CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP044131	Comamonas testosteroni strain NFYY023 chromosome, complete genome	2 crisprs	DEDDh,csa3,DinG,csx1,WYL	0	0	12	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044131_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044131_1

922983-923085

Orphan

Consensus_repeat	Method
GGCGAGCGCCAGGAGCGCAGCTTCG	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP044131_1

>merge|NZ_CP044131|1|922983-923085|CRISPRCasFinder
GGCGAGCGCCAGGAGCGCAGCTTCGAGCGCCGTGATGATCGCGGCAGCTTTGGCGGCGACCGTGGCGGCTTCCGTGGTGGCGAGCGTCAGGAGCGCAGCTTCG

>NZ_CP044131|1|1|922983-923085|CRISPRCasFinder
GGCGAGCGCCAGGAGCGCAGCTTCG	AGCGCCGTGATGATCGCGGCAGCTTTGGCGGCGACCGTGGCGGCTTCCGTGGT
GGCGAGCGTCAGGAGCGCAGCTTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044131.1\|WP_158389985.1\|929982_931179_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273385
NZ_CP044131.1\|WP_158389965.1\|917742_918729_-\|ribosome-small-subunit-dependent-GTPase-A	unknown	unknown	gnl\|CDD\|234631
NZ_CP044131.1\|WP_158389981.1\|927723_928344_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379522
NZ_CP044131.1\|WP_158389969.1\|919098_920400_-\|M48-family-metalloprotease	unknown	unknown	gnl\|CDD\|320702
NZ_CP044131.1\|WP_158389991.1\|935518_936616_+\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176245
NZ_CP044131.1\|WP_158389955.1\|913887_914457_+\|ribosome-maturation-factor-RimM	unknown	unknown	gnl\|CDD\|234650
NZ_CP044131.1\|WP_158389953.1\|913526_913781_+\|30S-ribosomal-protein-S16	unknown	unknown	gnl\|CDD\|234588
NZ_CP044131.1\|WP_158389987.1\|931186_932755_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP044131.1\|WP_158389963.1\|916676_917663_+\|CobD/CbiB-family-protein	unknown	unknown	gnl\|CDD\|236068
NZ_CP044131.1\|WP_158389957.1\|914508_915288_+\|tRNA-(guanosine(37)-N1)-methyltransferase-TrmD	unknown	unknown	gnl\|CDD\|234581
NZ_CP044131.1\|WP_158389983.1\|928450_929950_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP044131.1\|WP_158389975.1\|923535_924768_-\|Bcr/CflA-family-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NZ_CP044131.1\|WP_158389971.1\|920430_921039_+\|oligoribonuclease	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235429
NZ_CP044131.1\|WP_158389989.1\|932920_935398_+\|UvrD-helicase-domain-containing-protein	unknown	unknown	gnl\|CDD\|236976
NZ_CP044131.1\|WP_158389961.1\|915930_916629_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
NZ_CP044131.1\|WP_158389967.1\|918734_919079_-\|4a-hydroxytetrahydrobiopterin-dehydratase	unknown	unknown	gnl\|CDD\|234845
NZ_CP044131.1\|WP_158389977.1\|925469_926348_-\|NAD-binding-protein	unknown	unknown	gnl\|CDD\|224995
NZ_CP044131.1\|WP_158389979.1\|926531_927509_-\|GMP-reductase	unknown	unknown	gnl\|CDD\|235479
NZ_CP044131.1\|WP_158389993.1\|936790_938869_+\|DUF839-domain-containing-protein	unknown	unknown	gnl\|CDD\|225752
NZ_CP044131.1\|WP_158389959.1\|915427_915820_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418

Protein	Function_ID	Function_description	E-value
NZ_CP044131.1\|WP_158389985.1\|929982_931179_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273385	TIGR00998, Probable_multidrug_resistance_protein_EmrK, efflux pump membrane protein (multidrug resistance protein A). [Transport and binding proteins, Other].	4.50668e-103
NZ_CP044131.1\|WP_158389965.1\|917742_918729_-\|ribosome-small-subunit-dependent-GTPase-A	gnl\|CDD\|234631	PRK00098, PRK00098, GTPase RsgA; Reviewed.	5.12644e-112
NZ_CP044131.1\|WP_158389981.1\|927723_928344_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|379522	pfam14246, TetR_C_7, AefR-like transcriptional repressor, C-terminal region. This family comprises the C-terminal domain of transcriptional regulators of the TetR family. It includes the AefR transcriptional regulator from P. syringae. It is found in association with pfam00440.	3.39324e-25
NZ_CP044131.1\|WP_158389969.1\|919098_920400_-\|M48-family-metalloprotease	gnl\|CDD\|320702	cd07343, M48A_Zmpste24p_like, Peptidase M48 subfamily A, a type 1 CaaX endopeptidase. This family contains peptidase family M48 subfamily A which includes a number of well-characterized genes such as those found in humans (ZMPSTE24, also known as farnesylated protein-converting enzyme 1 or FACE-1 or Hs Ste24), Taenia solium metacestode (TsSte24p), Arabidopsis (AtSte24) and yeast (Ste24p). Ste24p contains the zinc metalloprotease motif (HEXXH), likely exposed on the cytoplasmic side. It is thought to be intimately associated with the endoplasmic reticulum (ER), regardless of whether its genes possess the conventional signal motif (KKXX) in the C-terminal. Proteins in this family proteolytically remove the C-terminal three residues of farnesylated proteins. Ste24p is involved in the post-translational processing of prelamin A to mature lamin A, a major component of the nuclear envelope. ZmpSte24 deficiency causes an accumulation of prelamin A leading to lipodystrophy and other disease phenotypes, while mutations in this gene or in that encoding its substrate, prelamin A, result in a series of human inherited diseases known as laminopathies, the most severe of which are Hutchinson Gilford progeria syndrome (HGPS) and restrictive dermopathy (RD) which arise due to unsuccessful maturation of prelamin A. Two forms of mandibuloacral dysplasia, a condition that causes a variety of abnormalities involving bone development, skin pigmentation, and fat distribution, are caused by mutations in two different genes; mutations in the LMNA gene, which normally provides instructions for making lamin A and lamin C, cause mandibuloacral dysplasia with A-type lipodystrophy (MAD-A), and mutations in the ZMPSTE24 gene cause mandibuloacral dysplasia with B-type lipodystrophy (MAD-B). Within cells, these genes are involved in maintaining the structure of the nucleus and may play a role in many cellular processes. Certain HIV protease inhibitors have been shown to inhibit the enzymatic activity of ZMPSTE24, but not enzymes involved in prelamin A processing.	0
NZ_CP044131.1\|WP_158389991.1\|935518_936616_+\|zinc-binding-dehydrogenase	gnl\|CDD\|176245	cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases. This group is predominated by atypical alcohol dehydrogenases; they exist as tetramers and exhibit specificity for NADP(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like other zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric ADHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains; however, they do not have and a structural zinc in a lobe of the catalytic domain. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.	0
NZ_CP044131.1\|WP_158389955.1\|913887_914457_+\|ribosome-maturation-factor-RimM	gnl\|CDD\|234650	PRK00122, rimM, 16S rRNA-processing protein RimM; Provisional.	1.01815e-71
NZ_CP044131.1\|WP_158389953.1\|913526_913781_+\|30S-ribosomal-protein-S16	gnl\|CDD\|234588	PRK00040, rpsP, 30S ribosomal protein S16; Reviewed.	3.79333e-39
NZ_CP044131.1\|WP_158389987.1\|931186_932755_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.01849e-131
NZ_CP044131.1\|WP_158389963.1\|916676_917663_+\|CobD/CbiB-family-protein	gnl\|CDD\|236068	PRK07630, PRK07630, CobD/CbiB family protein; Provisional.	7.90497e-112
NZ_CP044131.1\|WP_158389957.1\|914508_915288_+\|tRNA-(guanosine(37)-N1)-methyltransferase-TrmD	gnl\|CDD\|234581	PRK00026, trmD, tRNA (guanine-N(1)-)-methyltransferase; Reviewed.	3.17983e-138
NZ_CP044131.1\|WP_158389983.1\|928450_929950_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	3.91548e-99
NZ_CP044131.1\|WP_158389975.1\|923535_924768_-\|Bcr/CflA-family-efflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.8512e-94
NZ_CP044131.1\|WP_158389971.1\|920430_921039_+\|oligoribonuclease	gnl\|CDD\|235429	PRK05359, PRK05359, oligoribonuclease; Provisional.	6.8191e-123
NZ_CP044131.1\|WP_158389989.1\|932920_935398_+\|UvrD-helicase-domain-containing-protein	gnl\|CDD\|236976	PRK11773, uvrD, DNA-dependent helicase II; Provisional.	0
NZ_CP044131.1\|WP_158389961.1\|915930_916629_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	2.34305e-67
NZ_CP044131.1\|WP_158389967.1\|918734_919079_-\|4a-hydroxytetrahydrobiopterin-dehydratase	gnl\|CDD\|234845	PRK00823, phhB, pterin-4-alpha-carbinolamine dehydratase; Validated.	2.79591e-40
NZ_CP044131.1\|WP_158389977.1\|925469_926348_-\|NAD-binding-protein	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	9.24024e-98
NZ_CP044131.1\|WP_158389979.1\|926531_927509_-\|GMP-reductase	gnl\|CDD\|235479	PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional.	0
NZ_CP044131.1\|WP_158389993.1\|936790_938869_+\|DUF839-domain-containing-protein	gnl\|CDD\|225752	COG3211, PhoX, Predicted phosphatase [General function prediction only].	9.98028e-161
NZ_CP044131.1\|WP_158389959.1\|915427_915820_+\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	9.10862e-68

>NZ_CP044131.1|WP_158389971.1|920430_921039_+|oligoribonuclease
MSEASCMNSVAAVPVADTVPALSKSDLNMVWLDCEMTGLNPNHDRIIEIAVVVSSSDLQTRVEGPVFAIHQSDELLNGMDNWNKGTHGRSGLIDKVKASAITEAEAEAALIAFLSKYVPKGKTPLCGNSIGQDRRFMERYMPKLNSFFHYRNIDVSTLKELAKRWKPEAYTSFKKAQRHTALADVHESIDELQHYRRQLLSV
>NZ_CP044131.1|WP_158389969.1|919098_920400_-|M48-family-metalloprotease
MASNLDFSLTLSLLFAAAVLLQWLLRIWLVSRQVRHVARHRATVPEAFSNRISLAAHQKAADYTLAKAKLSLIDITLSAAVLLCWTLLGGLDRLNHGLLELMGPGLGQQLALLASFAVISTLIEMPLSLYQTFRLEQRFGFNQMTLGLWLGDLCKSTLVGAIIGLPLAALILWVMGSTGSLWWLWAWGTWTVFNLLLMWIFPSFIAPLFNKFEPLADESLKSRVTQLMERCGFAAKGLFVMDGSRRSAHANAYFTGFGNSKRVVFFDTLLKQLNPGEVEAVLAHELGHFKHKHITKRMVMMFGVSLLGFALLGWLSQQPWFYSGLGVDILQSKYLGVPAENNALALLLFMLAVPVFSFFITPLMSAMSRRDEFEADAYAMQQADGAQLASALLKLYEDNASTLTPDPWYVSFYYSHPPAVDRLARMPAPSGSL
>NZ_CP044131.1|WP_158389967.1|918734_919079_-|4a-hydroxytetrahydrobiopterin-dehydratase
MSTSTLQQKDWSEQKRSALSLEKAQEQLTTLSGWELAGSATNPVIRKTYRFANFYETMAFVNAVALIAHQQDHHPDLEVGYNRCQISLNTHDVGGISETDIDCARRIEALLKLA
>NZ_CP044131.1|WP_158389965.1|917742_918729_-|ribosome-small-subunit-dependent-GTPase-A
MGKQGRRPGAQQASGDMQTGLVVASYGRHCVVETKDGERRICHPRGKKSQAVVGDHVQWLAPPPGQGDEGTIEKVLERRNVFYRQDDIRTKTFAANLDQLLILIAAEPVFSEVQLARALIAAEAAHITPIIALNKMDLEEPFLRAWERLAPYRSMRDAVDDPPHYMVLPLSLEDADEEDRDAIIGLLQGKTTLVLGPSGVGKSTLINLLLPNAKVATNEISQALNTGKHTTTSTTLYWVDDERTTAIIDSPGFQEFGIYHIAPTQLPACMPDIGAHAKDCKFYNCTHLHEPGCGVIDAVKNGSDTLPISDNRYRIYSELFDELSQVGY
>NZ_CP044131.1|WP_158389963.1|916676_917663_+|CobD/CbiB-family-protein
MSFFAILIALLLEQARPLARSNLVQAGYRAWTVTVRRNFDAGKPHHGWLAWAMAVLLPSLIVLGIFWGLLTLIGWPAAMLWNVAVLYVTLGFRQFSHHFTRIRDALDAGDEFAARQALADWQQVDASEVPRSEVVRHVIEYSVLAAHRHVFGVLFWFSVLSAVGLGPLGAILYRMAEYLSRAWSRKGVEGLQAPTSERLQVAAARAWYAIDWLPARLTALAFAMVGSFEEAIDNWRVYAQRFPNDNDGVILSATAGAINVRLGGEALRRRDASYAEEGEEAQWDVGSDVTPGREPEMAHLRSVVGLVWRSVIVWLLLLALLTFARLLG
>NZ_CP044131.1|WP_158389961.1|915930_916629_+|CoA-pyrophosphatase
MSASDHSSSPSVGIVDPRSARLLSVDGDLPAVPLTEQTPQALRTRFARPPSWLPEVMQEKRMTARPPLDAAVLVPIVLREQPTVLLTVRSAKLSSHSGQVAFPGGKRDPLDVSAEATALREAHEEVGLAPQNVEVLGRLPIYVTGTAFHVTPVVALVRPQPSYFPNPGEVADLFEVPLSYLLNPAHHERRVMQWQGIDREWFAMPYQDGEQQRYIWGATAGMLRNLYRFLSA
>NZ_CP044131.1|WP_158389959.1|915427_915820_+|50S-ribosomal-protein-L19
MNLIQTLEQEEIARLNKTIPEFAPGDTVIVSVNVVEGSRKRVQAYEGVVIAKRNRGLNSGFTVRKISSGEGVERTFQTYSPLIAKIEVKRRGDVRRAKLYYLRERSGKSARIKEKLPQRVNKTAAAAVAE
>NZ_CP044131.1|WP_158389957.1|914508_915288_+|tRNA-(guanosine(37)-N1)-methyltransferase-TrmD
MRFDIITLFPELFAPFLEVGVTRRAYSSGQVDVHLWNPRDWAEGNYRRVDDRPFGGGPGMVMMAEPLQHCLEAIRAARIEADEKEQVEPAPLILFSPIGTTLKHAVVAEWAESSGAILLCGRYEGIDQRFIDTHVTHQLSLGDFVLSGGELAAMVLLDSLARLQPGVLNDEGSFQQDSFNPALDGLLDCPHYTRPEVWNGQEVPSELLSGHHANIDRWRRDQRLRITQQHRPELLDQARQQGLLNAKDEGFLAKTGTRL
>NZ_CP044131.1|WP_158389955.1|913887_914457_+|ribosome-maturation-factor-RimM
MSYMPPLQTTSLPADAVEVGRIADAWGIKGWFKVYAFSSAPEALFAAKSWFLQPAEKGAKQFSGTVELPVKQARFHADTIVATSPEVADRNAAEALKGARIFVAREHFPKTEDGEFYWVDLMGLNVLNREGVELGAVKDLMSTGPQTVLVLGYEQEGKEQERLIPFVDAYVDSVDLPGKKIVVDWQPDY
>NZ_CP044131.1|WP_158389953.1|913526_913781_+|30S-ribosomal-protein-S16
MVVIRLSRGGSKARPFYNIVAADKRVRRDGSFIERLGFYNPNARGAEEGLRLALDRVNYWKSVGAQASETAERLIKEASKKVAA
>NZ_CP044131.1|WP_158389975.1|923535_924768_-|Bcr/CflA-family-efflux-MFS-transporter
MQNDLSTFWRGPRWTLAMLLAILGMLGPFSVDTYIPAFSGIAKALGATPVEMQQTLSAYLLGFAFMNLFHGALADSFGRRPVILWGLVMFTIASAGCALSQNITQLVIFRTLQGLSTGAGIVVSRAIVRDIFPPAQAQGLMAQITIFFGVAPALAPIMGGWLFVHLGWQAVFWFLTIVGVLLWAINIKFLPESLPPQKRQPFQFKPLMQGYGLLLSDPRFLLLALASGIPFNGMFLYLLSAPEFLGTILQLEPTQFFWFFIATIGGIMAGSWTSGRLAGRIPPKRQIRHGFLVMCVTSIINLVANLIWPAHVSWALIPISLFAYGWALMVPVVTLLVLDIHPERRGLASSLQAVVGSTANGFVAGIIAPLVMHSAALLATGSILLMTIGLIAWIYLHHRWPEIGRHASEH
>NZ_CP044131.1|WP_158389977.1|925469_926348_-|NAD-binding-protein
MSTLKIAVLGTGMMGLPMARRLAQAGHEVHAWNRTRAKAEPLAADGVTIHDNAADAVRSVDFAVSLLESGAIVGEVLFNLGVAEALPKGSLFIDMASIQPREAREHATKLQALGVQHLDAPVSGGTLGAEAGTLAIMVGGEAADFERAQPVFAALGRSTHVGPHGAGQLAKLANQMIVGITIGAVAEALLLAERGGADPAKVREAISGGFADSRILQVHGERMVNHDFAPRGRMTVQLKDMRNAMATADEIGFSAPITDLLEELYAEGVKNGLGDLDQAGLFVELQRRNALD
>NZ_CP044131.1|WP_158389979.1|926531_927509_-|GMP-reductase
MEIFDYDNILLLPRMCRVESRSECDTSVQLGNRSFKLPVVPANMKTVVDEKICTYLAQNGFFYVMHRFDIDNVAFTKDMQSKGLFASISLGVKQPDYDIVDRFVADGICPEYITIDIAHGHAESVKNMIAYLKAKIPAAFVIAGNVATPEAVIDLENWGADATKVGVGPGKVCITKLKTGFGTGGWQLSALKWCARVATKPIIADGGIRSHGDIAKSIRFGATMIMIGSLFAGHEESPGKTVEVDGQLFKEYYGSASDFNKGEYKHVEGKRILEPIKGPLMNTLVEMQQDVQSSISYSGGTKLMDIRKVNYVILGGDNAGEHLLM
>NZ_CP044131.1|WP_158389981.1|927723_928344_-|TetR-family-transcriptional-regulator
MRTKTEEKRQAIIDVAAATFGELGFERTSMSEICARLGGSKATLYNYFPSKEALLLEVMFQASEADFQNTMLALQTSQKDAYQALCDFGERFLSLLYSPDVMSVRRLLIAEGGRSQIGQRCWEMGPARGNAAIQSFLQQGIQRKLLRSADPELMQHQLLALLEAELLPRFMFQHLPSPDAQEITQCAERAIHTFMQLYGMQPSSSS
>NZ_CP044131.1|WP_158389983.1|928450_929950_+|efflux-transporter-outer-membrane-subunit
MTSRIAAAQQEGSRWRTGWLALGLPAMLAACAQVPDWEGKATLSQPMPASLQATHNASHNIPYMDWPQQRWWQRYGDAQLNELIDQALQGAPDMAAAAARVQQAKAMLGVSESASAPQVSARVSATEDKLSYNHLTPEAFMPRGMNDYGRATLDLSWSLDFWGKQRAAVAAAAGELAAREADAAQARLLLSSNVAMAYAQLLRLAANEQTLQQSLKVRQATAELFAQRYANGLENKGGVHSANARLAAARAELAQMQEQVGLQRNSIAALMGASPDRGASIQVDAERLQAPWQQQWALPDQIPANLLGRRPDVVAARLQAQALESRVASKQAEFYPDVNLSAFVGVQSLGLDMLTKSGSSIASIGPAISLPIFNGGRLRSELGAARARYDEVVAQYRSTLNRALQEVADNATSQRALQQQLDAMQQAVNAAAEAHRVARNRYEGGLARYLDVLSAEDQLLASVRQLVDVQSRALTLDIGLHRALGGGWREAEIKTPGQA
>NZ_CP044131.1|WP_158389985.1|929982_931179_+|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MTENASSVSANPAVREQRRNKLLVALAGVVVLGGAVAGAYWWLHASNFVSTDNAYAAVEVAQVTPSIGGTVLEVIVKDTQSVKKGDVLVRIDPTDAKLALAQAEAELARATRRVKGYVANDGGLKAQVSAREADEKRAAAQLLAAQADMERATIDLKRREALAKSGSVSGEELTQAQNAFAAARAQLASAVAAQAQAKANREAAVGAKQVNATLIEGADADTNPEVLLAMARRDQAQVDLDRTTVLAPVDGVVAKRSVQIGQRVQAGAALMAVVPVQQMYVDANFKEGQLGKVRVGQQVELQSDLYGSDVKYKGQVVGFSGGSGSAFAAIPAQNATGNWIKVVQRLPVRIQLDAAQLAQHPLRVGLSMNVTVDTRTGPAKGESEGVAEAQDQTPTTAQ
>NZ_CP044131.1|WP_158389987.1|931186_932755_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MSELKASADAPAVPMAPGMVPLTGGALWLAALVLAAANFMAVLDMTVANVSVPSIAGNLGATTSQGTWVITSYAVAEAITVPLTGWLASRFGAVRVFATAMGLFGLASMLCGLANSLGMLVFARILQGLAGGPLMPLSQSLLLRIFPPRMAPAAIGLWSMTTLIAPVLGPIVGGWICDEYTWHWIFLINIPVALVCAFAVWHLVKRYEQPLLKNPIDTVGLILLIVWVGSLQLMLDEGKNLDWFASPMIVALAVVAVVGFAAFMIWELHAEHPIVDLRVFRHRGFSMAVLTISLAFAAFFAVNVLTPLWLQSFMGYTATLAGLVTAWTGLFALFVAPAAAGLSAKVDPRKLIFGGVFWMGVITFWRAFANTDMGYWDIALPLMFMGFGLPFFFIPTTGLALASVEPHEMDNAAGLMNFLRTLSGAAAVSIVNTAWENGSTRNHAELVGLSDPGGEVLQGMQQSGMSPDAALSALDHLITSQSVMLATNQIMFIIAGGFVLAACAIWLAPKPTRVVELGAGGH
>NZ_CP044131.1|WP_158389989.1|932920_935398_+|UvrD-helicase-domain-containing-protein
MFPIDLLDSAPEGARSASQSPLLTGLNDEQLAAVTLPAGHALILAGAGSGKTRVLTTRIAWLLQTGQATPGSIMAVTFTNKAAKEMLARLSAMLPYNVRGMWIGTFHGLCNRMLRAHYQAAKLPQAFQILDTQDQLSAIKRLCKQFNVDDERFPPKQLMYFIAGCKEEGMRPGDVVATDPDTRKKVELYQLYEEQCQREGVVDFGELMLRSFELLRDDVHLRQHYQRRFQHILVDEFQDTNKLQYQWLKQLAGEADGSRFVSQSSVIAVGDDDQSIYAFRGARVGNMADFIREFEVKNQIKLEQNYRSYSNILDCANALISHNSNRLGKNLRTTQGPGEPVRIYESPSDLAEAAWMVDEIKQLVKNDGFTRQEIAVLYRSNAQSRVIESALFNSKIPYRVYGGLRFFERAEIKHALAYLRLLENPHDDTSFMRVVNFPARGIGARTIEQLQDAARSSGCSLSDAVTAVPGAAGTKLQGFVAQIDVLREQTQGRTLREIIETVEEQSGLLEHYRNEKEGADRIENLQELVTAAESFVTQEGFGKDAVALPVDAQEILPGANLSQSPASQGLDPNAALLDQPLTPPAGTLASMVNEDTGETMSPLAAFLSHASLEAGDNQAQAGQDAVQLMTVHASKGLEFDAVFIGGVEEGLFPHENAMMDRGGLEEERRLAYVAITRARKRLYLSHSQTRMLHGQTRYNVKSRFFDELPEEALKWITPKQSGFGTFAPNSGAGGAWGTRGLGQFGSNSGWGSKQTEIFASPVVPKQKAEPSHGIKAGITVFHNKFGEGKVLAVEGTGDDARAQVSFGRHGTKWLALAIAKLTVVE
>NZ_CP044131.1|WP_158389991.1|935518_936616_+|zinc-binding-dehydrogenase
MSKTMKAAAFIEKGRIEIVEKPIPDVGPNDALIRITTTTICGTDVHILKGEYPVEKGLTVGHEPVGVIEKLGSAVRGYTEGQRVIAGAICPNFNSYAAQDGYPSQDGSYLGSRGLCGCHGYKATAGWRFGNLIDGTQAEYLLVPDAQANLEPIPDGLSDEQVLMCPDIMSTGFKGAENANIKIGDTVVVLAQGPIGLCATAGARLLGATTIIAVDGNDHRLEIARKMGADVTLNFRNVDVVEEVMKLTKGRGADSSIEALGTQATFAQAMKVLKPGGTLSSLGVYSEDLSIPLAQFAAGLGDHTIRTALCPGGKERMRRLMNVIEANRLDLGVMVTHQRKLDDIVQAYDLFANQRDGVLKIAIKP
>NZ_CP044131.1|WP_158389993.1|936790_938869_+|DUF839-domain-containing-protein
MSKTISDKVVRNHAGNAPFSAILEANLSRRTLTRGGLSAALAVFSGSMLAACGGSDDNSVDPGPGPNPKPDPEPKLKLGFESLPTSMTDACVVPAGYVAHVLGAWGTPLNDKAADWKNDGSNTSEDLLNSTGMHHDGMHYFPLEGSSTEGLLVVNHEYIDEKNLHPNGQTGTGAGEKRPAEEVRKEINAHGVAVMHIKKSGSGWEIVKNSKYNRRFTSATPMNLSGPVAKTDWVKTAFSKDGSQIRGTNNNCGNGTTPWGTYITAEENWAACFLNTGANLPESQKRVGIATKAGRYLWETAAGDATEKDGEFARFNITETGATALDDYRNEVNGFGYLVEIDPYDPSSVATKRTAMGRFAHEGAAYSLPEAGKPLAFYTGDDSRFEYIYRYVSDAVWDAADAKRSDRLAVGNKYLDKGTLFVARFNEDGTGDWLPLTLDSVGKDGSKLGSKYKSIEEILINTRGAADFVGATPMDRPEWTAVNPTNGDVYLTLTNNTSRNASTGTNAANPRLNNVNGHIIRWHDDAGKNSFKWEIFVFGSNAGADADTNRSGLTALNQLASPDGIAFDDRGILWVQTDNGIDGGRKNDVAKATNDQMLAVIPGALADSKATGPVINASNQGELRRFFVGPNEAEITGFAYTPDYSTIFLNVQHPVNWPAYGTSDATALPSGTVRPRSSTVVIQKKDGGPVVV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044131_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044131_2

3282248-3282331

Orphan

Consensus_repeat	Method
GCCCTAGAGTATTTCTACTCTAGGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044131_2

>merge|NZ_CP044131|2|3282248-3282331|CRISPRCasFinder
GCCCTAGAGTATTTCTACTCTAGGGCCTTTTTTCTTGATCGGGGACTGAAATACAAAAGCCCTAGAGCATTTCTACTCTAGGGC

>NZ_CP044131|2|2|3282248-3282331|CRISPRCasFinder
GCCCTAGAGTATTTCTACTCTAGGGC	CTTTTTTCTTGATCGGGGACTGAAATACAAAA
GCCCTAGAGCATTTCTACTCTAGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044131.1\|WP_158393126.1\|3272263_3272656_-\|SnoaL-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP044131.1\|WP_158393136.1\|3278336_3280148_+\|sulfoacetaldehyde-acetyltransferase	unknown	unknown	gnl\|CDD\|236042
NZ_CP044131.1\|WP_158393144.1\|3284049_3285039_-\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	unknown	unknown	gnl\|CDD\|234893
NZ_CP044131.1\|WP_161598770.1\|3287158_3288016_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371915
NZ_CP044131.1\|WP_158393124.1\|3271095_3272091_-\|DctP-family-TRAP-transporter-solute-binding-subunit	unknown	unknown	gnl\|CDD\|270321
NZ_CP044131.1\|WP_158393148.1\|3285626_3286319_+\|DNA-repair-protein-RadC	unknown	unknown	gnl\|CDD\|178801
NZ_CP044131.1\|WP_158393134.1\|3277375_3278200_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224332
NZ_CP044131.1\|WP_158393146.1\|3285040_3285523_-\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|223976
NZ_CP044131.1\|WP_158393158.1\|3289699_3290008_-\|monooxygenase	unknown	unknown	gnl\|CDD\|182975
NZ_CP044131.1\|WP_158393142.1\|3282549_3283866_-\|serine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235461
NZ_CP044131.1\|WP_158393138.1\|3280214_3281186_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	unknown	unknown	gnl\|CDD\|236180
NZ_CP044131.1\|WP_158393154.1\|3288012_3289041_-\|M48-family-metalloprotease	unknown	unknown	gnl\|CDD\|320699
NZ_CP044131.1\|WP_158393128.1\|3272999_3274421_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP044131.1\|WP_158393130.1\|3274678_3276376_-\|cobalt-chelatase	unknown	unknown	gnl\|CDD\|130712
NZ_CP044131.1\|WP_158393122.1\|3270373_3270922_-\|TRAP-transporter-small-permease-subunit	unknown	unknown	gnl\|CDD\|225632
NZ_CP044131.1\|WP_158393132.1\|3276378_3277383_-\|AAA-domain-containing-protein	unknown	unknown	gnl\|CDD\|130711
NZ_CP044131.1\|WP_158393140.1\|3281182_3282226_+\|putative-sulfate-exporter-family-transporter	unknown	unknown	gnl\|CDD\|225411
NZ_CP044131.1\|WP_158393156.1\|3289044_3289632_-\|LemA-family-protein	unknown	unknown	gnl\|CDD\|377192
NZ_CP044131.1\|WP_158393160.1\|3290045_3290450_-\|group-II-truncated-hemoglobin	unknown	unknown	gnl\|CDD\|381282
NZ_CP044131.1\|WP_158393150.1\|3286315_3286972_+\|DNA-mismatch-repair-protein-MutS	unknown	unknown	gnl\|CDD\|225396

Protein	Function_ID	Function_description	E-value
NZ_CP044131.1\|WP_158393126.1\|3272263_3272656_-\|SnoaL-like-domain-containing-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	9.99677e-20
NZ_CP044131.1\|WP_158393136.1\|3278336_3280148_+\|sulfoacetaldehyde-acetyltransferase	gnl\|CDD\|236042	PRK07525, PRK07525, sulfoacetaldehyde acetyltransferase; Validated.	0
NZ_CP044131.1\|WP_158393144.1\|3284049_3285039_-\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	gnl\|CDD\|234893	PRK01045, ispH, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed.	0
NZ_CP044131.1\|WP_161598770.1\|3287158_3288016_+\|hypothetical-protein	gnl\|CDD\|371915	pfam12138, Spherulin4, Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.	4.39482e-48
NZ_CP044131.1\|WP_158393124.1\|3271095_3272091_-\|DctP-family-TRAP-transporter-solute-binding-subunit	gnl\|CDD\|270321	cd13603, PBP2_TRAP_Siap_TeaA_like, Substrate-binding domain of a sialic acid binding Tripartite ATP-independent Periplasmic transport system (SiaP) and related proteins; the type 2 periplasmic-binding protein fold. This subfamily includes the periplasmic-binding component of TRAP transport systems such as SiaP (a sialic acid binding virulence factor), TeaA (an ectoine binding protein), and an uncharacterized TM0322 from hyperthermophilic bacterium Thermotoga maritima. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process and a smaller membrane of unknown function. The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.01596e-116
NZ_CP044131.1\|WP_158393148.1\|3285626_3286319_+\|DNA-repair-protein-RadC	gnl\|CDD\|178801	PRK00024, PRK00024, DNA repair protein RadC.	1.61934e-115
NZ_CP044131.1\|WP_158393134.1\|3277375_3278200_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	2.95942e-57
NZ_CP044131.1\|WP_158393146.1\|3285040_3285523_-\|peptidylprolyl-isomerase	gnl\|CDD\|223976	COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones].	3.16386e-29
NZ_CP044131.1\|WP_158393158.1\|3289699_3290008_-\|monooxygenase	gnl\|CDD\|182975	PRK11118, PRK11118, putative monooxygenase; Provisional.	6.12892e-57
NZ_CP044131.1\|WP_158393142.1\|3282549_3283866_-\|serine--tRNA-ligase	gnl\|CDD\|235461	PRK05431, PRK05431, seryl-tRNA synthetase; Provisional.	0
NZ_CP044131.1\|WP_158393138.1\|3280214_3281186_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	gnl\|CDD\|236180	PRK08190, PRK08190, bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated.	4.04553e-161
NZ_CP044131.1\|WP_158393154.1\|3288012_3289041_-\|M48-family-metalloprotease	gnl\|CDD\|320699	cd07340, M48B_Htpx_like, Peptidase M48 subfamily B HtpX-like membrane-bound metallopeptidase. This HtpX family of peptidase M48 subfamily B includes uncharacterized HtpX homologs and consists of proteins smaller than Ste24p, with homology restricted to the C-terminal half of Ste24p. HtpX expression is controlled by the Cpx stress response system, which senses abnormal membrane proteins. HtpX participates in the proteolytic quality control of these misfolded proteins by undergoing self-degradation and collaborating with FtsH, a membrane-bound and ATP-dependent protease, to eliminate them. HtpX, a zinc metalloprotease with an active site motif HEXXH, has an FtsH-like topology, and is capable of introducing endoproteolytic cleavages into SecY (also an FtsH substrate). However, HtpX does not have an ATPase activity and will only act against cytoplasmic regions of a target membrane protein. Thus, HtpX and FtsH have overlapping and/or complementary functions, which are especially important at high temperature; in E. coli and Xylella fastidiosa, HtpX is heat-inducible, while in Streptococcus gordonii it is not.	1.65533e-64
NZ_CP044131.1\|WP_158393128.1\|3272999_3274421_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	2.93666e-55
NZ_CP044131.1\|WP_158393130.1\|3274678_3276376_-\|cobalt-chelatase	gnl\|CDD\|130712	TIGR01651, CobT, cobaltochelatase, CobT subunit. This model describes Pseudomonas denitrificans CobT gene product, which is a cobalt chelatase subunit that functions in cobalamin biosynthesis. Cobalamin (vitamin B12) can be synthesized via several pathways, including an aerobic pathway (found in Pseudomonas denitrificans) and an anaerobic pathway (found in P. shermanii and Salmonella typhimurium). These pathways differ in the point of cobalt insertion during corrin ring formation. There are apparently a number of variations on these two pathways, where the major differences seem to be concerned with the process of ring contraction. Confusion regarding the functions of enzymes found in the aerobic vs. anaerobic pathways has arisen because nonhomologous genes in these different pathways were given the same gene symbols. Thus, cobT in the aerobic pathway (P. denitrificans) is not a homolog of cobT in the anaerobic pathway (S. typhimurium). It should be noted that E. coli synthesizes cobalamin only when it is supplied with the precursor cobinamide, which is a complex intermediate. Additionally, all E. coli cobalamin synthesis genes (cobU, cobS and cobT) were named after their Salmonella typhimurium homologs which function in the anaerobic cobalamin synthesis pathway. This model describes the aerobic cobalamin pathway Pseudomonas denitrificans CobT gene product, which is a cobalt chelatase subunit, with a MW ~70 kDa. The aerobic pathway cobalt chelatase is a heterotrimeric, ATP-dependent enzyme that catalyzes cobalt insertion during cobalamin biosynthesis. The other two subunits are the P. denitrificans CobS (TIGR01650) and CobN (pfam02514 CobN/Magnesium Chelatase) proteins. To avoid potential confusion with the nonhomologous Salmonella typhimurium/E.coli cobT gene product, the P. denitrificans gene symbol is not used in the name of this model. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin].	1.29343e-79
NZ_CP044131.1\|WP_158393122.1\|3270373_3270922_-\|TRAP-transporter-small-permease-subunit	gnl\|CDD\|225632	COG3090, DctM, TRAP-type C4-dicarboxylate transport system, small permease component [Carbohydrate transport and metabolism].	1.77058e-29
NZ_CP044131.1\|WP_158393132.1\|3276378_3277383_-\|AAA-domain-containing-protein	gnl\|CDD\|130711	TIGR01650, PD_CobS, cobaltochelatase, CobS subunit. This model describes Pseudomonas denitrificans CobS gene product, which is a cobalt chelatase subunit that functions in cobalamin biosynthesis. Cobalamin (vitamin B12) can be synthesized via several pathways, including an aerobic pathway (found in Pseudomonas denitrificans) and an anaerobic pathway (found in P. shermanii and Salmonella typhimurium). These pathways differ in the point of cobalt insertion during corrin ring formation. There are apparently a number of variations on these two pathways, where the major differences seem to be concerned with the process of ring contraction. Confusion regarding the functions of enzymes found in the aerobic vs. anaerobic pathways has arisen because nonhomologous genes in these different pathways were given the same gene symbols. Thus, cobS in the aerobic pathway (P. denitrificans) is not a homolog of cobS in the anaerobic pathway (S. typhimurium). It should be noted that E. coli synthesizes cobalamin only when it is supplied with the precursor cobinamide, which is a complex intermediate. Additionally, all E. coli cobalamin synthesis genes (cobU, cobS and cobT) were named after their Salmonella typhimurium homologs which function in the anaerobic cobalamin synthesis pathway. This model describes the aerobic cobalamin pathway Pseudomonas denitrificans CobS gene product, which is a cobalt chelatase subunit, with a MW ~37 kDa. The aerobic pathway cobalt chelatase is a heterotrimeric, ATP-dependent enzyme that catalyzes cobalt insertion during cobalamin biosynthesis. The other two subunits are the P. denitrificans CobT (TIGR01651) and CobN (pfam02514 CobN/Magnesium Chelatase) proteins. To avoid potential confusion with the nonhomologous Salmonella typhimurium/E.coli cobS gene product, the P. denitrificans gene symbol is not used in the name of this model. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin].	3.06311e-166
NZ_CP044131.1\|WP_158393140.1\|3281182_3282226_+\|putative-sulfate-exporter-family-transporter	gnl\|CDD\|225411	COG2855, COG2855, Predicted membrane protein [Function unknown].	5.38572e-72
NZ_CP044131.1\|WP_158393156.1\|3289044_3289632_-\|LemA-family-protein	gnl\|CDD\|377192	pfam04011, LemA, LemA family. The members of this family are related to the LemA protein. LemA contains an amino terminal predicted transmembrane helix. It has been predicted that the small amino terminus is extracellular. The exact molecular function of this protein is uncertain.	1.6684e-62
NZ_CP044131.1\|WP_158393160.1\|3290045_3290450_-\|group-II-truncated-hemoglobin	gnl\|CDD\|381282	cd14773, TrHb2_PhHbO-like_O, Truncated hemoglobins, group 2 (O); Pseudoalteromonas haloplanktis PhHbO like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include Pseudoalteromonas haloplanktis PhHbO (encoded by the PSHAa0030 gene) which appears to be involved in oxidative and nitrosative stress resistance.	7.71941e-61
NZ_CP044131.1\|WP_158393150.1\|3286315_3286972_+\|DNA-mismatch-repair-protein-MutS	gnl\|CDD\|225396	COG2840, COG2840, Uncharacterized protein conserved in bacteria [Function unknown].	4.29703e-37

>NZ_CP044131.1|WP_158393140.1|3281182_3282226_+|putative-sulfate-exporter-family-transporter
MSPASAPLTPPTPLSKRIPSLGLLPGIALSGVIALAATFVSTLHGGPQLLYALFFGVAFHFLSQDAKTKPGIEFCARGVLRLGVGLLGARITATQIAGLGLSTALIVIAAVVTTILCGSLLGRRLGMTRPQGVLSGGAVAICGASAALAISAVLPRDKNSDRFTLMVVVTVTVLSTVAMVLYPLIARLLNLPPDMAGLFIGGSIHDVAQVVGAGYTIDQATGDYATIVKLFRISMLAVVVVVVSAIFKQQREAATEQSSGKKPPLVPWFLWVFVALVCINSLGWVPSTLQLQLTDLSKHCLVLAIAALGMKTSFTQLAQAGWRPFVLLLVETVWMAAFVLLAITLTP
>NZ_CP044131.1|WP_158393138.1|3280214_3281186_+|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase
MALVTLPDVTTAPQSATPHRPHLDRLLEKARAQGPICVAVAYPCDASALQAAVQAAEAGLIQPLLVGPRERIEAAAQAAGLDLSHTQIHHTADDARLAASQAAALCRDGQAKALMKGSLHSDDLLAAAVARDAGLRTDRRASHVFVMDVPAYNRPLLMTDCVVNIFPTLLDKRDIAQNAVNLAHSIGIAQPRVAILSAVETVNPAIPGTVDAAALCKMADRGQITGGIFDGPLAYDNAISLTSATNKGIVSEVAGNPDVLLVPSLEAGNMIYKQLVYMANAECAGLVLGMRVPIVLTSRSDSIASRIASCALAVLASKAKEQT
>NZ_CP044131.1|WP_158393136.1|3278336_3280148_+|sulfoacetaldehyde-acetyltransferase
MAATDNRKVVEGVQKMTPSEAFVETCVANGVSEMFGIMGSAFMDAMDIFAPAGIRLIPVVHEQGAAHMADGYARVSGRHGVVIGQNGPGISNCVTGIAAAFWAHSPVVIVTPETGTMGMGLGGFQEANQLPMFQEFTKYQGHVCNPKRMAEFTGRVFDRAMSEMGPTQLNIPRDYFYGEIECEIPKPMRVDRGHGGEASLQAAVDLLKTAKFPVILAGGGVVMGDAVEEAKQLAERLGAPVATGYLRNDAFPAKHPLWAGPLGYQGSKAAMKLIAQADVVIALGSRMGPFGTLPQHGMDYWPKTAKIIQVEADHTNLGLVKKISVGINGDAKAVAAELVKRLADVKLDCDATKAARADTVATEKAAWEKELDEWTHERDAYSLDMIEEAKNERTPTGGTYLHPRQVLRELEKAMPARAMVSTDIGNINSVANSYLRFDEPRSFFAPMSFGNCGYALPTIIGAKCAAPDRPAIAYAGDGAWGMSMMEIMTAVRHDIPVTAVVFHNRQWGAEKKNQVDFYNRRFVAGELESESFSDIAKAMGAEGIVVDNIEDVGPALQKAIDMQMKEGKTCVIEIMCTRELGDPFRRDALSKPVRFLEKYKDYV
>NZ_CP044131.1|WP_158393134.1|3277375_3278200_-|helix-turn-helix-domain-containing-protein
MIDQDMKHSENTGTARLDGDTPNLRLFALLETVAQKSVPFTLQNLVDELGLPKPTMHRMLAQLESAGILQRDGNGRHYSTGQRLMRLAENVLLNNTTHGARHAVLTQLVNDLGESCNITAFSGSEVLYLDRVETPAPLRFYLHPGSRVPAHCSATGKLFLSQMAPAQRRRLLANVPLEAFTANTLTSFEAVDQELDQVKAQGYAFDNEEFLPGLLCLGVLVPAPSGNSNMGLAVQAPIMRFSKEKALSFLPKLQAAAAAIARINDEIPPEADDD
>NZ_CP044131.1|WP_158393132.1|3276378_3277383_-|AAA-domain-containing-protein
MTDLNQLQPPQLVKVRDVFGIDSGMLVPAFAERTEHVPAIDTAYRLNPRVTLAILAGFAHNRRVVIQGLHGTGKSTHIEQVAARLNWPCVRVNLDGHVSRMDLVGKDTIVLKDGKQVTQFQEGILPWALQRPVAMVFDEYDAGRPDVMFVIQRVLEREGSFTMLDQKRVIQPHPHFRMFATMNTLGQGNLNGLYHGTQQLNHAQLDRWNLVTSLNYLPEDEEAAIVVARVPELASPEGLKTVQAMVALAGLTRKGFAVGDLSLLMSPRTVITWAENLSIFNDLKLAFELSFLNKCEPAERAIVTEYFQRCFAQELEPSQESSQDSALASIASLA
>NZ_CP044131.1|WP_158393130.1|3274678_3276376_-|cobalt-chelatase
MAASSKSVSLLQMEAWGGAMLRAITGDDSLQWSGQTLYQGINPVPQAAAHHIEVPALQTDQRGLLDSMGLRLQLSDASLFQAHVAKEPVERMIFELLEQLRVESLVPESWPGARDNMRQRFEHWCQAFVDSGLTESSLGILLFTVSITAWSRLTGHEIPHGMADLVEATRLSMAPELGQYWVQLRRFRGDQQQFLAPALAISRWVSAAVLAAQEDAPRGTAGARRRGNFALPLHFESQSLDDLPVAQTGDSRAWASTAQSYRVFTREFDREVHAASLVRAEQLRQFRGQMDEELASAGLQHAGRLARYLQQRLASHQPDGWNFAQEEGHLDGSRLSQLVTDPQQSAIFKQEMQRPVNQTAVTILMDCSGSMKAHAKPLSLLLDVLGRSLEMAGAAVEILGFSTQAWNGGRARRQWQRAGRPEFPGRLNERLHIVFKEGNKRWRHARQGVAALRKPDIFREGLDGEAVEWACQRLRAQTAQRCILLLISDGCPMDTATHQANDEHYLDQHLRQVLAAQERAGDIQVCALGVGLDLGVFYRRRLAIDLLEQIDESLMLEIAALLCKR
>NZ_CP044131.1|WP_158393128.1|3272999_3274421_+|FAD-dependent-oxidoreductase
MKAEDIRPSHRNPYDPQYDPLVAANPGHGAGYAPTYWVGTAGRPPEDDGPIEADTEADVVIVGSGFTGLSTALFLAREHGIRAIVLDANQTAWGCTSRNGGQGQNASGRLYRSQWIDRWGKDVALKLDAEIREGFETFKDLVAEFPECEPQPGGHLYIAHRDRKMDFLRNETRVMREVFGYDARILSTAEVRRDYVDDADCRGAMHEPDGIGVHPLKLAFAYLRKARELGVKVHPASPVIGMKTVNGVHYLQTPGGTVKARAVGFATGGYTSNGMHRSLNSKIMPILSNSLVTRPLTEEELEATSFKTTQVITDTRTLRFYYRKLPDNRVQIGSRSAITGADAPNPVHMAKLVDGLHHKFPALKGIPIDYSWWGWVDVSHDMMPRICQPDPKESVFYATGYGGNGVSFSAHAGRRMAQRIAGVQSPAFTLPIYNSELEYPNVFNMVRSQAFAPFRRMGQRFLYHWYHMNDEKQ
>NZ_CP044131.1|WP_158393126.1|3272263_3272656_-|SnoaL-like-domain-containing-protein
MTTSQPNAQFLADFAAAWNRHDIEALMSFMADECEFHAVAGPDLMGRSFVGRDAVREGFQMAWQAFPDAAWVDGVHFAHGDLGLSECTFKGTKADGQRVEARMVDVFTFRDGKIAVKNAFRKDRPPIAVG
>NZ_CP044131.1|WP_158393124.1|3271095_3272091_-|DctP-family-TRAP-transporter-solute-binding-subunit
MVNIKKTISYVACAAAVLAGGNAWSATFKVAVGDAQGGTQWELGTKFKQLFEQKTAGKHKVDLFPNGALGSEEDTVNNAAMGTLDFSILAVNNITPFSPSVGVLTLPYVIQSAEEAKKLTMGEVGKELTANTLRDARVRIVGWSYSGFRVLTNSKKPVTKVADLAGLKIRVPKNEIMIASYKAWGINPTPMAWSETFTALQQRVVDGQDNPFMTISAMQFNEVQKYITNIRYVYSLEPLIVSEAVFKKQPADVQKAILEAGAEASEHSYSWIQATEGRIRKELTAKGMQIVDPADGEKEWISKATQAVWPQFYDSIGGKAKLDQVLRTLGR
>NZ_CP044131.1|WP_158393122.1|3270373_3270922_-|TRAP-transporter-small-permease-subunit
MSFLRALLKCLNKTETVLCELLLAAFVTLLFVQIVARQVFGYSIAWSEELSTYMFVWFAYMGAVVAAKISAHNRVMFQFKYLPKALGKFMLAASDVLWIAFNLYFAYLAYDFVFNHMNRFWKSQTLGIPMKWIYLILPIAFALMALRVLINLYLTVVRGEELLDPEQKELQALNQQATTSNP
>NZ_CP044131.1|WP_158393142.1|3282549_3283866_-|serine--tRNA-ligase
MLDIQLLRKDLDSVVARLQTRKNPQAFLNVKAFKALESERKSIQTRTEELQSKRNQLSKQIGMLMGKGEKDAAEAAKAEVAAMKTELEQSATRLDQIQTELQAMLAAVPNLPHESVPVGADEEGNVEVRRFGTPKNFDFEIKDHVDLGASIGLDFESGVKLTGARFTVMQGQIARLHRALAQFMLDLQTEEHGYTECYVPYIVNSDSLKGTGQLPKFEGDLFAAQKGGQDAEPVPDTAALYLIPTAEVPLTNLVRDEVLAEDRLPIKLTAHSPCFRSEAGSGGRDTRGLIRQHQFDKVEMVQIVHPEKSYEALEEMTAHAEAVLQKLGLPYRVMSLCTGDMGFGAAKTYDLEVWVPAQNTYREISSVSNCEAFQARRMQARFKNAQGKNELVHTLNGSGLAVGRTLVAVLENYQNADGSITVPEALVSYMGGKTLLKA
>NZ_CP044131.1|WP_158393144.1|3284049_3285039_-|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase
MLGAKEVLLAEPRGFCAGVDRAIEIVERALAKFGAPIYVRHEIVHNTFVVNDLKAKGAIFIEELDDVPPGATLIFSAHGVSKAVQQEAERRGFSIFDATCPLVTKVHVEVAKLAKEGYEFLMIGHKGHPEVEGTMGQLSEGIHLVEDEDDVAKVAPRQTEKLAVVTQTTLSVDDAAGIKAAIKARFPQVREPKQQDICYATQNRQDAVKVLAPQVDVVIVVGSPTSSNSNRLRELAARLGTPAYMVDNASELKEEWFANTARVGLTAGASAPEVLVEEVIDRVKQLGAVAVRKMDGIEETIKFPLPKGLKIDAATGLEIEVRKAPETGH
>NZ_CP044131.1|WP_158393146.1|3285040_3285523_-|peptidylprolyl-isomerase
MTTSATPSAAATDLPVVQAGSFLTLHYRLAGPAGDVINTFNEKPATLSLGAGELSPAMEDKLIGLVEGTHTTFELPAGEAFGERNPDMMQWVARKLMNELGDPHEQYTAGDVVQFPTPDGLGSYAGAVVQVREDGAVLFDFNHPLASQPVTFEVKLIGVL
>NZ_CP044131.1|WP_158393148.1|3285626_3286319_+|DNA-repair-protein-RadC
MPIKDLPLDAQPREKLAQRGAAALSDAELLAIILRTGMAGKSVLQMAQELLELPGTGTGAHGLAGLLAADYKALASVKGLGPAKRAELMAVLELARRAMAQQLREREVFSSPEAVKHYVQLHLASKSHEVFGVLFLDSQNRLLALEEMFRGTLTQTSVYPREVVLRALHHQASAVILAHNHPSGSVQPSHADKALTSTLKAALALLDVRVLDHIIVGPGAACSMAEEGLL
>NZ_CP044131.1|WP_158393150.1|3286315_3286972_+|DNA-mismatch-repair-protein-MutS
MNHAHRSLQDLAGISRHLKQLREQAEALALAQAEARAARERERNLFALSVGKVTPLRARNEVSFQDPPPSPLPLQLVIDEQNVLREAMSDEFDVSTLLDVDDQLSFRRPGIGLDVTHKLRGGHWSIQRQLDLHGLRSDEAREALGQFIRLSHRTGVRCVRVVHGKGLGSPGRTPVLKGKVQRWLVQKKEVLAFVQARPAEGGAGALVVLLQPGKRRMY
>NZ_CP044131.1|WP_161598770.1|3287158_3288016_+|hypothetical-protein
MTACGGGGGGDSSSEAGGSGSTKPDTGSPALQILVPAYFYPSTKDSQWDVLSAGAQAYPGVKITAILNPSNGIFDKANPAFTAAIQDFESHGGKLLGYVNTKYGTRTAQAVQSNIDDYLKFYPSIQGLFLDEMDAHGKEISFYRQVAAHIRAQNSKLQIVGNPGTPPTSDYAAVADTLVSFEGKEVDYRKLDPERTHSWIYQLPTSSNAVLIHDADNCELMQSTLRSAKTTQAHTGYIYVTDRQYDYQNNVGNPWATLPSYWLKMLQTVDALNKGQPLPSCTSPS
>NZ_CP044131.1|WP_158393154.1|3288012_3289041_-|M48-family-metalloprotease
MRFWEQQKQARRRTRWLLLAFGLCVLAVVVSVHLGLALAWWLGTWVLGGWSYPAGFTAVNIGVTLLLVLGGTCIELDQLRHGGRKLAERVGAREARPGGSLAEQQLCNIVDEMCIAAHWPTPQVAVLARTEAINAFAAGWDAQDAVIAVTQGALEQLNREEMQGLVAHELSHLREGDTRLNMQLASMVYGLELIHNFGQGLRERDSVLTQWFGLFIQASGFIGWLCGQVLKAAVSRQREYLADARAVQWTRSKDGLGGVLRKVLAQREISRRQYGHWQADVRSHQGLDHRTVQHMLLADAPHVSRLEEWLESHPSVRERIRRIYGRDMQPLPLPLNTVPQGR
>NZ_CP044131.1|WP_158393156.1|3289044_3289632_-|LemA-family-protein
MAGWIALAVAVVALIWGVAVYNRLRTFKNQVENAFAQIDVQLKRRHDLIPNLVEVARGYMQHEAQTLEAVTRARSAAVGAAEKARQAPGQPQAMGALMAAEQVLGSQMGRLMALTEAYPSLKADAQMQQLSEEITSTENRIGFARQAYNDQVLDFNNQAGQFPDLLVARLTGFSHLDMLASTQSEQERAVPQVKF
>NZ_CP044131.1|WP_158393158.1|3289699_3290008_-|monooxygenase
MPFLLQVDFEMDGPFGEAMVQAFSGLAQSINQEPGMLWKIWTEDAQAKQAGGVYLFDTHEHAQQYLQMHSARLTEAGVRNLRGKIFEVNEALSAINHGPLQA
>NZ_CP044131.1|WP_158393160.1|3290045_3290450_-|group-II-truncated-hemoglobin
MQIEEKPPFDTPYEWIGGEEKVQQLVARFYDLMDLEPGYKELRDAHGSTLEDARQKLFWFLCGWLGGPDYYQERFGHPRLRMRHMPFSIGIQERDQWVACMDQAMGETEVPQALRTRLKASFMNTADWMRNRGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1237533 : 1321623

Burkholderia_phage(30.56%)

terminase,plate,capsid,integrase,portal,tail,tRNA,protease,head,transposase

attL 1278183:1278204|attR 1313155:1313176

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158386860.1\|1237533_1238460_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	2.6e-53	38.6
WP_158390476.1\|1238527_1238842_+	hypothetical protein	NA	NA	NA	NA
WP_158390478.1\|1238851_1239490_+	hypothetical protein	NA	NA	NA	NA
WP_161598727.1\|1239705_1240746_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_158390482.1\|1240796_1241684_-	hypothetical protein	NA	NA	NA	NA
WP_158390486.1\|1242082_1243075_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_158390488.1\|1243168_1244434_+	aspartate kinase	NA	NA	NA	NA
WP_158390490.1\|1250400_1251147_+	pseudouridine synthase	NA	NA	NA	NA
WP_158394207.1\|1251224_1252031_-	DNA/RNA non-specific endonuclease	A0A2H4N7Z3	Lake_Baikal_phage	3.2e-23	34.9
WP_158390492.1\|1252540_1252987_-	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_158390494.1\|1253029_1254532_-	sensor histidine kinase	A0A1V0SGX0	Hokovirus	1.1e-08	25.5
WP_158390496.1\|1254528_1255230_-	response regulator	NA	NA	NA	NA
WP_158390498.1\|1255365_1256331_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_158390502.1\|1256563_1257157_+	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
WP_158390504.1\|1257156_1258671_+	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
WP_158390506.1\|1258958_1260947_+	acetoacetate--CoA ligase	NA	NA	NA	NA
WP_158390508.1\|1260997_1261879_+	amidohydrolase family protein	NA	NA	NA	NA
WP_158390510.1\|1262258_1263230_+	sulfurtransferase	NA	NA	NA	NA
WP_158390512.1\|1263487_1264585_-	YeeE/YedE family protein	NA	NA	NA	NA
WP_158390514.1\|1264641_1265601_-	sulfurtransferase	NA	NA	NA	NA
WP_158390516.1\|1265890_1266457_-	hypothetical protein	NA	NA	NA	NA
WP_158390518.1\|1266611_1267709_-	ferrochelatase	NA	NA	NA	NA
WP_158390520.1\|1267780_1268530_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_158390522.1\|1268575_1269424_+	DUF2189 domain-containing protein	NA	NA	NA	NA
WP_158390524.1\|1269470_1269686_+	DUF2788 domain-containing protein	NA	NA	NA	NA
WP_158390526.1\|1269778_1270024_-	hypothetical protein	NA	NA	NA	NA
WP_158390528.1\|1270172_1271519_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_158390530.1\|1271527_1272367_-	presqualene diphosphate synthase HpnD	NA	NA	NA	NA
WP_158390532.1\|1272515_1273406_-	squalene synthase HpnC	NA	NA	NA	NA
WP_158390534.1\|1273567_1274827_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_158390536.1\|1274823_1278033_+	efflux RND transporter permease subunit	NA	NA	NA	NA
1278183:1278204	attL	NA	NA	NA	NA
WP_158394208.1\|1278395_1279412_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P9F9	Acinetobacter_phage	3.6e-48	36.4
WP_158390538.1\|1279420_1279927_-	hypothetical protein	NA	NA	NA	NA
WP_158394209.1\|1279944_1280130_-	hypothetical protein	NA	NA	NA	NA
WP_158390540.1\|1280424_1280628_-	hypothetical protein	NA	NA	NA	NA
WP_158390541.1\|1280653_1280881_-	hypothetical protein	NA	NA	NA	NA
WP_158390543.1\|1280902_1283014_-	replication endonuclease	R4JJS4	Burkholderia_phage	9.2e-54	31.9
WP_158390545.1\|1283031_1283457_-	hypothetical protein	NA	NA	NA	NA
WP_158390547.1\|1283602_1284232_-	hypothetical protein	NA	NA	NA	NA
WP_158394210.1\|1284327_1284753_-	ogr/Delta-like zinc finger family protein	E5E3T8	Burkholderia_phage	8.4e-15	55.1
WP_158394211.1\|1284861_1285167_-	DNA-binding protein	NA	NA	NA	NA
WP_158390549.1\|1285270_1285534_-	hypothetical protein	NA	NA	NA	NA
WP_158390551.1\|1285692_1286397_+	helix-turn-helix domain-containing protein	A4JWR8	Burkholderia_virus	9.3e-11	61.9
WP_158394212.1\|1286568_1286955_+	hypothetical protein	NA	NA	NA	NA
WP_158390553.1\|1287008_1287314_+	hypothetical protein	A0A0R6PIB1	Moraxella_phage	6.0e-07	74.3
WP_161598728.1\|1287371_1287542_+	hypothetical protein	NA	NA	NA	NA
WP_158390555.1\|1287625_1288156_+	hypothetical protein	NA	NA	NA	NA
WP_158390557.1\|1288272_1289562_-	DUF4113 domain-containing protein	I6RSM4	Salmonella_phage	1.4e-89	41.8
WP_158390559.1\|1289566_1290007_-	translesion error-prone DNA polymerase V autoproteolytic subunit	F1C5A6	Cronobacter_phage	1.0e-23	46.7
WP_158390561.1\|1290057_1290357_-	hypothetical protein	NA	NA	NA	NA
WP_158390563.1\|1290462_1291614_-	late control protein	A0A1S5NV58	Burkholderia_phage	5.2e-75	41.6
WP_158390565.1\|1291619_1292066_-\|tail	phage tail protein	K4NXK5	Burkholderia_phage	1.0e-31	54.4
WP_158390567.1\|1292069_1295123_-\|tail	phage tail tape measure protein	A0A2H4JGB2	uncultured_Caudovirales_phage	1.3e-120	42.6
WP_158390569.1\|1295349_1295469_-\|tail	GpE family phage tail protein	E5E3U7	Burkholderia_phage	2.6e-06	59.5
WP_158390571.1\|1295477_1295819_-\|tail	phage tail assembly protein	A4PE51	Ralstonia_virus	6.5e-18	52.3
WP_158390573.1\|1295866_1296376_-\|tail	phage major tail tube protein	V9IQX1	Stenotrophomonas_phage	4.2e-45	54.2
WP_158390575.1\|1296406_1297615_-\|tail	phage tail sheath protein	E5FFG9	Burkholderia_phage	3.0e-126	59.2
WP_158390577.1\|1298259_1300752_-	hypothetical protein	E5FFH1	Burkholderia_phage	9.3e-13	29.6
WP_158390579.1\|1300783_1301332_-\|tail	phage tail protein I	V9IQK7	Stenotrophomonas_phage	3.0e-49	50.6
WP_158390581.1\|1301324_1302242_-\|plate	baseplate assembly protein	R4JDM0	Burkholderia_phage	5.5e-80	53.8
WP_158390583.1\|1302238_1302583_-	hypothetical protein	A0A077K8R5	Ralstonia_phage	1.9e-17	50.5
WP_158390585.1\|1302579_1303251_-\|plate	phage baseplate assembly protein V	A0A2H4JFJ8	uncultured_Caudovirales_phage	1.7e-30	41.4
WP_158390587.1\|1303452_1303920_-	phage virion morphogenesis protein	A0A2H4J927	uncultured_Caudovirales_phage	3.4e-25	42.9
WP_158390589.1\|1303919_1304420_-\|tail	phage tail protein	E5G6N3	Salmonella_phage	2.4e-21	41.2
WP_158390591.1\|1304416_1304905_-	hypothetical protein	NA	NA	NA	NA
WP_158390593.1\|1304901_1305477_-	hypothetical protein	A0A0N7IRE7	Acinetobacter_phage	1.4e-41	49.4
WP_158390595.1\|1305473_1305938_-	hypothetical protein	NA	NA	NA	NA
WP_158390597.1\|1305970_1306183_-\|tail	phage tail protein	A0A077K8R0	Ralstonia_phage	2.1e-11	54.5
WP_158390599.1\|1306185_1306677_-\|head	head completion/stabilization protein	E5E3W6	Burkholderia_phage	3.1e-21	40.1
WP_158390601.1\|1306792_1307653_-\|terminase	small terminase subunit	A4JWP8	Burkholderia_virus	5.1e-35	39.6
WP_158390603.1\|1307721_1308735_-\|capsid	phage major capsid protein, P2 family	E5FFI6	Burkholderia_phage	3.6e-112	59.3
WP_158390605.1\|1308773_1309598_-\|capsid	GPO family capsid scaffolding protein	A0A077K9W8	Ralstonia_phage	4.5e-57	48.9
WP_158390607.1\|1309766_1311659_+\|terminase	terminase	E5FFI8	Burkholderia_phage	5.0e-200	59.8
WP_158390609.1\|1311655_1312687_+\|portal	phage portal protein	A0A077K9Q8	Ralstonia_phage	1.2e-110	57.3
WP_158390611.1\|1313490_1314801_+	trigger factor	NA	NA	NA	NA
1313155:1313176	attR	NA	NA	NA	NA
WP_158390613.1\|1314937_1315546_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	8.5e-53	55.2
WP_158390615.1\|1315722_1316985_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.0e-124	53.3
WP_158390617.1\|1317133_1319548_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.7e-217	51.6
WP_158390618.1\|1320423_1320732_+	hypothetical protein	NA	NA	NA	NA
WP_161598729.1\|1321266_1321623_+\|transposase	transposase	A0A0N9SHJ4	Paenibacillus_phage	8.0e-19	40.6

DBSCAN-SWA_2

1423221 : 1430151

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158390787.1\|1423221_1424007_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	4.6e-59	46.7
WP_158390789.1\|1424003_1424789_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	3.4e-30	45.0
WP_158390791.1\|1424802_1425648_+	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	2.4e-05	35.0
WP_158390793.1\|1425650_1426727_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	1.7e-08	27.0
WP_158390795.1\|1426826_1428062_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.6e-18	31.6
WP_158390797.1\|1428058_1429603_+	pseudouridine synthase	NA	NA	NA	NA
WP_158390799.1\|1429725_1430151_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	2.5e-19	42.1

DBSCAN-SWA_3

1875649 : 1978299

Escherichia_phage(20.0%)

transposase,integrase,protease,tRNA

attL 1933040:1933099|attR 1955456:1956644

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158391172.1\|1875649_1876015_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.2e-11	41.0
WP_158391173.1\|1876079_1878398_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	2.9e-170	42.3
WP_158391174.1\|1878571_1879108_-	response regulator	NA	NA	NA	NA
WP_158391175.1\|1879123_1880425_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_158394258.1\|1880538_1881339_-	SURF1 family protein	NA	NA	NA	NA
WP_158391176.1\|1881347_1881764_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
WP_158391177.1\|1881764_1882382_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
WP_158391178.1\|1882398_1884408_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_158391179.1\|1884470_1885526_-	ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_158391180.1\|1885864_1887205_+	MFS transporter	NA	NA	NA	NA
WP_158391181.1\|1887350_1888349_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_158391182.1\|1888539_1889451_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_012836612.1\|1889507_1890440_-\|transposase	IS5-like element ISAav2 family transposase	NA	NA	NA	NA
WP_158391183.1\|1890697_1891507_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_158391184.1\|1891690_1892866_+	4-hydroxybenzoate 3-monooxygenase	NA	NA	NA	NA
WP_158391185.1\|1893066_1893828_+	2OG-Fe dioxygenase family protein	NA	NA	NA	NA
WP_158394259.1\|1893860_1894742_-	thiol:disulfide interchange protein DsbG	NA	NA	NA	NA
WP_158391186.1\|1894807_1896244_-	redoxin family protein	NA	NA	NA	NA
WP_158391187.1\|1897125_1898907_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_158391188.1\|1899089_1899815_+	c-type cytochrome	NA	NA	NA	NA
WP_158391189.1\|1899832_1900813_+	c-type cytochrome	NA	NA	NA	NA
WP_158394260.1\|1900892_1901783_-	CoA transferase	NA	NA	NA	NA
WP_158394261.1\|1901966_1902893_+	4,5-DOPA dioxygenase extradiol	NA	NA	NA	NA
WP_158391190.1\|1903384_1903678_+	hypothetical protein	NA	NA	NA	NA
WP_158394262.1\|1903802_1904240_+	universal stress protein	NA	NA	NA	NA
WP_158391191.1\|1904398_1905382_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_158391192.1\|1905877_1906642_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_158394263.1\|1906745_1907447_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.4e-14	27.4
WP_158391193.1\|1907458_1908226_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG	G3M9Y6	Bacillus_virus	2.8e-16	26.8
WP_158391194.1\|1908278_1909517_-	high-affinity branched-chain amino acid ABC transporter permease LivM	NA	NA	NA	NA
WP_158391195.1\|1909516_1910440_-	high-affinity branched-chain amino acid ABC transporter permease LivH	NA	NA	NA	NA
WP_158391196.1\|1910537_1911656_-	high-affinity branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_158394264.1\|1912005_1912680_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_158391197.1\|1912708_1914886_-	response regulator	NA	NA	NA	NA
WP_158391198.1\|1915177_1918075_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	4.4e-264	51.0
WP_158391199.1\|1918168_1918543_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_158391200.1\|1918679_1919834_-	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_158391201.1\|1920244_1920661_-	hypothetical protein	NA	NA	NA	NA
WP_158391202.1\|1920767_1921097_+	hypothetical protein	NA	NA	NA	NA
WP_158391203.1\|1921162_1922719_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_158391204.1\|1922735_1924058_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_158391205.1\|1924209_1925694_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_158391206.1\|1925754_1926339_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_158391207.1\|1926645_1927116_-	hypothetical protein	NA	NA	NA	NA
WP_158391208.1\|1927246_1928827_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_158391209.1\|1929796_1930678_-	putative selenate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_158391210.1\|1930897_1932826_-	alkaline phosphatase	M4SLV1	Cyanophage	2.0e-15	29.0
1933040:1933099	attL	NA	NA	NA	NA
WP_158387950.1\|1933199_1934162_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.7e-111	64.4
WP_161598740.1\|1934183_1935326_+	AAA family ATPase	NA	NA	NA	NA
WP_001067855.1\|1935337_1936042_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000052512.1\|1936491_1937967_+	ABC-F type ribosomal protection protein Msr(E)	A0A1B0RXA0	Streptococcus_phage	2.3e-160	59.0
WP_000155092.1\|1938022_1938907_+	Mph(E) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
WP_001067855.1\|1938990_1939695_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_002016386.1\|1939585_1940545_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.3e-47	40.5
WP_014454105.1\|1940705_1941260_+	aminoglycoside N-acetyltransferase AAC(6')-Ib'	NA	NA	NA	NA
WP_001261740.1\|1941329_1942121_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA2	NA	NA	NA	NA
WP_158391211.1\|1942389_1943604_+	chloramphenicol/florfenicol efflux MFS transporter FloR	S4TR35	Salmonella_phage	5.7e-16	23.7
WP_001747812.1\|1943631_1943814_+	DUF3363 domain-containing protein	NA	NA	NA	NA
WP_012836612.1\|1944184_1945117_-\|transposase	IS5-like element ISAav2 family transposase	NA	NA	NA	NA
WP_001257840.1\|1945582_1946758_+	tetracycline efflux MFS transporter Tet(G)	NA	NA	NA	NA
WP_001253717.1\|1946778_1947570_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_001747814.1\|1947661_1949194_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_001317507.1\|1950229_1950703_+	trimethoprim-resistant dihydrofolate reductase DfrA5	A0A1B2IBQ4	Erwinia_phage	2.6e-17	33.7
WP_000679427.1\|1950886_1951234_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259032.1\|1951227_1952067_+	sulfonamide-resistant dihydropteroate synthase Sul1	NA	NA	NA	NA
WP_001389365.1\|1952241_1953006_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_001375131.1\|1953069_1953327_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A077SL39	Escherichia_phage	8.9e-12	61.9
WP_157914678.1\|1953590_1954145_-	hypothetical protein	NA	NA	NA	NA
WP_158387950.1\|1955615_1956578_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.7e-111	64.4
WP_158391212.1\|1956973_1957810_+	DNA ligase	R4T9D4	Halovirus	2.2e-06	23.8
1955456:1956644	attR	NA	NA	NA	NA
WP_158391213.1\|1957877_1959023_+	AAA family ATPase	NA	NA	NA	NA
WP_158391214.1\|1959125_1959884_-	hypothetical protein	NA	NA	NA	NA
WP_158391215.1\|1959893_1961372_-	amidohydrolase family protein	NA	NA	NA	NA
WP_161598741.1\|1961951_1962353_+	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_158391217.1\|1962561_1963359_+	hypothetical protein	NA	NA	NA	NA
WP_158391218.1\|1963688_1965305_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	8.4e-15	30.6
WP_158391219.1\|1965341_1965782_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_158391220.1\|1965778_1966039_-	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_158391221.1\|1966345_1966798_-	DIP1984 family protein	NA	NA	NA	NA
WP_158391222.1\|1966873_1968349_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	2.7e-92	39.9
WP_158391223.1\|1968448_1968973_+	DUF4124 domain-containing protein	NA	NA	NA	NA
WP_158391224.1\|1969049_1969397_-	RnfH family protein	NA	NA	NA	NA
WP_158391225.1\|1969389_1969842_-	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_158391226.1\|1970001_1970475_+	SsrA-binding protein SmpB	NA	NA	NA	NA
WP_158391227.1\|1970692_1970986_-	hypothetical protein	NA	NA	NA	NA
WP_158391228.1\|1971195_1973820_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	7.4e-77	37.5
WP_158391229.1\|1973966_1975100_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_158391230.1\|1975104_1976403_+	diguanylate cyclase	NA	NA	NA	NA
WP_158394265.1\|1976455_1977193_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_158391231.1\|1977222_1978299_-\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA

DBSCAN-SWA_4

2044485 : 2074710

Choristoneura_rosaceana_entomopoxvirus(25.0%)

transposase,integrase

attL 2059644:2059658|attR 2073352:2073366

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158391283.1\|2044485_2045574_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_158391284.1\|2045703_2046351_-	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_158391285.1\|2046386_2047031_+	NTP transferase domain-containing protein	NA	NA	NA	NA
WP_158391286.1\|2047087_2047699_-	superoxide dismutase family protein	R4ZFR3	Choristoneura_rosaceana_entomopoxvirus	3.0e-21	42.9
WP_158391287.1\|2047802_2048432_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_158391288.1\|2048708_2049233_+	OmpA family protein	NA	NA	NA	NA
WP_158391289.1\|2049322_2049850_-	SnoaL-like domain-containing protein	NA	NA	NA	NA
WP_158391290.1\|2050005_2050431_-	lactoylglutathione lyase	NA	NA	NA	NA
WP_158391291.1\|2050787_2051777_-	hypothetical protein	NA	NA	NA	NA
WP_158391292.1\|2052271_2052622_-	hypothetical protein	NA	NA	NA	NA
WP_158391293.1\|2058629_2059199_+	hypothetical protein	NA	NA	NA	NA
WP_158391294.1\|2059195_2059765_+	GTPase	NA	NA	NA	NA
2059644:2059658	attL	NA	NA	NA	NA
WP_158391295.1\|2059761_2060160_+	roadblock/LC7 domain-containing protein	NA	NA	NA	NA
WP_158391296.1\|2060260_2060620_+	hypothetical protein	NA	NA	NA	NA
WP_158391297.1\|2060913_2063526_+	EAL domain-containing protein	A0A1V0S925	Catovirus	3.8e-09	32.1
WP_158391298.1\|2063533_2065120_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.0e-05	87.1
WP_158391300.1\|2065207_2065564_-	EAL domain-containing protein	NA	NA	NA	NA
WP_158391302.1\|2065660_2066080_+\|transposase	transposase	NA	NA	NA	NA
WP_158391304.1\|2066170_2067250_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_158391306.1\|2067496_2068696_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_158391308.1\|2068786_2069785_+	hypothetical protein	NA	NA	NA	NA
WP_158391310.1\|2070161_2071265_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_158394269.1\|2071670_2072762_-	zinc-binding dehydrogenase	A0A2L2DIY2	Acanthamoeba_polyphaga_mimivirus	1.8e-08	23.5
WP_158388482.1\|2073414_2074710_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
2073352:2073366	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2368287 : 2473200

Pseudomonas_phage(12.0%)

terminase,capsid,integrase,tRNA,transposase

attL 2382696:2382711|attR 2408288:2408303

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012836612.1\|2368287_2369220_-\|transposase	IS5-like element ISAav2 family transposase	NA	NA	NA	NA
WP_158391729.1\|2369280_2369748_+	hypothetical protein	NA	NA	NA	NA
WP_158391731.1\|2370054_2370822_+	hypothetical protein	NA	NA	NA	NA
WP_158394293.1\|2371624_2372194_+	hypothetical protein	A0A1P8DTE1	Proteus_phage	1.3e-23	49.6
WP_158391735.1\|2372197_2372752_+	Rha family transcriptional regulator	G8C7W4	Escherichia_phage	2.8e-18	38.2
WP_158391737.1\|2373501_2373720_+	hypothetical protein	NA	NA	NA	NA
WP_158391739.1\|2373723_2374242_+	hypothetical protein	NA	NA	NA	NA
WP_161598743.1\|2374234_2374708_+	hypothetical protein	NA	NA	NA	NA
WP_158391743.1\|2374721_2375483_+	hypothetical protein	NA	NA	NA	NA
WP_012836612.1\|2376034_2376967_-\|transposase	IS5-like element ISAav2 family transposase	NA	NA	NA	NA
WP_158391745.1\|2376976_2378401_-	AAA family ATPase	R9TRQ8	Vibrio_phage	2.2e-19	27.9
WP_158391747.1\|2378556_2379156_-	DUF4124 domain-containing protein	NA	NA	NA	NA
WP_158391749.1\|2379233_2379944_-	hypothetical protein	NA	NA	NA	NA
WP_158391751.1\|2380372_2380738_-	hypothetical protein	NA	NA	NA	NA
WP_158391753.1\|2381030_2381606_+	hypothetical protein	NA	NA	NA	NA
WP_158391755.1\|2381654_2382482_+	hypothetical protein	L7TIB4	Pseudomonas_virus	4.4e-28	45.2
WP_158391757.1\|2382478_2384056_+\|terminase	terminase	Q775B9	Bordetella_phage	3.3e-117	44.6
2382696:2382711	attL	NA	NA	NA	NA
WP_158391759.1\|2384064_2386164_+	genomic island protein	A0A0S3UFY2	Pseudomonas_phage	9.0e-102	37.6
WP_158391761.1\|2386172_2386385_+	hypothetical protein	NA	NA	NA	NA
WP_158391763.1\|2386410_2387355_+	hypothetical protein	NA	NA	NA	NA
WP_158391765.1\|2387690_2388791_+\|capsid	N4-gp56 family major capsid protein	A0A0S3UG53	Pseudomonas_phage	4.1e-98	51.1
WP_158391767.1\|2388862_2389264_+	hypothetical protein	NA	NA	NA	NA
WP_158391769.1\|2389359_2389725_+	hypothetical protein	NA	NA	NA	NA
WP_158391771.1\|2389740_2390412_+	hypothetical protein	NA	NA	NA	NA
WP_158391772.1\|2391716_2392145_+	hypothetical protein	NA	NA	NA	NA
WP_158391774.1\|2392147_2398672_+	PLxRFG domain-containing protein	A0A240F4T3	Ochrobactrum_phage	4.0e-116	32.2
WP_158391776.1\|2398865_2399627_-	hypothetical protein	NA	NA	NA	NA
WP_158391778.1\|2399977_2400274_-	putative addiction module antidote protein	NA	NA	NA	NA
WP_158391780.1\|2400276_2400573_-	type II toxin-antitoxin system RelE/ParE family toxin	A4JWV2	Burkholderia_virus	1.6e-17	43.9
WP_158391782.1\|2400839_2402180_-\|integrase	tyrosine-type recombinase/integrase	A0A221SAN4	Ralstonia_phage	2.6e-09	25.3
WP_158391784.1\|2402630_2402903_+	hypothetical protein	NA	NA	NA	NA
WP_158391786.1\|2403260_2403737_+	hypothetical protein	NA	NA	NA	NA
WP_158388626.1\|2403739_2404777_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-40	34.4
WP_158391788.1\|2404802_2405057_+	hypothetical protein	NA	NA	NA	NA
WP_158388482.1\|2405217_2406513_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_161598744.1\|2406662_2407097_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_158391792.1\|2407106_2407283_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_158391794.1\|2407736_2407955_+	hypothetical protein	NA	NA	NA	NA
WP_158391796.1\|2407977_2408238_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_158391798.1\|2408886_2409207_+	hypothetical protein	NA	NA	NA	NA
2408288:2408303	attR	NA	NA	NA	NA
WP_158391800.1\|2409214_2410150_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_158391802.1\|2410301_2411294_+	bile acid:sodium symporter	NA	NA	NA	NA
WP_158391804.1\|2411522_2411912_+	hypothetical protein	NA	NA	NA	NA
WP_158391806.1\|2411994_2413788_-	hypothetical protein	NA	NA	NA	NA
WP_158391808.1\|2413784_2414228_-	hypothetical protein	NA	NA	NA	NA
WP_158394294.1\|2414303_2415302_-	LD-carboxypeptidase	NA	NA	NA	NA
WP_158391810.1\|2415528_2416917_-\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	4.4e-12	34.0
WP_158391812.1\|2416980_2418192_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_158391814.1\|2418638_2420645_+	U32 family peptidase	Q6DW11	Phage_TP	9.1e-19	27.5
WP_158391816.1\|2420904_2421846_-	alpha/beta hydrolase fold domain-containing protein	A0A2P1EM31	Moumouvirus	1.1e-35	31.9
WP_158391818.1\|2421918_2423382_-	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_158394295.1\|2423395_2424136_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_158391820.1\|2424465_2425266_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_158391821.1\|2425590_2426247_+	3'-5' exonuclease domain-containing protein 2	NA	NA	NA	NA
WP_158391822.1\|2426486_2427764_+	aminotransferase class V-fold PLP-dependent enzyme	A0A0B5JD48	Pandoravirus	1.3e-10	28.4
WP_158391824.1\|2428010_2428610_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_158391826.1\|2428851_2429865_-	DUF808 family protein	NA	NA	NA	NA
WP_158391828.1\|2430113_2430323_+	hypothetical protein	NA	NA	NA	NA
WP_158394296.1\|2430341_2431550_-	VWA domain-containing protein	Q9EYF7	Enterobacteria_phage	4.3e-48	36.2
WP_158391830.1\|2431552_2434165_-	hypothetical protein	NA	NA	NA	NA
WP_158391832.1\|2434207_2435290_-	AAA domain-containing protein	NA	NA	NA	NA
WP_158391834.1\|2435328_2437044_-	hypothetical protein	NA	NA	NA	NA
WP_158391836.1\|2437043_2438456_-	SWIM zinc finger family protein	NA	NA	NA	NA
WP_158388482.1\|2438886_2440182_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_158388626.1\|2440457_2441495_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-40	34.4
WP_158391838.1\|2441658_2442573_+	WYL domain-containing protein	A0A0R6PH67	Moraxella_phage	3.0e-25	27.8
WP_158391840.1\|2442748_2446771_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	7.4e-145	61.2
WP_158391842.1\|2446948_2447761_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_158391844.1\|2447948_2450621_+	[protein-PII] uridylyltransferase	NA	NA	NA	NA
WP_158391846.1\|2450694_2450955_+	hypothetical protein	NA	NA	NA	NA
WP_158391848.1\|2451027_2451891_-	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_158391850.1\|2452297_2452555_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_158391852.1\|2453493_2455389_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_158391854.1\|2455959_2456304_+	DNA breaking-rejoining protein	NA	NA	NA	NA
WP_158391856.1\|2456560_2457013_+	universal stress protein	NA	NA	NA	NA
WP_158391858.1\|2457702_2458920_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.1e-19	36.4
WP_158391860.1\|2459138_2460026_+	Band 7 protein	A0A292GKI7	Xanthomonas_phage	2.2e-57	58.5
WP_158391864.1\|2460772_2461417_+	FABP family protein	NA	NA	NA	NA
WP_158391866.1\|2461618_2462728_+	restriction endonuclease	A0A1S5SAB0	Streptococcus_phage	7.4e-71	40.8
WP_158391868.1\|2462813_2463371_-	Arc family DNA-binding protein	NA	NA	NA	NA
WP_158391870.1\|2463471_2463642_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_158391872.1\|2464868_2465294_-	hypothetical protein	NA	NA	NA	NA
WP_158391874.1\|2465341_2466067_-	LrgB family protein	NA	NA	NA	NA
WP_158391876.1\|2466059_2466434_-	CidA/LrgA family protein	NA	NA	NA	NA
WP_158391878.1\|2466670_2467120_+	cytochrome c5 family protein	NA	NA	NA	NA
WP_158391880.1\|2467343_2467799_+	universal stress protein	NA	NA	NA	NA
WP_161598745.1\|2467805_2467958_-	hypothetical protein	NA	NA	NA	NA
WP_158391882.1\|2467986_2468499_-	hypothetical protein	NA	NA	NA	NA
WP_158391884.1\|2468495_2468966_-	glycoside hydrolase family protein	A0A0U4JP67	Pseudomonas_phage	8.9e-34	53.1
WP_158391886.1\|2468962_2469259_-	hypothetical protein	NA	NA	NA	NA
WP_158391888.1\|2469297_2469534_-	hypothetical protein	NA	NA	NA	NA
WP_158391890.1\|2469530_2471420_-	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	8.0e-49	35.0
WP_158391892.1\|2471434_2471878_-	hypothetical protein	NA	NA	NA	NA
WP_158387950.1\|2472237_2473200_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.7e-111	64.4

DBSCAN-SWA_6

2481536 : 2512526

Marinobacter_phage(14.29%)

terminase,portal,capsid,integrase,head,transposase

attL 2480572:2480587|attR 2514528:2514543

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2480572:2480587	attL	NA	NA	NA	NA
WP_158391898.1\|2481536_2482334_-	hypothetical protein	A0A2D1GMD2	Marinobacter_phage	2.8e-43	40.6
WP_158391900.1\|2482369_2482783_-	hypothetical protein	NA	NA	NA	NA
WP_158391902.1\|2482788_2483109_-	hypothetical protein	NA	NA	NA	NA
WP_158391904.1\|2483112_2484156_-\|capsid	major capsid protein	A0A0A8ILA9	Aurantimonas_phage	9.8e-65	41.0
WP_158391906.1\|2484184_2484544_-\|head	head decoration protein	A0A0A8IL52	Aurantimonas_phage	1.5e-17	50.0
WP_158391908.1\|2484573_2485947_-	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	3.6e-51	43.6
WP_158391910.1\|2485943_2487545_-\|portal	phage portal protein	A0A2D1GMT8	Marinobacter_phage	2.2e-71	34.1
WP_158391912.1\|2487547_2487790_-	hypothetical protein	NA	NA	NA	NA
WP_158391914.1\|2487966_2488263_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_158391916.1\|2488268_2488589_+	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	5.0e-12	43.0
WP_158391918.1\|2488790_2489351_-	hypothetical protein	NA	NA	NA	NA
WP_158391920.1\|2489568_2490357_-	Rha family transcriptional regulator	A0A2R2Z320	Escherichia_phage	1.7e-16	47.0
WP_158388482.1\|2490765_2492061_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_158391922.1\|2492271_2494314_-\|terminase	phage terminase large subunit family protein	K7PGW7	Enterobacteria_phage	6.7e-102	37.0
WP_158394299.1\|2494995_2495523_-	hypothetical protein	NA	NA	NA	NA
WP_158394300.1\|2495552_2496263_-	helix-turn-helix domain-containing protein	A0A1B0YZZ0	Pseudomonas_phage	5.0e-28	69.7
WP_158391924.1\|2496291_2496633_-	hypothetical protein	NA	NA	NA	NA
WP_158391926.1\|2496704_2497526_-	hypothetical protein	NA	NA	NA	NA
WP_158391928.1\|2497527_2498061_-	hypothetical protein	NA	NA	NA	NA
WP_158391930.1\|2498059_2498335_+	hypothetical protein	NA	NA	NA	NA
WP_158391932.1\|2498432_2498927_-	hypothetical protein	NA	NA	NA	NA
WP_161598746.1\|2498910_2499084_-	hypothetical protein	NA	NA	NA	NA
WP_158391934.1\|2499082_2499466_+	hypothetical protein	NA	NA	NA	NA
WP_158391936.1\|2499468_2499690_-	hypothetical protein	NA	NA	NA	NA
WP_158391938.1\|2499864_2500479_+	helix-turn-helix transcriptional regulator	A0A0U4JEE2	Pseudomonas_phage	7.1e-15	33.3
WP_158391940.1\|2500637_2501030_+	hypothetical protein	NA	NA	NA	NA
WP_158391942.1\|2501351_2501810_-	hypothetical protein	NA	NA	NA	NA
WP_158391944.1\|2502344_2502536_-	hypothetical protein	NA	NA	NA	NA
WP_158391946.1\|2502534_2502774_+	hypothetical protein	NA	NA	NA	NA
WP_158391948.1\|2502988_2503183_+	hypothetical protein	NA	NA	NA	NA
WP_158391950.1\|2503251_2503599_+	PRC-barrel domain containing protein	NA	NA	NA	NA
WP_158391952.1\|2504506_2504686_+	hypothetical protein	NA	NA	NA	NA
WP_158391954.1\|2504754_2504949_+	hypothetical protein	NA	NA	NA	NA
WP_158391956.1\|2504991_2505216_+	hypothetical protein	NA	NA	NA	NA
WP_158391958.1\|2505232_2505493_+	hypothetical protein	NA	NA	NA	NA
WP_158391960.1\|2505706_2505925_-	hypothetical protein	NA	NA	NA	NA
WP_158391962.1\|2506066_2506324_+	hypothetical protein	NA	NA	NA	NA
WP_161598747.1\|2506346_2506748_-	hypothetical protein	NA	NA	NA	NA
WP_158388626.1\|2506983_2508021_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-40	34.4
WP_158391966.1\|2508030_2508330_-	hypothetical protein	NA	NA	NA	NA
WP_158391968.1\|2508662_2509367_+	hypothetical protein	F8J196	Lactobacillus_virus	6.9e-22	48.3
WP_158391970.1\|2509500_2509851_+	hypothetical protein	NA	NA	NA	NA
WP_158391972.1\|2509892_2510147_-	DUF333 domain-containing protein	NA	NA	NA	NA
WP_158391974.1\|2510234_2510783_-	lipocalin	A0A1W6JNX6	Morganella_phage	1.7e-47	54.8
WP_158391976.1\|2510927_2511146_+	hypothetical protein	NA	NA	NA	NA
WP_158391978.1\|2511196_2511454_+	excisionase family DNA-binding protein	NA	NA	NA	NA
WP_158391980.1\|2511401_2512526_-\|integrase	tyrosine-type recombinase/integrase	A0A1L7DQ84	Ralstonia_phage	4.0e-24	30.1
2514528:2514543	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2596960 : 2700331

Streptococcus_phage(18.18%)

tRNA,integrase,transposase

attL 2591896:2591910|attR 2679405:2679422

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2591896:2591910	attL	NA	NA	NA	NA
WP_012836612.1\|2596960_2597893_-\|transposase	IS5-like element ISAav2 family transposase	NA	NA	NA	NA
2591896:2591910	attL	NA	NA	NA	NA
WP_158392118.1\|2597864_2598872_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	5.4e-113	65.6
WP_158394305.1\|2599079_2600006_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_158392120.1\|2600364_2601348_+	DUF1852 family protein	NA	NA	NA	NA
WP_158394306.1\|2601391_2601970_+	FMN reductase	NA	NA	NA	NA
WP_158392122.1\|2602039_2603065_+	methionine synthase	NA	NA	NA	NA
WP_012836612.1\|2603901_2604834_+\|transposase	IS5-like element ISAav2 family transposase	NA	NA	NA	NA
WP_158392124.1\|2604852_2605194_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_158392126.1\|2606437_2607499_+	porin	NA	NA	NA	NA
WP_158392128.1\|2607580_2608288_-	hypothetical protein	NA	NA	NA	NA
WP_158392130.1\|2608284_2609274_-	MCE family protein	NA	NA	NA	NA
WP_158392132.1\|2609287_2610091_-	ABC transporter permease	NA	NA	NA	NA
WP_158392134.1\|2610148_2610622_-	MerR family DNA-binding protein	NA	NA	NA	NA
WP_158392136.1\|2610661_2612776_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.1e-118	39.8
WP_158392138.1\|2612802_2613162_+	hypothetical protein	NA	NA	NA	NA
WP_158392140.1\|2613189_2613612_+	hypothetical protein	NA	NA	NA	NA
WP_158392142.1\|2613729_2614089_+	hypothetical protein	NA	NA	NA	NA
WP_158392144.1\|2614085_2615531_+	TolC family protein	NA	NA	NA	NA
WP_158392146.1\|2615532_2616918_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_158392148.1\|2617025_2617532_+	DUF411 domain-containing protein	NA	NA	NA	NA
WP_158392150.1\|2617566_2617911_+	copper-binding protein	NA	NA	NA	NA
WP_158392152.1\|2617964_2619137_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_158392154.1\|2619217_2620195_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_158392156.1\|2620251_2621454_+	hypothetical protein	NA	NA	NA	NA
WP_158392158.1\|2621530_2622367_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_158392160.1\|2622530_2623559_+	P1 family peptidase	NA	NA	NA	NA
WP_158392162.1\|2623615_2625913_-	DUF1631 family protein	NA	NA	NA	NA
WP_158392164.1\|2625959_2627621_-	energy-dependent translational throttle protein EttA	A0A1B0RXA0	Streptococcus_phage	2.3e-39	29.3
WP_158392166.1\|2627887_2629714_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	7.7e-49	30.2
WP_158394307.1\|2629920_2631660_+	peptidase M14	NA	NA	NA	NA
WP_158392168.1\|2632231_2632420_+	hypothetical protein	NA	NA	NA	NA
WP_158392170.1\|2632468_2633188_+	hypothetical protein	NA	NA	NA	NA
WP_161598749.1\|2633263_2633467_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_161598750.1\|2633439_2633880_+	ogr/Delta-like zinc finger family protein	NA	NA	NA	NA
WP_158392176.1\|2634010_2634415_+	hypothetical protein	NA	NA	NA	NA
WP_012836612.1\|2634429_2635362_+\|transposase	IS5-like element ISAav2 family transposase	NA	NA	NA	NA
WP_158392178.1\|2635403_2635796_+	hypothetical protein	NA	NA	NA	NA
WP_158392180.1\|2635899_2636175_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_158392182.1\|2636186_2637029_+	hypothetical protein	K7PH51	Enterobacterial_phage	3.4e-52	45.2
WP_158392184.1\|2637330_2637546_+	hypothetical protein	NA	NA	NA	NA
WP_158392186.1\|2637717_2638128_+	hypothetical protein	NA	NA	NA	NA
WP_158392188.1\|2638786_2641567_+	bifunctional DNA primase/helicase	A0A077K8T2	Ralstonia_phage	5.9e-242	48.4
WP_158394308.1\|2641648_2642665_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P9F9	Acinetobacter_phage	3.9e-50	38.5
WP_158388626.1\|2643608_2644646_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-40	34.4
WP_161598751.1\|2644699_2644852_+	hypothetical protein	NA	NA	NA	NA
WP_158392190.1\|2644926_2645121_-	hypothetical protein	NA	NA	NA	NA
WP_158387946.1\|2645402_2646848_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_158392192.1\|2647472_2648714_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	9.7e-96	46.7
WP_158389430.1\|2649913_2650909_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.2e-117	65.9
2650488:2650502	attR	NA	NA	NA	NA
WP_158392194.1\|2651044_2651311_-	DUF1488 family protein	NA	NA	NA	NA
2650488:2650502	attR	NA	NA	NA	NA
WP_158388626.1\|2651497_2652535_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-40	34.4
WP_158392196.1\|2652563_2653037_+	hypothetical protein	A0A1V0SLK8	Klosneuvirus	4.5e-09	30.9
WP_158388626.1\|2653039_2654077_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-40	34.4
WP_158392198.1\|2654290_2656714_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	2.3e-77	37.5
WP_158392202.1\|2656925_2657621_-	hypothetical protein	NA	NA	NA	NA
WP_158392204.1\|2657634_2657970_-	hypothetical protein	NA	NA	NA	NA
WP_158392206.1\|2658263_2660711_-	DUF3987 domain-containing protein	A0A291LAR9	Bordetella_phage	2.7e-41	37.9
WP_158392208.1\|2660710_2660929_-	hypothetical protein	NA	NA	NA	NA
WP_158392210.1\|2660928_2661210_-	hypothetical protein	NA	NA	NA	NA
WP_158392212.1\|2661219_2661468_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_158392214.1\|2661585_2662038_-	hypothetical protein	NA	NA	NA	NA
WP_158392216.1\|2663062_2663995_-\|transposase	IS5-like element ISAav2 family transposase	NA	NA	NA	NA
WP_158394309.1\|2663966_2664503_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A7X7X0	Dichelobacter_phage	5.6e-08	33.3
WP_158392218.1\|2665856_2666570_-	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
WP_158392220.1\|2666654_2667296_-	OmpA family protein	NA	NA	NA	NA
WP_158392222.1\|2667525_2670252_+	DNA gyrase subunit A	A0A172JHV7	Bacillus_phage	7.3e-104	31.5
WP_158392224.1\|2670387_2671497_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	5.1e-80	43.0
WP_158392226.1\|2671631_2672732_+	prephenate dehydratase	NA	NA	NA	NA
WP_158392228.1\|2672731_2673634_+	prephenate dehydrogenase/arogenate dehydrogenase family protein	NA	NA	NA	NA
WP_158392230.1\|2673754_2675815_+	bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidylate kinase	NA	NA	NA	NA
WP_158392232.1\|2676000_2677683_+	30S ribosomal protein S1	NA	NA	NA	NA
WP_158392234.1\|2677792_2678113_+	integration host factor subunit beta	A0A0H3UZA0	Geobacillus_virus	2.5e-11	35.6
WP_158392236.1\|2678219_2678549_+	DUF1049 domain-containing protein	NA	NA	NA	NA
WP_158392238.1\|2678538_2679696_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
WP_158392240.1\|2679762_2680956_-	MFS transporter	NA	NA	NA	NA
WP_158392242.1\|2680952_2682593_-	DNA recombination protein RmuC	NA	NA	NA	NA
WP_158392244.1\|2682834_2683242_-	tautomerase family protein	NA	NA	NA	NA
WP_158392246.1\|2683388_2684366_-	D-glycerate dehydrogenase	M1NSB9	Streptococcus_phage	1.5e-11	26.2
WP_158394310.1\|2684486_2685905_-	sodium:proton antiporter	NA	NA	NA	NA
WP_158392248.1\|2685982_2687227_-	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	2.4e-49	34.0
WP_158392250.1\|2687459_2687936_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_158392252.1\|2688288_2688837_+	TIGR01841 family phasin	NA	NA	NA	NA
WP_158392254.1\|2689101_2689860_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_158392256.1\|2690616_2690952_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_158392258.1\|2690972_2694062_-	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	2.4e-71	25.1
WP_158392260.1\|2694066_2695278_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_158392262.1\|2695322_2696612_-	TolC family protein	NA	NA	NA	NA
WP_158394311.1\|2696925_2697324_-	hypothetical protein	NA	NA	NA	NA
WP_158392264.1\|2698921_2700331_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA

DBSCAN-SWA_8

2728609 : 2833002

Lactobacillus_phage(15.38%)

holin,transposase,integrase

attL 2747509:2747524|attR 2789056:2789071

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158392305.1\|2728609_2729563_-\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	7.1e-62	46.8
WP_012836612.1\|2729644_2730577_+\|transposase	IS5-like element ISAav2 family transposase	NA	NA	NA	NA
WP_018716282.1\|2730778_2731570_+	AadA family aminoglycoside 3''-O-nucleotidyltransferase	NA	NA	NA	NA
WP_000503574.1\|2731634_2732423_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA5	NA	NA	NA	NA
WP_012836612.1\|2732640_2733573_+\|transposase	IS5-like element ISAav2 family transposase	NA	NA	NA	NA
WP_158392310.1\|2733870_2734500_+	HindIII family type II restriction endonuclease	NA	NA	NA	NA
WP_158388626.1\|2734518_2735556_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-40	34.4
WP_158392312.1\|2735806_2736679_-	TIGR00730 family Rossman fold protein	F4YCQ1	Synechococcus_phage	3.0e-11	35.9
WP_158392314.1\|2736895_2737273_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	2.2e-19	50.5
WP_158392316.1\|2737326_2737755_-	Na+/H+ antiporter subunit G	NA	NA	NA	NA
WP_158392318.1\|2737751_2738030_-	K+/H+ antiporter subunit F	NA	NA	NA	NA
WP_158392320.1\|2738026_2738527_-	Na+/H+ antiporter subunit E	NA	NA	NA	NA
WP_158392322.1\|2738523_2740344_-	monovalent cation/H+ antiporter subunit D	NA	NA	NA	NA
WP_158392324.1\|2740340_2740706_-	Na+/H+ antiporter subunit C	NA	NA	NA	NA
WP_158392326.1\|2740705_2743681_-	monovalent cation/H+ antiporter subunit A	NA	NA	NA	NA
WP_158392328.1\|2744258_2744861_+	hypothetical protein	NA	NA	NA	NA
WP_158392330.1\|2744935_2745514_+	hypothetical protein	NA	NA	NA	NA
WP_158394316.1\|2745769_2746165_+	hypothetical protein	NA	NA	NA	NA
WP_158392332.1\|2746288_2747185_+	glutamate racemase	NA	NA	NA	NA
WP_158392334.1\|2747185_2747773_-	DUF45 domain-containing protein	NA	NA	NA	NA
2747509:2747524	attL	NA	NA	NA	NA
WP_158392336.1\|2747849_2748479_-	hypothetical protein	NA	NA	NA	NA
WP_158392338.1\|2749075_2750698_-	AMP-binding protein	A0A1V0SBX8	Catovirus	9.0e-17	22.2
WP_158392340.1\|2750701_2751769_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_158392342.1\|2751856_2753593_-	FAD-binding protein	A0A2P0ZL82	Lactobacillus_phage	9.1e-07	22.9
WP_158392344.1\|2753603_2755334_-	FAD-binding protein	A0A2P0ZL82	Lactobacillus_phage	1.6e-24	29.3
WP_158394317.1\|2755441_2756629_-	flavin-dependent monooxygenase	NA	NA	NA	NA
WP_158392346.1\|2756917_2757895_+	flavin reductase	NA	NA	NA	NA
WP_158392348.1\|2757965_2758805_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_158392350.1\|2758809_2759604_+	2-oxopent-4-enoate hydratase	NA	NA	NA	NA
WP_158392352.1\|2759610_2760534_+	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	4.9e-36	35.8
WP_158392354.1\|2760549_2761587_+	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	2.4e-47	35.6
WP_158392356.1\|2761595_2761832_-	hypothetical protein	NA	NA	NA	NA
WP_158392358.1\|2761880_2762090_-	hypothetical protein	NA	NA	NA	NA
WP_158392360.1\|2762655_2763600_-	acyl dehydratase	NA	NA	NA	NA
WP_158392362.1\|2763604_2764819_-	thiolase family protein	NA	NA	NA	NA
WP_158392364.1\|2765031_2766039_+	glycosyl hydrolase	NA	NA	NA	NA
WP_158392366.1\|2766035_2768522_+	MMPL family transporter	NA	NA	NA	NA
WP_158392368.1\|2768521_2768980_+	SnoaL-like domain-containing protein	NA	NA	NA	NA
WP_158392370.1\|2769168_2770278_-	dienelactone hydrolase	NA	NA	NA	NA
WP_158392372.1\|2770349_2771882_-	DUF1302 family protein	NA	NA	NA	NA
WP_158392374.1\|2771905_2773285_-	DUF1329 domain-containing protein	NA	NA	NA	NA
WP_158392376.1\|2773583_2775296_-	AMP-binding protein	NA	NA	NA	NA
WP_158392378.1\|2775298_2776426_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_158392380.1\|2776585_2777779_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_158392382.1\|2777791_2778859_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_158392384.1\|2778851_2780693_-	long-chain-acyl-CoA synthetase	NA	NA	NA	NA
WP_158392386.1\|2780753_2781935_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_158392388.1\|2781951_2783133_-	lipid-transfer protein	NA	NA	NA	NA
WP_158392390.1\|2783155_2783572_-	acyl dehydratase	NA	NA	NA	NA
WP_158392392.1\|2783587_2784694_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_158392394.1\|2784710_2785667_-	Zn-ribbon domain-containing OB-fold protein	NA	NA	NA	NA
WP_158392396.1\|2785685_2786477_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	6.1e-19	30.2
WP_158392398.1\|2786585_2787398_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_161598754.1\|2788450_2788684_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_158394319.1\|2788838_2790065_-	anaerobic sulfatase maturase	NA	NA	NA	NA
2789056:2789071	attR	NA	NA	NA	NA
WP_158389430.1\|2791077_2792073_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.2e-117	65.9
WP_158394320.1\|2792313_2793123_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_158392400.1\|2793206_2793899_-	hypothetical protein	NA	NA	NA	NA
WP_161598755.1\|2793976_2795494_-	sulfatase-like hydrolase/transferase	NA	NA	NA	NA
WP_158388482.1\|2795616_2796912_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_158388482.1\|2797268_2798564_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_158392404.1\|2799702_2801091_-	DUF1254 domain-containing protein	NA	NA	NA	NA
WP_158388482.1\|2801357_2802653_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_158392406.1\|2802937_2803849_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_158394321.1\|2804067_2804427_-	SgcJ/EcaC family oxidoreductase	NA	NA	NA	NA
WP_158392408.1\|2804576_2805350_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_158392410.1\|2805505_2807521_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_158392412.1\|2807537_2809664_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_158392414.1\|2809841_2810201_+	hypothetical protein	NA	NA	NA	NA
WP_158392416.1\|2810511_2812707_+	TonB-dependent copper receptor	NA	NA	NA	NA
WP_158392418.1\|2812819_2813590_-	glucose 1-dehydrogenase	NA	NA	NA	NA
WP_158392420.1\|2813831_2815256_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_158392422.1\|2815374_2816718_+	MFS transporter	NA	NA	NA	NA
WP_158392424.1\|2816756_2817596_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_158392426.1\|2817751_2818861_+	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_158392428.1\|2819085_2819823_-	EthD domain-containing protein	NA	NA	NA	NA
WP_158394322.1\|2819847_2821122_-	MFS transporter	NA	NA	NA	NA
WP_158392429.1\|2821299_2823066_+	amidohydrolase family protein	NA	NA	NA	NA
WP_158392431.1\|2823369_2823732_+	hypothetical protein	NA	NA	NA	NA
WP_158392433.1\|2823866_2825504_-	AMP-binding protein	NA	NA	NA	NA
WP_158392435.1\|2825694_2827065_-	MFS transporter	NA	NA	NA	NA
WP_158392437.1\|2827164_2829591_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_158392439.1\|2829631_2831284_-\|holin	glucose-methanol-choline oxidoreductase	A0A1V0SI18	Klosneuvirus	1.1e-49	29.6
WP_158392441.1\|2831280_2833002_-\|holin	glucose-methanol-choline oxidoreductase	A0A1V0SI18	Klosneuvirus	2.0e-46	27.6

DBSCAN-SWA_9

2902839 : 2983349

Pseudomonas_phage(35.71%)

tRNA,integrase,transposase,protease

attL 2963378:2963395|attR 2975418:2975435

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158392548.1\|2902839_2903880_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	2.9e-93	51.7
WP_158392550.1\|2903966_2904422_-	CBS domain-containing protein	NA	NA	NA	NA
WP_158392552.1\|2904573_2905278_-	DUF937 domain-containing protein	NA	NA	NA	NA
WP_158392554.1\|2905462_2906467_+	DNA-binding protein YbiB	A0A2H4JBY5	uncultured_Caudovirales_phage	1.9e-25	32.0
WP_158392556.1\|2906478_2907270_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_158392558.1\|2907436_2907919_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_158392560.1\|2908060_2908663_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_158392562.1\|2908713_2909991_+	aminoacetone oxidase family FAD-binding enzyme	NA	NA	NA	NA
WP_003052999.1\|2910174_2910387_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_158392564.1\|2910620_2911067_+	GatB/YqeY domain-containing protein	NA	NA	NA	NA
WP_158394329.1\|2911199_2912114_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_158392566.1\|2912218_2913319_+	tartrate dehydrogenase	NA	NA	NA	NA
WP_158392568.1\|2913463_2913820_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_158392570.1\|2913897_2914095_-	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_158394330.1\|2914402_2915332_-	EamA family transporter	NA	NA	NA	NA
WP_158392572.1\|2915457_2916012_-	hypothetical protein	NA	NA	NA	NA
WP_158392574.1\|2916105_2916459_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_158392576.1\|2916682_2918104_-\|protease	metalloprotease PmbA	NA	NA	NA	NA
WP_158392578.1\|2918169_2918856_+	DUF615 domain-containing protein	NA	NA	NA	NA
WP_158392580.1\|2918848_2919454_+	molybdopterin adenylyltransferase	NA	NA	NA	NA
WP_158392582.1\|2919823_2921032_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_158392584.1\|2921135_2922503_-	DUF1329 domain-containing protein	NA	NA	NA	NA
WP_012836612.1\|2922544_2923477_-\|transposase	IS5-like element ISAav2 family transposase	NA	NA	NA	NA
WP_158392586.1\|2923658_2923904_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_012836612.1\|2923918_2924851_+\|transposase	IS5-like element ISAav2 family transposase	NA	NA	NA	NA
WP_158392588.1\|2924808_2925738_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.4e-30	33.6
WP_158394331.1\|2926159_2927602_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_158394332.1\|2927758_2929702_-	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_158392590.1\|2930167_2930827_-	nitroreductase	NA	NA	NA	NA
WP_158392592.1\|2931090_2931945_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_158392594.1\|2931983_2932784_-	RNA methyltransferase	NA	NA	NA	NA
WP_158392596.1\|2933045_2933966_+	inositol monophosphatase	NA	NA	NA	NA
WP_158392598.1\|2934347_2937014_+	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	2.3e-25	20.2
WP_158392600.1\|2937063_2938044_+\|protease	proteasome-type protease	NA	NA	NA	NA
WP_158392602.1\|2938112_2939015_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_158392604.1\|2939142_2939967_-	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_158392606.1\|2940180_2940459_+	PsiF repeat protein	NA	NA	NA	NA
WP_158392608.1\|2940591_2941263_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_158394333.1\|2941377_2941743_+	hypothetical protein	NA	NA	NA	NA
WP_158392610.1\|2941762_2942086_-	hypothetical protein	NA	NA	NA	NA
WP_158392612.1\|2942150_2943710_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_158392614.1\|2943717_2946900_-	MMPL family transporter	NA	NA	NA	NA
WP_158392616.1\|2946896_2950112_-	MdtB/MuxB family multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	6.7e-56	21.2
WP_158392618.1\|2950136_2951798_-	MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_158392620.1\|2952073_2952457_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_158392622.1\|2952939_2953560_+	TRAP transporter small permease subunit	NA	NA	NA	NA
WP_158392624.1\|2953579_2955424_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_158392626.1\|2955493_2956816_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_158392628.1\|2956802_2957507_-	response regulator	NA	NA	NA	NA
WP_161598756.1\|2957867_2958581_+\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_158392632.1\|2958629_2959004_-	hypothetical protein	NA	NA	NA	NA
WP_161598757.1\|2959015_2959663_-	DUF1018 domain-containing protein	A4JWM5	Burkholderia_virus	2.9e-19	38.5
WP_158392636.1\|2959741_2960014_-	HU family DNA-binding protein	B5TA87	Burkholderia_phage	5.2e-18	55.6
WP_161598758.1\|2960072_2960231_-	hypothetical protein	NA	NA	NA	NA
WP_158392638.1\|2960227_2960482_-	hypothetical protein	NA	NA	NA	NA
WP_158392640.1\|2960478_2960913_-	hypothetical protein	A0A0U5KSG7	unidentified_phage	1.4e-12	41.7
WP_158392642.1\|2960909_2961539_-	DUF3164 family protein	A0A0A1IVF8	Pseudomonas_phage	1.0e-48	46.0
WP_158392644.1\|2961553_2961787_-	hypothetical protein	NA	NA	NA	NA
WP_158392646.1\|2961776_2962382_-	hypothetical protein	NA	NA	NA	NA
WP_158392648.1\|2962378_2962624_-	hypothetical protein	NA	NA	NA	NA
WP_158392650.1\|2962620_2962827_-	hypothetical protein	NA	NA	NA	NA
WP_161598759.1\|2962819_2964076_-	AAA family ATPase	Q6QIE1	Burkholderia_phage	6.2e-74	42.6
2963378:2963395	attL	NA	NA	NA	NA
WP_158394334.1\|2964083_2965868_-\|integrase	integrase	A4JWN2	Burkholderia_virus	2.9e-77	34.9
WP_158392654.1\|2966921_2967227_-	hypothetical protein	Q6QID7	Burkholderia_phage	7.1e-08	39.2
WP_158392656.1\|2967223_2967703_-	hypothetical protein	Q6QID6	Burkholderia_phage	5.3e-26	39.0
WP_158392657.1\|2967799_2968132_+	hypothetical protein	NA	NA	NA	NA
WP_158392659.1\|2968183_2968429_-	DNA-binding protein	Q6QID3	Burkholderia_phage	1.7e-12	51.9
WP_161598760.1\|2968589_2969069_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_158392663.1\|2969112_2969538_+	hypothetical protein	NA	NA	NA	NA
WP_158392665.1\|2969554_2969935_+	hypothetical protein	NA	NA	NA	NA
WP_158392667.1\|2970027_2970468_+	hypothetical protein	A4JWP3	Burkholderia_virus	1.6e-13	35.8
WP_158392669.1\|2970471_2971095_+	transglycosylase SLT domain-containing protein	J9SHG5	Pseudomonas_phage	8.8e-37	50.5
WP_158392671.1\|2971091_2971496_+	hypothetical protein	NA	NA	NA	NA
WP_158392673.1\|2971601_2971820_+	TraR/DksA family transcriptional regulator	A0A1L5C2A6	Pseudoalteromonas_phage	4.3e-07	76.5
WP_158392675.1\|2971826_2972132_+	DUF2730 family protein	NA	NA	NA	NA
WP_158392677.1\|2972141_2972435_+	ArsR family transcriptional regulator	J9SNG3	Pseudomonas_phage	1.0e-27	64.3
WP_158392679.1\|2972436_2972982_+	DUF3486 family protein	J9SH37	Pseudomonas_phage	1.2e-26	47.4
WP_158392681.1\|2972981_2974634_+	hypothetical protein	A0A219VH72	Ochrobactrum_phage	7.3e-107	46.1
WP_158392683.1\|2974800_2976393_+	DUF935 family protein	J9SVY0	Pseudomonas_phage	7.4e-173	61.0
2975418:2975435	attR	NA	NA	NA	NA
WP_158392685.1\|2976392_2977640_+	hypothetical protein	J9STS2	Pseudomonas_phage	5.3e-126	56.0
WP_158392687.1\|2977749_2978331_+	phage virion morphogenesis protein	J9SNH3	Pseudomonas_phage	2.8e-29	42.1
WP_158394335.1\|2978461_2979544_+	hypothetical protein	J9SH47	Pseudomonas_phage	7.0e-82	50.7
WP_158392689.1\|2979579_2979990_+	hypothetical protein	J9RWG0	Pseudomonas_phage	4.3e-32	59.8
WP_158392691.1\|2980020_2980911_+	hypothetical protein	A0A0M4UKB9	Ralstonia_phage	1.6e-95	57.6
WP_158392693.1\|2980949_2981234_+	hypothetical protein	NA	NA	NA	NA
WP_158394336.1\|2981245_2981782_+	DUF1320 family protein	J9SNI4	Pseudomonas_phage	2.3e-38	52.8
WP_158392695.1\|2981778_2982204_+	hypothetical protein	NA	NA	NA	NA
WP_158392697.1\|2982200_2982404_+	hypothetical protein	NA	NA	NA	NA
WP_158392699.1\|2982410_2983349_+	hypothetical protein	G8EY04	Synechococcus_phage	1.6e-42	36.9

DBSCAN-SWA_10

3174438 : 3230353

Ralstonia_phage(50.0%)

integrase,capsid,transposase

attL 3171493:3171508|attR 3219654:3219669

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3171493:3171508	attL	NA	NA	NA	NA
WP_158392986.1\|3174438_3175485_+\|capsid	phage capsid protein	NA	NA	NA	NA
WP_158394350.1\|3175654_3175939_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_158392988.1\|3176131_3177439_+	hypothetical protein	A0A0A8J8N7	Ralstonia_phage	1.1e-65	40.6
WP_158392990.1\|3177611_3178382_+	hypothetical protein	NA	NA	NA	NA
WP_158392992.1\|3178531_3178813_+	hypothetical protein	NA	NA	NA	NA
WP_161598767.1\|3178947_3179346_-	hypothetical protein	NA	NA	NA	NA
WP_161598768.1\|3179449_3180829_-	thiamine biosynthesis protein ThiF	NA	NA	NA	NA
WP_158392998.1\|3181243_3182389_-	hypothetical protein	NA	NA	NA	NA
WP_158393000.1\|3182392_3183907_-	SAVED domain-containing protein	NA	NA	NA	NA
WP_158393002.1\|3184180_3187336_-	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_158393004.1\|3187358_3188237_-	DUF4357 domain-containing protein	NA	NA	NA	NA
WP_158393006.1\|3188233_3189601_-	type I restriction endonuclease subunit S	NA	NA	NA	NA
WP_158393008.1\|3189597_3191343_-	N-6 DNA methylase	A0A220A2U4	Liberibacter_phage	4.1e-39	27.9
WP_158393010.1\|3191447_3191777_-	hypothetical protein	NA	NA	NA	NA
WP_158393012.1\|3192077_3192494_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_158394351.1\|3192486_3192879_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_158393014.1\|3192997_3194095_-	hypothetical protein	NA	NA	NA	NA
WP_158393016.1\|3194508_3194949_+	acetyltransferase	NA	NA	NA	NA
WP_158393018.1\|3195067_3195370_-	hypothetical protein	NA	NA	NA	NA
WP_158393020.1\|3195946_3197476_+	catalase	A0A2K9L0T1	Tupanvirus	1.7e-94	45.3
WP_158393022.1\|3198133_3198859_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003066676.1\|3198941_3199382_-	hypothetical protein	NA	NA	NA	NA
WP_158393024.1\|3199378_3199840_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_158393026.1\|3199853_3201119_-	NnrS family protein	NA	NA	NA	NA
WP_158393028.1\|3201111_3201516_-	group III truncated hemoglobin	NA	NA	NA	NA
WP_158393030.1\|3202308_3203094_-	hypothetical protein	NA	NA	NA	NA
WP_158389430.1\|3203977_3204973_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.2e-117	65.9
WP_158393034.1\|3205698_3206766_+	efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_158389430.1\|3206917_3207913_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.2e-117	65.9
WP_158393036.1\|3211087_3212332_+	TolC family protein	NA	NA	NA	NA
WP_158393038.1\|3212450_3212975_+	cytochrome b	NA	NA	NA	NA
WP_158393040.1\|3213534_3214365_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_161598769.1\|3214343_3214892_-	restriction endonuclease	NA	NA	NA	NA
WP_158393044.1\|3215126_3216104_-	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_158393046.1\|3216592_3216811_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_158393048.1\|3217185_3218304_-	hypothetical protein	NA	NA	NA	NA
WP_158393050.1\|3218290_3219487_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A077KET4	Ralstonia_phage	2.8e-92	46.9
WP_158393052.1\|3220442_3220775_-	hypothetical protein	NA	NA	NA	NA
3219654:3219669	attR	NA	NA	NA	NA
WP_158393054.1\|3220771_3222232_-	cytochrome P450	I6XF76	Cotesia_sesamiae_Mombasa_bracovirus	9.0e-24	23.3
WP_158393056.1\|3222228_3222615_-	hypothetical protein	NA	NA	NA	NA
WP_158394352.1\|3222592_3223387_-	Eco29kI family restriction endonuclease	NA	NA	NA	NA
WP_036514597.1\|3223585_3223789_+	hypothetical protein	NA	NA	NA	NA
WP_158393058.1\|3223782_3223974_+	hypothetical protein	NA	NA	NA	NA
WP_158393060.1\|3224278_3225175_+	mechanosensitive ion channel	NA	NA	NA	NA
WP_158388482.1\|3225424_3226720_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_158393062.1\|3226799_3227945_-	hypothetical protein	NA	NA	NA	NA
WP_158394353.1\|3227948_3229217_-	capsular biosynthesis protein	NA	NA	NA	NA
WP_158388626.1\|3229315_3230353_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-40	34.4

DBSCAN-SWA_11

3504484 : 3573787

Bacillus_phage(28.57%)

transposase,integrase,protease

attL 3536095:3536116|attR 3571127:3571148

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158393521.1\|3504484_3505945_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_158393523.1\|3506328_3507510_-	rod shape-determining protein RodA	NA	NA	NA	NA
WP_158393525.1\|3507690_3508275_+	esterase	NA	NA	NA	NA
WP_158393528.1\|3508440_3510513_+	RNB domain-containing ribonuclease	NA	NA	NA	NA
WP_158393530.1\|3510542_3511403_+	TonB family protein	NA	NA	NA	NA
WP_158393532.1\|3511561_3512428_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_158393534.1\|3512443_3513163_+	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
WP_158393536.1\|3513274_3513823_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_158393539.1\|3514037_3514466_-	hypothetical protein	NA	NA	NA	NA
WP_158393541.1\|3514845_3515769_-	UDP-3-O-acyl-N-acetylglucosamine deacetylase	NA	NA	NA	NA
WP_158393543.1\|3516021_3517215_-	cell division protein FtsZ	NA	NA	NA	NA
WP_158393546.1\|3517361_3518591_-	cell division protein FtsA	NA	NA	NA	NA
WP_158393548.1\|3518663_3519470_-	FtsQ-type POTRA domain-containing protein	NA	NA	NA	NA
WP_158393550.1\|3519466_3520438_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_158393552.1\|3520434_3521871_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_158393554.1\|3521867_3522953_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_158393556.1\|3522949_3524221_-	putative lipid II flippase FtsW	NA	NA	NA	NA
WP_158393558.1\|3524217_3526149_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_158393560.1\|3526154_3527333_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_158393562.1\|3527323_3528754_-	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_158393564.1\|3528750_3530256_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_158393566.1\|3530252_3532001_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_158393568.1\|3531997_3532279_-	cell division protein FtsL	NA	NA	NA	NA
WP_158393570.1\|3532319_3533249_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_158393572.1\|3533263_3533692_-	division/cell wall cluster transcriptional repressor MraZ	NA	NA	NA	NA
WP_158394373.1\|3534047_3535355_-\|protease	ATP-dependent protease ATPase subunit HslU	W6AS21	Erwinia_phage	2.9e-42	29.1
WP_158393574.1\|3535444_3535990_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
3536095:3536116	attL	NA	NA	NA	NA
WP_158393576.1\|3536186_3537917_-	STAS domain-containing protein	NA	NA	NA	NA
WP_158394374.1\|3537963_3538446_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_158393578.1\|3538960_3540091_-	GTP-binding protein	NA	NA	NA	NA
WP_158393580.1\|3540305_3541364_-\|integrase	tyrosine-type recombinase/integrase	A0A2D1G8E2	Mycobacterium_phage	8.8e-13	32.0
WP_158393582.1\|3541392_3542106_-	DUF484 family protein	NA	NA	NA	NA
WP_158393584.1\|3542102_3542981_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_158393586.1\|3543013_3543553_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_158393588.1\|3543650_3545414_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_158393590.1\|3545581_3546589_-	twin-arginine translocation pathway signal protein	NA	NA	NA	NA
WP_158393592.1\|3546695_3547463_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_158393594.1\|3547535_3549440_-	AMP-binding protein	NA	NA	NA	NA
WP_158393596.1\|3549477_3550260_-	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_158393598.1\|3550419_3552114_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_158393600.1\|3552180_3552948_+	RNA-binding protein	NA	NA	NA	NA
WP_158393602.1\|3553504_3554329_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_158393604.1\|3554422_3555322_+	EamA family transporter	NA	NA	NA	NA
WP_158393606.1\|3555376_3555595_-	hypothetical protein	NA	NA	NA	NA
WP_158393608.1\|3555716_3556637_+	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	4.7e-87	56.0
WP_158393610.1\|3556831_3558673_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.8e-29	27.9
WP_158393612.1\|3558844_3559111_+	DUF2164 family protein	NA	NA	NA	NA
WP_158393614.1\|3559171_3560416_+	exonuclease subunit SbcD	A0A0A0PQ58	Bacillus_phage	1.6e-05	28.9
WP_158393616.1\|3560412_3563898_+	AAA family ATPase	G3MAB6	Bacillus_virus	9.3e-11	26.9
WP_158389430.1\|3564009_3565005_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.2e-117	65.9
WP_158393618.1\|3565334_3566450_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_158393620.1\|3566566_3567139_+	TRAP transporter small permease subunit	NA	NA	NA	NA
WP_158393622.1\|3567135_3569079_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_158393624.1\|3569288_3571073_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_158393626.1\|3571194_3571734_+	VUT family protein	NA	NA	NA	NA
3571127:3571148	attR	NA	NA	NA	NA
WP_158393629.1\|3571820_3572387_+	hypothetical protein	NA	NA	NA	NA
WP_158393632.1\|3572426_3572804_-	BcpO-related WXXGXW repeat protein	NA	NA	NA	NA
WP_158393640.1\|3572914_3573787_-\|protease	protease HtpX	NA	NA	NA	NA

DBSCAN-SWA_12

3820693 : 3828903

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158393908.1\|3820693_3821434_-	uracil-DNA glycosylase	A0A0B5IW78	Pandoravirus	8.2e-42	45.3
WP_158393909.1\|3821606_3822008_+	transcriptional regulator	NA	NA	NA	NA
WP_158393910.1\|3822029_3822830_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.4e-63	52.5
WP_158393911.1\|3822980_3824015_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.1e-76	45.0
WP_158393912.1\|3824132_3824714_-	C26 family cysteine hydrolase domain-containing family	A0A0P0IKJ1	Acinetobacter_phage	1.7e-66	65.5
WP_158393913.1\|3824718_3825051_-	chorismate mutase	NA	NA	NA	NA
WP_158394386.1\|3825047_3826547_-	anthranilate synthase component I	A0A0B5J984	Pandoravirus	5.0e-38	31.0
WP_158393914.1\|3826989_3827595_+	hypothetical protein	NA	NA	NA	NA
WP_158393915.1\|3827616_3828903_-	polyamine aminopropyltransferase	A0A1D7SEZ2	Cyanophage	5.5e-09	36.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP044131

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection