggacctca	CRISPR spacer
cggccctcaaggtattcaaggaccgaa	Protospacer
*** *****.**************  *

6. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_028925 (Enterobacteria phage vB_EcoM_VR25, complete genome) position: , mismatch: 4, identity: 0.852

cgggcctcagggtattcaaggacctca	CRISPR spacer
cggtcctcaaggtattcaaggaccgaa	Protospacer
*** *****.**************  *

7. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_028957 (Enterobacteria phage vB_EcoM_VR26, complete genome) position: , mismatch: 4, identity: 0.852

cgggcctcagggtattcaaggacctca	CRISPR spacer
cggtcctcaaggtattcaaggacctgt	Protospacer
*** *****.***************

8. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_028957 (Enterobacteria phage vB_EcoM_VR26, complete genome) position: , mismatch: 4, identity: 0.852

cgggcctcagggtattcaaggacctca	CRISPR spacer
cggccctcaaggtattcaaggaccgaa	Protospacer
*** *****.**************  *

9. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to KJ510415 (Mycobacterium phage Phantastic, complete genome) position: , mismatch: 4, identity: 0.852

cgggcctcagggtattcaaggacctca	CRISPR spacer
agggcctcagggtattcagggtcctcc	Protospacer
 *****************.** ****

10. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_028925 (Enterobacteria phage vB_EcoM_VR25, complete genome) position: , mismatch: 4, identity: 0.852

cgggcctcagggtattcaaggacctca	CRISPR spacer
cggtcctcaaggtattcaaggacctgt	Protospacer
*** *****.***************

11. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_028925 (Enterobacteria phage vB_EcoM_VR25, complete genome) position: , mismatch: 4, identity: 0.852

cgggcctcagggtattcaaggacctca	CRISPR spacer
cggccctcaaggtattcaaggaccgaa	Protospacer
*** *****.**************  *

12. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_028925 (Enterobacteria phage vB_EcoM_VR25, complete genome) position: , mismatch: 4, identity: 0.852

cgggcctcagggtattcaaggacctca	CRISPR spacer
cggtcctcaaggtattcaaggaccgaa	Protospacer
*** *****.**************  *

13. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_028957 (Enterobacteria phage vB_EcoM_VR26, complete genome) position: , mismatch: 4, identity: 0.852

cgggcctcagggtattcaaggacctca	CRISPR spacer
cggtcctcaaggtattcaaggacctgt	Protospacer
*** *****.***************

14. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_028957 (Enterobacteria phage vB_EcoM_VR26, complete genome) position: , mismatch: 4, identity: 0.852

cgggcctcagggtattcaaggacctca	CRISPR spacer
cggccctcaaggtattcaaggaccgaa	Protospacer
*** *****.**************  *

15. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to KJ510415 (Mycobacterium phage Phantastic, complete genome) position: , mismatch: 4, identity: 0.852

cgggcctcagggtattcaaggacctca	CRISPR spacer
agggcctcagggtattcagggtcctcc	Protospacer
 *****************.** ****

16. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019086 (Synechococcus phage ACG-2014f isolate Syn7803US17, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

17. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019106 (Synechococcus phage ACG-2014f isolate Syn7803US50, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

18. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019107 (Synechococcus phage ACG-2014f isolate Syn7803US52, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

19. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019142 (Synechococcus phage ACG-2014f isolate Syn7803C11, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

20. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019149 (Synechococcus phage ACG-2014f isolate Syn7803C21, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

21. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019159 (Synechococcus phage ACG-2014f isolate Syn7803C34, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

22. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019123 (Synechococcus phage ACG-2014f isolate Syn7803US7, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

23. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019111 (Synechococcus phage ACG-2014f isolate Syn7803US57, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

24. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019148 (Synechococcus phage ACG-2014f isolate Syn7803C19, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

25. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019090 (Synechococcus phage ACG-2014f isolate Syn7803US24, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

26. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019146 (Synechococcus phage ACG-2014f isolate Syn7803C16, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

27. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019093 (Synechococcus phage ACG-2014f isolate Syn7803US30, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

28. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019151 (Synechococcus phage ACG-2014f isolate Syn7803C24, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

29. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019155 (Synechococcus phage ACG-2014f isolate Syn7803C29, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

30. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019147 (Synechococcus phage ACG-2014f isolate Syn7803C17, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

31. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019100 (Synechococcus phage ACG-2014f isolate Syn7803US40, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

32. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019101 (Synechococcus phage ACG-2014f isolate Syn7803US42, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

33. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019085 (Synechococcus phage ACG-2014f isolate Syn7803US13, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

34. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019091 (Synechococcus phage ACG-2014f isolate Syn7803US26, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

35. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to KJ019144 (Synechococcus phage ACG-2014f isolate Syn7803C14, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
agctgctactggtgccactggtcctga	Protospacer
 * .***************** *** *

36. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to NZ_LR723678 (Arsenite-oxidising bacterium NT-25 plasmid 2) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
tggcgctactggtgccgctggtggtcg	Protospacer
****************.****   **.

37. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to NZ_FO082821 (Rhizobium sp. NT-26 plasmid NT26_p1, complete sequence) position: , mismatch: 5, identity: 0.815

tggcgctactggtgccactgggcctca	CRISPR spacer
tggcgctactggtgccgctggtggtcg	Protospacer
****************.****   **.

38. spacer 3.29|3718286|27|NZ_CP032365|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 5, identity: 0.815

cggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggtgctac	Protospacer
.*****.****************.*

39. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggacctcaaggttctac	Protospacer
****** *************** .*

40. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggacctcaaggttctac	Protospacer
****** *************** .*

41. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggtcctcaaggtgatat	Protospacer
****** ***** ********** *

42. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggtcctcaaggtgatat	Protospacer
****** ***** ********** *

43. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggtcctcaaggtgatat	Protospacer
****** ***** ********** *

44. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggacctcaaggttctac	Protospacer
****** *************** .*

45. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggacctcaaggttctac	Protospacer
****** *************** .*

46. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggtcctcaaggtgatat	Protospacer
****** ***** ********** *

47. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggtcctcaaggtgatat	Protospacer
****** ***** ********** *

48. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggtcctcaaggtgatat	Protospacer
****** ***** ********** *

49. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to GU070616 (Salmonella phage PVP-SE1, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggtccacagggtattcaaggacctat	Protospacer
 ** ** ******************

50. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to MT986028 (Arthrobacter phage Thunderclap, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

51. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to MN234217 (Arthrobacter phage Ichor, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

52. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to KU160639 (Arthrobacter phage Anansi, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

53. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to KU160638 (Arthrobacter phage Amigo, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

54. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to KU160647 (Arthrobacter phage Gorgeous, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

55. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to KU160666 (Arthrobacter phage SorJuana, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

56. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to KU160663 (Arthrobacter phage Rings, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

57. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to MT310874 (Arthrobacter phage Boersma, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

58. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to JX181824 (Salmonella phage SSE-121, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggtccacagggtattcaaggacctat	Protospacer
 ** ** ******************

59. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to MN234164 (Arthrobacter phage Yeezus, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

60. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to MN234224 (Arthrobacter phage Jaek, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

61. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_018511 (Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcagggtattcaaggtccacc	Protospacer
 **.***************** ** *

62. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NZ_CP009345 (Bacillus thuringiensis HD1002 plasmid 6, complete sequence) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcagggtattcaaggtccacc	Protospacer
 **.***************** ** *

63. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
agggcctcaaggtgttcaaggaccaaa	Protospacer
 ********.***.**********  *

64. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
agggcctcaaggtgttcaaggaccaaa	Protospacer
 ********.***.**********  *

65. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_001446 (Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcagggtattcaaggtccacc	Protospacer
 **.***************** ** *

66. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_014260 (Enterobacteria phage IME08, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggtattcaaggtattcaaggacctca	Protospacer
 **  .***.*****************

67. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
tgggccacaaggtattcaaggaccaga	Protospacer
.***** **.**************  *

68. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to HM071924 (Enterobacteria phage IME08, complete sequence) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggtattcaaggtattcaaggacctca	Protospacer
 **  .***.*****************

69. spacer 3.42|3718808|27|NZ_CP032365|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggtgctac	Protospacer
***.*****.*************.*

70. spacer 3.45|3718925|27|NZ_CP032365|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 5, identity: 0.815

cggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggtgctac	Protospacer
.*****.****************.*

71. spacer 3.47|3719006|27|NZ_CP032365|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 5, identity: 0.815

cggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggtgctac	Protospacer
.*****.****************.*

72. spacer 3.49|3719087|27|NZ_CP032365|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 5, identity: 0.815

cggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggtgctac	Protospacer
.*****.****************.*

73. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to GU070616 (Salmonella phage PVP-SE1, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggtccacagggtattcaaggacctat	Protospacer
 ** ** ******************

74. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to MT986028 (Arthrobacter phage Thunderclap, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

75. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to MN234217 (Arthrobacter phage Ichor, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

76. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to KU160639 (Arthrobacter phage Anansi, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

77. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to KU160638 (Arthrobacter phage Amigo, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

78. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to KU160647 (Arthrobacter phage Gorgeous, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

79. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to KU160666 (Arthrobacter phage SorJuana, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

80. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to KU160663 (Arthrobacter phage Rings, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

81. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to MT310874 (Arthrobacter phage Boersma, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

82. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to JX181824 (Salmonella phage SSE-121, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggtccacagggtattcaaggacctat	Protospacer
 ** ** ******************

83. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to MN234164 (Arthrobacter phage Yeezus, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

84. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to MN234224 (Arthrobacter phage Jaek, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
ggggcctcagggtatccaaggccctgc	Protospacer
 **************.***** ***

85. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_018511 (Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcagggtattcaaggtccacc	Protospacer
 **.***************** ** *

86. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NZ_CP009345 (Bacillus thuringiensis HD1002 plasmid 6, complete sequence) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcagggtattcaaggtccacc	Protospacer
 **.***************** ** *

87. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
agggcctcaaggtgttcaaggaccaaa	Protospacer
 ********.***.**********  *

88. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
agggcctcaaggtgttcaaggaccaaa	Protospacer
 ********.***.**********  *

89. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_001446 (Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcagggtattcaaggtccacc	Protospacer
 **.***************** ** *

90. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_014260 (Enterobacteria phage IME08, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggtattcaaggtattcaaggacctca	Protospacer
 **  .***.*****************

91. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
tgggccacaaggtattcaaggaccaga	Protospacer
.***** **.**************  *

92. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to HM071924 (Enterobacteria phage IME08, complete sequence) position: , mismatch: 5, identity: 0.815

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggtattcaaggtattcaaggacctca	Protospacer
 **  .***.*****************

93. spacer 3.56|3719357|27|NZ_CP032365|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 5, identity: 0.815

tggcgctaccggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggtgctac	Protospacer
***.*****.*************.*

94. spacer 3.1|3717251|27|NZ_CP032365|CRT matches to MF417887 (Uncultured Caudovirales phage clone 7S_3, partial genome) position: , mismatch: 6, identity: 0.778

tggcgctactggtgccactgggcctca----	CRISPR spacer
cggcgctactggtgccactg----tcgtcgc	Protospacer
.*******************    **.

95. spacer 3.7|3717476|27|NZ_CP032365|CRT matches to MF668279 (Arthrobacter phage Nellie, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

96. spacer 3.7|3717476|27|NZ_CP032365|CRT matches to NC_041875 (Arthrobacter phage Jasmine, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

97. spacer 3.7|3717476|27|NZ_CP032365|CRT matches to MF668273 (Arthrobacter phage GurgleFerb, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

98. spacer 3.7|3717476|27|NZ_CP032365|CRT matches to MH450114 (Arthrobacter phage Brad, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

99. spacer 3.7|3717476|27|NZ_CP032365|CRT matches to MF668266 (Arthrobacter phage Adat, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

100. spacer 3.20|3717953|27|NZ_CP032365|CRT matches to MF668279 (Arthrobacter phage Nellie, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

101. spacer 3.20|3717953|27|NZ_CP032365|CRT matches to NC_041875 (Arthrobacter phage Jasmine, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

102. spacer 3.20|3717953|27|NZ_CP032365|CRT matches to MF668273 (Arthrobacter phage GurgleFerb, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

103. spacer 3.20|3717953|27|NZ_CP032365|CRT matches to MH450114 (Arthrobacter phage Brad, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

104. spacer 3.20|3717953|27|NZ_CP032365|CRT matches to MF668266 (Arthrobacter phage Adat, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

105. spacer 3.29|3718286|27|NZ_CP032365|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 6, identity: 0.778

cggtgccactggacctcaaggtgttca	CRISPR spacer
aggtgatactggacctcaaggtgtaac	Protospacer
 **** .*****************

106. spacer 3.29|3718286|27|NZ_CP032365|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

cggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggacctcaaggttctac	Protospacer
.***** *************** .*

107. spacer 3.29|3718286|27|NZ_CP032365|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

cggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggacctcaaggttctac	Protospacer
.***** *************** .*

108. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 6, identity: 0.778

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggacctac	Protospacer
******.**************  .*

109. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 6, identity: 0.778

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggtcctcaaggtgagtt	Protospacer
******.***** **********  .

110. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 6, identity: 0.778

tggtgccactggacctcaaggtgttca	CRISPR spacer
aggtgatactggacctcaaggtgtaac	Protospacer
 **** .*****************

111. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 6, identity: 0.778

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggtcctcaaggtgagtt	Protospacer
******.***** **********  .

112. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 6, identity: 0.778

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggtcctcaaggtgagtt	Protospacer
******.***** **********  .

113. spacer 3.31|3718376|27|NZ_CP032365|CRT matches to MF668279 (Arthrobacter phage Nellie, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

114. spacer 3.31|3718376|27|NZ_CP032365|CRT matches to NC_041875 (Arthrobacter phage Jasmine, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

115. spacer 3.31|3718376|27|NZ_CP032365|CRT matches to MF668273 (Arthrobacter phage GurgleFerb, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

116. spacer 3.31|3718376|27|NZ_CP032365|CRT matches to MH450114 (Arthrobacter phage Brad, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

117. spacer 3.31|3718376|27|NZ_CP032365|CRT matches to MF668266 (Arthrobacter phage Adat, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

118. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 6, identity: 0.778

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggacctac	Protospacer
******.**************  .*

119. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 6, identity: 0.778

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggtcctcaaggtgagtt	Protospacer
******.***** **********  .

120. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 6, identity: 0.778

tggtgccactggacctcaaggtgttca	CRISPR spacer
aggtgatactggacctcaaggtgtaac	Protospacer
 **** .*****************

121. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 6, identity: 0.778

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggtcctcaaggtgagtt	Protospacer
******.***** **********  .

122. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 6, identity: 0.778

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggtcctcaaggtgagtt	Protospacer
******.***** **********  .

123. spacer 3.33|3718466|27|NZ_CP032365|CRT matches to MF668279 (Arthrobacter phage Nellie, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

124. spacer 3.33|3718466|27|NZ_CP032365|CRT matches to NC_041875 (Arthrobacter phage Jasmine, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

125. spacer 3.33|3718466|27|NZ_CP032365|CRT matches to MF668273 (Arthrobacter phage GurgleFerb, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

126. spacer 3.33|3718466|27|NZ_CP032365|CRT matches to MH450114 (Arthrobacter phage Brad, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

127. spacer 3.33|3718466|27|NZ_CP032365|CRT matches to MF668266 (Arthrobacter phage Adat, complete genome) position: , mismatch: 6, identity: 0.778

cggtgctactggacctcagggcgttca	CRISPR spacer
aatagctaccggccctcagggcgttca	Protospacer
 .  *****.** **************

128. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_028957 (Enterobacteria phage vB_EcoM_VR26, complete genome) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
agggccgcagggtattcagggaccaag	Protospacer
 ***** ***********.*****  .

129. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
gggacctcaaggtattcaaggaccagc	Protospacer
 **.*****.**************

130. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcaaggtattcaaggaccagc	Protospacer
 **.*****.**************

131. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcaaggtattcaaggaccagc	Protospacer
 **.*****.**************

132. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcaaggtattcaaggaccagc	Protospacer
 **.*****.**************

133. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcaaggtattcaaggaccagc	Protospacer
 **.*****.**************

134. spacer 3.41|3718763|27|NZ_CP032365|CRT matches to NC_031065 (Salmonella phage vB_SnwM_CGG4-1, complete genome) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
agggccacagggaattcaaggacccac	Protospacer
 ***** ***** ***********.

135. spacer 3.45|3718925|27|NZ_CP032365|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 6, identity: 0.778

cggtgccactggacctcaaggtgttca	CRISPR spacer
aggtgatactggacctcaaggtgtaac	Protospacer
 **** .*****************

136. spacer 3.45|3718925|27|NZ_CP032365|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

cggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggacctcaaggttctac	Protospacer
.***** *************** .*

137. spacer 3.45|3718925|27|NZ_CP032365|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

cggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggacctcaaggttctac	Protospacer
.***** *************** .*

138. spacer 3.47|3719006|27|NZ_CP032365|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 6, identity: 0.778

cggtgccactggacctcaaggtgttca	CRISPR spacer
aggtgatactggacctcaaggtgtaac	Protospacer
 **** .*****************

139. spacer 3.47|3719006|27|NZ_CP032365|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

cggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggacctcaaggttctac	Protospacer
.***** *************** .*

140. spacer 3.47|3719006|27|NZ_CP032365|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

cggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggacctcaaggttctac	Protospacer
.***** *************** .*

141. spacer 3.49|3719087|27|NZ_CP032365|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 6, identity: 0.778

cggtgccactggacctcaaggtgttca	CRISPR spacer
aggtgatactggacctcaaggtgtaac	Protospacer
 **** .*****************

142. spacer 3.49|3719087|27|NZ_CP032365|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

cggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggacctcaaggttctac	Protospacer
.***** *************** .*

143. spacer 3.49|3719087|27|NZ_CP032365|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

cggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgcaactggacctcaaggttctac	Protospacer
.***** *************** .*

144. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_028957 (Enterobacteria phage vB_EcoM_VR26, complete genome) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
agggccgcagggtattcagggaccaag	Protospacer
 ***** ***********.*****  .

145. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
gggacctcaaggtattcaaggaccagc	Protospacer
 **.*****.**************

146. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcaaggtattcaaggaccagc	Protospacer
 **.*****.**************

147. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcaaggtattcaaggaccagc	Protospacer
 **.*****.**************

148. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcaaggtattcaaggaccagc	Protospacer
 **.*****.**************

149. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
aggacctcaaggtattcaaggaccagc	Protospacer
 **.*****.**************

150. spacer 3.55|3719312|27|NZ_CP032365|CRT matches to NC_031065 (Salmonella phage vB_SnwM_CGG4-1, complete genome) position: , mismatch: 6, identity: 0.778

cgggcctcagggtattcaaggacctca	CRISPR spacer
agggccacagggaattcaaggacccac	Protospacer
 ***** ***** ***********.

151. spacer 3.29|3718286|27|NZ_CP032365|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 7, identity: 0.741

cggtgccactggacctcaaggtgttca	CRISPR spacer
aggtgctactggacctcaaggtccagc	Protospacer
 *****.*************** .

152. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 7, identity: 0.741

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggaccagc	Protospacer
******.**************  .

153. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.741

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggaccagc	Protospacer
******.**************  .

154. spacer 3.30|3718331|27|NZ_CP032365|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 7, identity: 0.741

tggtgccactggacctcaaggtgttca	CRISPR spacer
aggtgctactggacctcaaggtccagc	Protospacer
 *****.*************** .

155. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 7, identity: 0.741

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggaccagc	Protospacer
******.**************  .

156. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.741

tggtgccactggacctcaaggtgttca	CRISPR spacer
tggtgctactggacctcaaggaccagc	Protospacer
******.**************  .

157. spacer 3.32|3718421|27|NZ_CP032365|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 7, identity: 0.741

tggtgccactggacctcaaggtgttca	CRISPR spacer
aggtgctactggacctcaaggtccagc	Protospacer
 *****.*************** .

158. spacer 3.45|3718925|27|NZ_CP032365|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 7, identity: 0.741

cggtgccactggacctcaaggtgttca	CRISPR spacer
aggtgctactggacctcaaggtccagc	Protospacer
 *****.*************** .

159. spacer 3.47|3719006|27|NZ_CP032365|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 7, identity: 0.741

cggtgccactggacctcaaggtgttca	CRISPR spacer
aggtgctactggacctcaaggtccagc	Protospacer
 *****.*************** .

160. spacer 3.49|3719087|27|NZ_CP032365|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 7, identity: 0.741

cggtgccactggacctcaaggtgttca	CRISPR spacer
aggtgctactggacctcaaggtccagc	Protospacer
 *****.*************** .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

261812 : 269759

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917306.1\|261812_262097_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8
WP_001029984.1\|262135_263770_+	chaperonin GroEL	A0A219YK78	uncultured_virus	6.5e-156	57.8
WP_164085719.1\|264172_265714_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.2e-21	31.7
WP_000833097.1\|266097_267423_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	9.2e-44	29.4
WP_001262950.1\|267568_268270_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.3e-40	36.9
WP_000719256.1\|268253_269759_+	aminopeptidase AmpS	W8CYF6	Bacillus_phage	7.1e-32	29.0

DBSCAN-SWA_2

312922 : 321294

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625688.1\|312922_314230_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	2.4e-20	24.7
WP_001170536.1\|314318_315038_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	3.0e-49	44.3
WP_000278821.1\|315030_315285_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666772.1\|315281_315965_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_064472453.1\|315948_318168_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.3e-162	41.0
WP_000879030.1\|318152_319568_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.1e-54	35.2
WP_001262447.1\|319669_320710_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.6e-67	45.6
WP_000088568.1\|320706_321294_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.2e-27	36.4

DBSCAN-SWA_3

1899515 : 1908846

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755541.1\|1899515_1900796_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	3.4e-11	31.5
WP_001194295.1\|1900894_1901659_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_048566554.1\|1901899_1903660_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.0e-267	95.7
WP_139019641.1\|1903739_1904426_+	response regulator	W8CYM9	Bacillus_phage	2.9e-118	93.4
WP_001231636.1\|1904422_1905496_+	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	4.1e-175	92.2
WP_064056572.1\|1905519_1906107_-	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_000818988.1\|1906303_1907023_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_151035404.1\|1907170_1907842_+	O-methyltransferase	W8CYT3	Bacillus_phage	2.8e-65	92.0
WP_061671823.1\|1907973_1908846_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	4.8e-65	44.4

DBSCAN-SWA_4

2738976 : 2746217

Apis_mellifera_filamentous_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048566256.1\|2738976_2740344_-	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	5.6e-20	37.5
WP_151035441.1\|2740700_2741894_-	glycosyl transferase family 1	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	3.1e-06	26.2
WP_001078764.1\|2741964_2742642_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BUR2	Microcystis_phage	1.3e-33	40.2
WP_000720540.1\|2742674_2743193_-	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	1.5e-42	46.0
WP_001056435.1\|2743214_2743601_-	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_000655481.1\|2743662_2744373_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	6.1e-18	27.5
WP_033658841.1\|2744394_2744748_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_000288955.1\|2744763_2745168_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_033658753.1\|2745410_2746217_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	6.7e-106	67.8

DBSCAN-SWA_5

3465261 : 3477319

Bacillus_phage(69.23%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000898179.1\|3465261_3465819_+	CatB-related O-acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	5.8e-40	50.7
WP_000570181.1\|3467179_3467419_-	hypothetical protein	A0A0A7AR38	Bacillus_phage	1.3e-25	74.7
WP_000348873.1\|3467418_3467655_-	hypothetical protein	A0A2H4J382	uncultured_Caudovirales_phage	3.1e-11	80.8
WP_000185567.1\|3467733_3468030_-	hypothetical protein	NA	NA	NA	NA
WP_001051383.1\|3468413_3469376_-	M23 family metallopeptidase	G9J3H9	Clostridium_phage	4.4e-11	37.9
WP_000025241.1\|3469482_3470601_-	lysozyme family protein	A0A223LKM8	Bacillus_phage	1.9e-34	44.3
WP_000716768.1\|3471000_3472053_-	glycoside hydrolase family 25	A7KV11	Bacillus_phage	1.4e-66	48.3
WP_001051382.1\|3472185_3473070_-	M23 family metallopeptidase	A0A1D8EVX2	Mycobacterium_phage	6.2e-12	27.2
WP_048565923.1\|3473335_3474352_-	lysozyme family protein	A0A1B1PAK0	Bacillus_phage	9.0e-31	36.4
WP_151035494.1\|3474589_3474976_-	hypothetical protein	A0A288WG73	Bacillus_phage	3.7e-46	68.3
WP_000510884.1\|3475076_3475979_-	DnaD domain protein	A0A1C8E9B4	Bacillus_phage	6.7e-70	61.3
WP_000527105.1\|3476065_3476302_-	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	3.1e-11	56.9
WP_000580595.1\|3476439_3476868_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	1.6e-29	51.4
WP_000673783.1\|3476890_3477319_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	7.3e-35	55.1

DBSCAN-SWA_6

3665334 : 3688555

uncultured_Caudovirales_phage(33.33%)

holin,capsid,tail,protease,portal,terminase,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151035499.1\|3665334_3665574_-\|holin	holin	A0A0A7AR38	Bacillus_phage	5.2e-30	86.1
WP_000398741.1\|3665573_3665810_-	hypothetical protein	A0A2H4J382	uncultured_Caudovirales_phage	1.9e-16	92.3
WP_167514912.1\|3665848_3668647_-	hypothetical protein	A0A1B1P831	Bacillus_phage	2.0e-144	43.0
WP_151035500.1\|3672096_3673569_-\|tail	phage tail family protein	D2XPZ5	Bacillus_virus	7.7e-225	74.2
WP_151035501.1\|3673610_3675995_-	hypothetical protein	A0A2H4JC82	uncultured_Caudovirales_phage	5.5e-47	47.9
WP_078206662.1\|3676260_3677508_-	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	6.8e-182	84.3
WP_016091257.1\|3677738_3678101_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	3.5e-46	73.9
WP_098057514.1\|3678105_3678699_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	9.1e-92	84.0
WP_065223373.1\|3678699_3679029_-	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	8.4e-47	83.5
WP_088065451.1\|3679025_3679382_-	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	1.7e-29	58.6
WP_098204324.1\|3679374_3679674_-\|head	phage head closure protein	R9TPZ2	Paenibacillus_phage	4.4e-10	40.4
WP_142316199.1\|3679670_3679943_-	DNA-packaging protein	R9TMB7	Paenibacillus_phage	1.5e-20	56.2
WP_151035502.1\|3679945_3680236_-	hypothetical protein	A6XMJ7	Bacillus_virus	3.7e-06	39.0
WP_000854838.1\|3680272_3681436_-\|capsid	phage major capsid protein	H7BUQ0	unidentified_phage	1.8e-80	54.7
WP_098204327.1\|3681449_3682034_-\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	3.9e-39	50.0
WP_151035503.1\|3681999_3683211_-\|portal	phage portal protein	J9QE83	Clostridium_phage	1.0e-137	59.4
WP_151035504.1\|3683226_3684915_-\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	5.0e-252	72.9
WP_000985226.1\|3684911_3685283_-	hypothetical protein	R9TQ46	Paenibacillus_phage	1.3e-24	55.0
WP_151035505.1\|3685449_3685746_-	HNH endonuclease	R9TNN2	Paenibacillus_phage	4.6e-28	60.4
WP_151035506.1\|3685923_3686607_-	hypothetical protein	NA	NA	NA	NA
WP_000352021.1\|3686788_3686950_+	hypothetical protein	NA	NA	NA	NA
WP_151035507.1\|3687221_3687644_+	type II toxin-antitoxin system HicB family antitoxin	A0A1L2JY34	Aeribacillus_phage	5.2e-41	59.1
WP_151035508.1\|3687730_3688156_-	hypothetical protein	NA	NA	NA	NA
WP_151035509.1\|3688276_3688555_-	helix-turn-helix domain-containing protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	1.2e-09	43.8

DBSCAN-SWA_7

3696555 : 3708853

Bacillus_phage(63.16%)

integrase

attL 3706112:3706125|attR 3709873:3709886

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098812741.1\|3696555_3696930_-	DUF1492 domain-containing protein	A0A0M4R397	Bacillus_phage	2.1e-41	66.9
WP_151035513.1\|3696934_3697222_-	hypothetical protein	A6M999	Geobacillus_virus	4.9e-35	72.3
WP_151035514.1\|3697353_3697875_+	restriction endonuclease	NA	NA	NA	NA
WP_151035515.1\|3697902_3698322_-	DNA methyltransferase	A0A1S5SFL7	Streptococcus_phage	1.7e-28	59.6
WP_151035516.1\|3698275_3698818_-	DNA (cytosine-5-)-methyltransferase	A0A0A8WFL3	Clostridium_phage	1.6e-55	56.7
WP_151035517.1\|3698873_3699620_-	FAD-dependent thymidylate synthase	A0A2P1JUN2	Bacillus_phage	7.7e-80	63.3
WP_044810252.1\|3699658_3700231_-	dUTPase	A0A0A7AQI4	Bacillus_phage	2.6e-80	73.8
WP_000553935.1\|3700325_3700448_-	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_151035518.1\|3700450_3701080_-	hypothetical protein	A0A0M4RU33	Bacillus_phage	5.2e-29	40.5
WP_088065475.1\|3701076_3701247_-	hypothetical protein	NA	NA	NA	NA
WP_000573307.1\|3701243_3701432_-	hypothetical protein	NA	NA	NA	NA
WP_151035519.1\|3701455_3702286_-	ATP-binding protein	U5PWH5	Bacillus_phage	7.6e-36	38.4
WP_151035520.1\|3702221_3702980_-	replication protein	A0A1W6JNI1	Staphylococcus_phage	4.8e-61	54.9
WP_078182965.1\|3702976_3703249_-	hypothetical protein	A0A0M4S680	Bacillus_phage	5.0e-37	79.8
WP_098328746.1\|3703262_3703934_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.0e-27	46.3
WP_151035521.1\|3703930_3704413_-	siphovirus Gp157 family protein	E5DV79	Deep-sea_thermophilic_phage	6.3e-35	49.4
WP_151035522.1\|3704427_3704691_-	hypothetical protein	A0A0M5M3T1	Bacillus_phage	2.2e-10	59.3
WP_144467654.1\|3704662_3704980_-	hypothetical protein	NA	NA	NA	NA
WP_000483547.1\|3705130_3705397_-	hypothetical protein	S5MC08	Brevibacillus_phage	6.6e-26	57.0
WP_151035523.1\|3705416_3706145_-	Rha family transcriptional regulator	A0A288WFT2	Bacillus_phage	1.9e-51	49.5
3706112:3706125	attL	NA	NA	NA	NA
WP_000877760.1\|3706141_3706342_-	helix-turn-helix transcriptional regulator	A0A0C5AJQ3	Paenibacillus_phage	1.4e-09	52.6
WP_151035524.1\|3706617_3707031_+	helix-turn-helix transcriptional regulator	A0A0M4QX29	Bacillus_phage	6.6e-25	46.4
WP_098948885.1\|3707053_3707482_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	2.4e-33	54.4
WP_078182958.1\|3707498_3707666_+	hypothetical protein	NA	NA	NA	NA
WP_167514913.1\|3707704_3708853_+\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	2.0e-66	38.5
3709873:3709886	attR	NA	NA	NA	NA

DBSCAN-SWA_8

4228374 : 4267762

Bacillus_phage(83.67%)

holin,capsid,tail,plate,integrase,protease,portal,terminase,head

attL 4229158:4229173|attR 4269530:4269545

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000183841.1\|4228374_4229025_-	2OG-Fe(II) oxygenase	A0A1V0SIE1	Klosneuvirus	1.5e-18	31.1
4229158:4229173	attL	NA	NA	NA	NA
WP_001245749.1\|4229199_4229571_-	competence protein ComG	NA	NA	NA	NA
WP_151035543.1\|4229567_4229912_-	competence protein ComG	NA	NA	NA	NA
WP_151035545.1\|4230042_4230666_-	hypothetical protein	H0USY2	Bacillus_phage	1.6e-99	84.9
WP_151035546.1\|4230607_4231789_-	cell division protein FtsK	H0USY1	Bacillus_phage	1.7e-190	83.2
WP_151035547.1\|4231904_4232087_-	hypothetical protein	Q2I8E2	Bacillus_phage	1.4e-22	88.3
WP_151035678.1\|4232089_4232392_-	hypothetical protein	A0A288WG38	Bacillus_phage	5.0e-46	88.9
WP_151035548.1\|4232555_4232753_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_151035549.1\|4232774_4233041_+	hypothetical protein	NA	NA	NA	NA
WP_151035550.1\|4233999_4234425_-\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	4.1e-62	85.1
WP_081257737.1\|4234460_4234625_-	XkdX family protein	NA	NA	NA	NA
WP_151035551.1\|4234626_4235064_-	hypothetical protein	NA	NA	NA	NA
WP_151035552.1\|4235082_4236273_-\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	8.3e-52	33.2
WP_106405210.1\|4236199_4236394_-	hypothetical protein	NA	NA	NA	NA
WP_167514903.1\|4236405_4238568_-	endopeptidase	A0A1B1P7P0	Bacillus_phage	1.5e-139	46.0
WP_060487450.1\|4238564_4239254_-\|tail	phage tail protein	A0A1C8EA72	Bacillus_phage	1.2e-55	46.9
WP_151035554.1\|4239256_4243765_-	hypothetical protein	A6XMK6	Bacillus_virus	9.6e-117	51.5
WP_151035555.1\|4243943_4244405_-	hypothetical protein	A0A1B1P772	Bacillus_phage	2.3e-50	62.1
WP_151035556.1\|4244472_4245057_-\|tail	phage tail protein	A0A1B1P778	Bacillus_phage	9.5e-94	86.4
WP_151035557.1\|4245058_4245487_-	hypothetical protein	A0A1B1P769	Bacillus_phage	3.2e-62	82.3
WP_151035679.1\|4245473_4245851_-	hypothetical protein	A0A1B1P759	Bacillus_phage	7.3e-55	88.0
WP_151035558.1\|4245867_4246224_-\|head	phage head closure protein	A0A1B1P760	Bacillus_phage	2.2e-53	88.1
WP_151035559.1\|4246204_4246504_-	hypothetical protein	A0A1B1P751	Bacillus_phage	8.2e-41	83.5
WP_151035560.1\|4246513_4246738_-	hypothetical protein	NA	NA	NA	NA
WP_088667782.1\|4246752_4247904_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.5e-207	95.0
WP_151035680.1\|4247932_4248658_-\|protease	Clp protease ClpP	A0A1B1P753	Bacillus_phage	3.1e-110	89.6
WP_151035561.1\|4248650_4249826_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	6.2e-209	92.8
WP_151035681.1\|4249840_4251523_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	0.0e+00	94.8
WP_151035562.1\|4251506_4251824_-	hypothetical protein	A0A1B1P762	Bacillus_phage	1.4e-43	85.8
WP_151035682.1\|4251932_4252241_-	hypothetical protein	A0A1B1P767	Bacillus_phage	3.6e-44	88.5
WP_098578464.1\|4252243_4252591_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	5.8e-22	50.5
WP_151035563.1\|4253133_4253358_-	hypothetical protein	A0A1B1P745	Bacillus_phage	1.7e-19	67.6
WP_151035564.1\|4253364_4253664_-	hypothetical protein	NA	NA	NA	NA
WP_098831933.1\|4254272_4254815_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P746	Bacillus_phage	1.8e-94	98.3
WP_098831932.1\|4254811_4255282_-	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	3.5e-78	94.2
WP_167514904.1\|4255302_4255473_-	hypothetical protein	A0A1B1P735	Bacillus_phage	1.0e-08	91.1
WP_000212570.1\|4255588_4255711_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_151035565.1\|4255740_4256070_-	hypothetical protein	A0A191ZDH8	Pseudoalteromonas_virus	3.3e-11	35.8
WP_167514905.1\|4256158_4256320_-	hypothetical protein	NA	NA	NA	NA
WP_151035566.1\|4256351_4257272_-	DNA (cytosine-5-)-methyltransferase	A0A0U4JEA2	Bacillus_phage	5.5e-88	59.7
WP_151035567.1\|4257315_4257657_-	hypothetical protein	NA	NA	NA	NA
WP_151035568.1\|4257692_4258091_-	hypothetical protein	W8CYU3	Bacillus_phage	8.0e-52	74.2
WP_151035569.1\|4258120_4258498_-	hypothetical protein	A0A0D4DCF5	Staphylococcus_phage	6.7e-08	30.9
WP_167514899.1\|4258494_4258659_-	hypothetical protein	A0A140HLS3	Bacillus_phage	9.0e-10	55.6
WP_167514906.1\|4258685_4258853_-	hypothetical protein	NA	NA	NA	NA
WP_151035570.1\|4258898_4259153_-	hypothetical protein	A0A1B1P779	Bacillus_phage	2.9e-31	73.8
WP_151035683.1\|4259218_4259404_-	glyoxalase	A0A1B0T6B5	Bacillus_phage	3.2e-19	77.0
WP_151035571.1\|4259419_4259674_-	hypothetical protein	A0A1B1P7U6	Bacillus_phage	3.9e-36	85.7
WP_151035572.1\|4259688_4259862_-	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.8e-24	96.5
WP_151035573.1\|4259887_4260082_-	hypothetical protein	A0A0U3K3J8	Bacillus_phage	2.2e-23	81.2
WP_151035574.1\|4260097_4260973_-	ATP-binding protein	Q2I8C8	Bacillus_phage	1.8e-64	46.5
WP_151035575.1\|4260911_4261658_-	DnaD domain protein	A0A1B0T6C0	Bacillus_phage	1.4e-78	80.3
WP_167514907.1\|4261663_4261840_-	hypothetical protein	A0A0U3SQC4	Bacillus_phage	4.8e-25	94.8
WP_167514908.1\|4261869_4262034_-	hypothetical protein	A0A0U3B230	Bacillus_phage	9.6e-20	87.0
WP_151035576.1\|4262046_4262307_-	group-specific protein	A0A1B1P7U4	Bacillus_phage	1.3e-42	94.2
WP_151035577.1\|4262346_4263078_-	Rha family transcriptional regulator	A0A1B1P7T7	Bacillus_phage	1.0e-129	95.5
WP_151035578.1\|4263040_4263319_-	helix-turn-helix domain-containing protein	B5LPU7	Bacillus_virus	1.2e-33	94.9
WP_098152302.1\|4263573_4263918_+	helix-turn-helix transcriptional regulator	D2XQ11	Bacillus_virus	3.9e-55	95.6
WP_167514909.1\|4264227_4264380_-	hypothetical protein	B5LPU5	Bacillus_virus	2.7e-16	88.0
WP_151035579.1\|4264414_4265554_-	hypothetical protein	D2XQ10	Bacillus_virus	8.7e-200	92.3
WP_151035580.1\|4266047_4266392_+	helix-turn-helix domain-containing protein	A0A1B1P888	Bacillus_phage	1.8e-20	46.4
WP_151035581.1\|4266592_4267762_+\|integrase	tyrosine-type recombinase/integrase	A0A0M5M609	Bacillus_phage	4.6e-63	38.4
4269530:4269545	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP032366

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP032365

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection