CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP044056	Burkholderia multivorans strain FDAARGOS_622 chromosome 1, complete sequence	3 crisprs	DinG,csa3,cas3	1	1	1
NZ_CP044057	Burkholderia multivorans strain FDAARGOS_622 chromosome 2, complete sequence	0 crisprs	csa3	0	0	0
NZ_CP044058	Burkholderia multivorans strain FDAARGOS_622 chromosome 3, complete sequence	1 crisprs	WYL,cas3,DEDDh,csa3,DinG	0	0	240

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044056_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044056_1

549982-550155

Orphan

Consensus_repeat	Method
CGTCGTGCCCGACAGCGCGCC	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP044056_1

>merge|NZ_CP044056|1|549982-550155|PILER-CR
CGTCGGGCCCGACAGCGGGTTCGTCCCGCTCAGCACTTGCGCGCCCGTGCCGGCCAGCGTCAGCGGGCCGGTGCCCGACAGCGTGCCAGCGAACGTGCCGGTGCCCGCCGTGTTCACCGTCAGCGGCGTGCTGCCGAGGTTCACGTTCGAGCCCGTCGTGCCCGACAGCGCGCC

>NZ_CP044056|1|1|549982-550155|PILER-CR
CGTCGGGCCCGACAGCGGGTT	CGTCCCGCTCAGCACTTGCGCGCCCGTGCCGGCCAGCGTCAGCGGGCCGGTGC
CCGACAGCGTGCCAGCGAACG	TGCCGGTGCCCGCCGTGTTCACCGTCAGCGGCGTGCTGCCGAGGTTCACGTTCGAGCCCGTCGTGC
CCGACAGCGCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044056.1\|WP_006403410.1\|562309_564793_+\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	unknown	unknown	gnl\|CDD\|224446
NZ_CP044056.1\|WP_053298468.1\|565193_566213_-\|transglutaminase-family-protein	unknown	unknown	gnl\|CDD\|224224
NZ_CP044056.1\|WP_006403419.1\|539847_540936_+\|ionic-transporter-y4hA	unknown	unknown	gnl\|CDD\|223464
NZ_CP044056.1\|WP_035947906.1\|547542_547959_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044056.1\|WP_006396925.1\|541057_541966_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176138
NZ_CP044056.1\|WP_150331526.1\|569000_572432_-\|transglutaminase-family-protein	unknown	unknown	gnl\|CDD\|378297
NZ_CP044056.1\|WP_053298465.1\|572519_573503_-\|transglutaminase-family-protein	unknown	unknown	gnl\|CDD\|224224
NZ_CP044056.1\|WP_053298467.1\|566206_568813_-\|circularly-permuted-type-2-ATP-grasp-protein	unknown	unknown	gnl\|CDD\|379601
NZ_CP044056.1\|WP_006403420.1\|539666_539849_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044056.1\|WP_006403411.1\|561829_562288_+\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|224991
NZ_CP044056.1\|WP_053298473.1\|536407_537730_-\|phenylacetate--CoA-ligase	unknown	unknown	gnl\|CDD\|131210
NZ_CP044056.1\|WP_012216902.1\|576267_576594_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044056.1\|WP_150331525.1\|537779_539336_-\|3-hydroxyacyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|236211
NZ_CP044056.1\|WP_006396908.1\|573511_574453_-\|alpha-E-domain-containing-protein	unknown	unknown	gnl\|CDD\|377234
NZ_CP044056.1\|WP_006403417.1\|542531_543503_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP044056.1\|WP_125902435.1\|575904_576156_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044056.1\|WP_006403414.1\|545579_547367_+\|chloride-channel-protein	unknown	unknown	gnl\|CDD\|238233
NZ_CP044056.1\|WP_053298470.1\|543843_545043_+\|HPP-family-protein	unknown	unknown	gnl\|CDD\|225979
NZ_CP044056.1\|WP_035488112.1\|574515_575931_-\|circularly-permuted-type-2-ATP-grasp-protein	unknown	unknown	gnl\|CDD\|225190
NZ_CP044056.1\|WP_006396919.1\|545145_545559_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759

Protein	Function_ID	Function_description	E-value
NZ_CP044056.1\|WP_006403410.1\|562309_564793_+\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	gnl\|CDD\|224446	COG1529, CoxL, Aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL homologs [Energy production and conversion].	2.73908e-104
NZ_CP044056.1\|WP_053298468.1\|565193_566213_-\|transglutaminase-family-protein	gnl\|CDD\|224224	COG1305, COG1305, Transglutaminase-like enzymes, putative cysteine proteases [Amino acid transport and metabolism].	6.78287e-54
NZ_CP044056.1\|WP_006403419.1\|539847_540936_+\|ionic-transporter-y4hA	gnl\|CDD\|223464	COG0387, ChaA, Ca2+/H+ antiporter [Inorganic ion transport and metabolism].	7.59478e-77
NZ_CP044056.1\|WP_006396925.1\|541057_541966_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176138	cd08447, PBP2_LTTR_aromatics_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type regulator similar to CbnR which is involved in the regulation of chlorocatechol breakdown. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.19811e-98
NZ_CP044056.1\|WP_150331526.1\|569000_572432_-\|transglutaminase-family-protein	gnl\|CDD\|378297	pfam09899, DUF2126, Putative amidoligase enzyme (DUF2126). Members of this family of bacterial domains are predominantly found in transglutaminase and transglutaminase-like proteins. Their exact function is, as yet, unknown, but they are likely to act as amidoligase enzymes Protein in this family are found in conserved gene neighborhoods encoding a glutamine amidotransferase-like thiol peptidase (in proteobacteria) or an Aig2 family cyclotransferase protein (in firmicutes).	0
NZ_CP044056.1\|WP_053298465.1\|572519_573503_-\|transglutaminase-family-protein	gnl\|CDD\|224224	COG1305, COG1305, Transglutaminase-like enzymes, putative cysteine proteases [Amino acid transport and metabolism].	4.50788e-26
NZ_CP044056.1\|WP_053298467.1\|566206_568813_-\|circularly-permuted-type-2-ATP-grasp-protein	gnl\|CDD\|379601	pfam14403, CP_ATPgrasp_2, Circularly permuted ATP-grasp type 2. Circularly permuted ATP-grasp prototyped by Roseiflexus RoseRS_2616 that is associated in gene neighborhoods with a GCS2-like COOH-NH2 ligase, alpha/beta hydrolase fold peptidase, GAT-II -like amidohydrolase, and M20 peptidase. Members of this family are predicted to be involved in the biosynthesis of small peptides.	5.63507e-180
NZ_CP044056.1\|WP_006403411.1\|561829_562288_+\|(2Fe-2S)-binding-protein	gnl\|CDD\|224991	COG2080, CoxS, Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion].	9.30729e-74
NZ_CP044056.1\|WP_053298473.1\|536407_537730_-\|phenylacetate--CoA-ligase	gnl\|CDD\|131210	TIGR02155, Phenylacetate-coenzyme_A_ligase, phenylacetate-CoA ligase. Phenylacetate-CoA ligase (PA-CoA ligase) catalyzes the first step in aromatic catabolism of phenylacetic acid (PA) into phenylacetyl-CoA (PA-CoA). Often located in a conserved gene cluster with enzymes involved in phenylacetic acid activation (paaG/H/I/J), phenylacetate-CoA ligase has been found among the proteobacteria as well as in gram positive prokaryotes. In the B-subclass proteobacterium Azoarcus evansii, phenylacetate-CoA ligase has been shown to be induced under aerobic and anaerobic growth conditions. It remains unclear however, whether this induction is due to the same enzyme or to another isoenzyme restricted to specific anaerobic growth conditions. [Energy metabolism, Other].	0
NZ_CP044056.1\|WP_150331525.1\|537779_539336_-\|3-hydroxyacyl-CoA-dehydrogenase	gnl\|CDD\|236211	PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogenase; Validated.	0
NZ_CP044056.1\|WP_006396908.1\|573511_574453_-\|alpha-E-domain-containing-protein	gnl\|CDD\|377234	pfam04168, Alpha-E, A predicted alpha-helical domain with a conserved ER motif. An uncharacterized alpha helical domain containing a highly conserved ER motif and typically found as a tandem duplication. Contextual analysis suggests that it functions in a distinct peptide synthesis/modification system comprising of a transglutaminase, a peptidase of the NTN-hydrolase superfamily, an active and inactive circularly permuted ATP-grasp domains and a transglutaminase fused N-terminal to a circularly permuted COOH-NH2 ligase domain.	1.13167e-110
NZ_CP044056.1\|WP_006403417.1\|542531_543503_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.24626e-67
NZ_CP044056.1\|WP_006403414.1\|545579_547367_+\|chloride-channel-protein	gnl\|CDD\|238233	cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel. The ClC chloride channels catalyse the selective flow of Cl- ions across cell membranes, thereby regulating electrical excitation in skeletal muscle and the flow of salt and water across epithelial barriers. This domain is found in the halogen ions (Cl-, Br- and I-) transport proteins of the ClC family. The ClC channels are found in all three kingdoms of life and perform a variety of functions including cellular excitability regulation, cell volume regulation, membrane potential stabilization, acidification of intracellular organelles, signal transduction, transepithelial transport in animals, and the extreme acid resistance response in eubacteria. They lack any structural or sequence similarity to other known ion channels and exhibit unique properties of ion permeation and gating. Unlike cation-selective ion channels, which form oligomers containing a single pore along the axis of symmetry, the ClC channels form two-pore homodimers with one pore per subunit without axial symmetry. Although lacking the typical voltage-sensor found in cation channels, all studied ClC channels are gated (opened and closed) by transmembrane voltage. The gating is conferred by the permeating ion itself, acting as the gating charge. In addition, eukaryotic and some prokaryotic ClC channels have two additional C-terminal CBS (cystathionine beta synthase) domains of putative regulatory function.	1.09985e-100
NZ_CP044056.1\|WP_053298470.1\|543843_545043_+\|HPP-family-protein	gnl\|CDD\|225979	COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms].	8.6079e-136
NZ_CP044056.1\|WP_035488112.1\|574515_575931_-\|circularly-permuted-type-2-ATP-grasp-protein	gnl\|CDD\|225190	COG2308, COG2308, Uncharacterized conserved protein [Function unknown].	0
NZ_CP044056.1\|WP_006396919.1\|545145_545559_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	2.23592e-10

>NZ_CP044056.1|WP_035947906.1|547542_547959_-|hypothetical-protein
MPFLAPQVRHRRVARNTGRASTKTIGALSDAAQFVPRVISFTYGNSKIALQHSCAGADGLRVRRKRALIARFVLPGKVLAVAETSLSNGRTLAGRLRHPFFTSCASTNAPRSAIGQRDDRGDRDAACVAAMPRRAPDR
>NZ_CP044056.1|WP_006403414.1|545579_547367_+|chloride-channel-protein
MNAPHKRDFSTNERLPRIALLAAVIGLLSTLAAFVLLSLIHLFTNLFFFQQFSFADRSPAGNTLGAWVIVVPVIGALVVGLMARFGSEKIRGHGIPEAIEAILFGKSRMSPKVAVLKPLSSGIVIGSGGPFGAEGPIIMTGGALGSLIAQCVHVTAAERKTLLVAGAAAGMTAVFGTPVAAVLLAVELLLFEWRPRSFLPVALACAVAGFARALFFGVEPLFPLTTAAPSPVALLSCLVAGLLSGVLACGLSAALYRVEDTFAKLPVHWMWWPALGAIVIGVGGWLEPRALGVGYDVIGDLLHQHIALQIALALLVVKAVMWVIALGSGTSGGVLAPLLMLGAGLGTVLSPVLPGGDPALWPLVCMAATLGATLGAPLTAIVFAFGLTHDANALLPLLAATLVAHGFATVAMKRSIMTEKIARRGYHIYREYGVDPLERHDVGEVMTPADALVAIDGTATLEAVAAQFFGAQQTHRAYPVVQNGRLLGVVDRAFVDAQRAQRTPDTSIATALADRAPAIALAHETCRLVASRLAMLGLERLPVVDDPQSMRLTGIVSRSDLIKPALQHFDDEHKRERFRPIVPANLRDPGARKAG
>NZ_CP044056.1|WP_006396919.1|545145_545559_+|winged-helix-turn-helix-transcriptional-regulator
MTDSRRALTKSDFQQLSEFRYQMRRFERFSERAAQSEGVTPLQYLLLLHIKGYPHREWATIGELAERLQAQHHGVVALVTRCEALGLVKRKPSEADRRQVEVHLEPAGETLLARLAAMHRAELKSLKGAFQVPQIDY
>NZ_CP044056.1|WP_053298470.1|543843_545043_+|HPP-family-protein
MRPIFSTVTSMSSGSSPSRRTLRQWLHSFIPHPMTLGWRERLRSCTGALVGIATVGVTMRLLPGVPGLVPLLVAPMGASAVLLFAVPASPLAQPWSIIGGNLVAATVGVACAQWIADPITAAAVAIACAIGGMFVLRCVHPPSGAVALTAVVGGPAIHALGFGFVLEPILLQSTILLSAALAYHALTGHRYPHGSARGDAKPQAATPARGGFRREDLDAVLKRRSEWLDVDPDDLETLLRETEMQAYARTFGQLTCADLMTKNAISIAPSTSIAAALTLLDRHRVKALPVVDADGRLTGIVTRADLTRPQRRPAALWQRLSARLPESFGGQPPSVSTVMTRDVASVPQTLPLTALVPLFTHSGHHHIPVVDASRRLVGIITQTDLVTGLYQQTQLLEAA
>NZ_CP044056.1|WP_006403417.1|542531_543503_-|LysR-family-transcriptional-regulator
MDMLENMRLFVRVVEAGSFTAVAKEIDATTAQVSRAVSNLEAHVQTRLLHRTTRHLGLTESGERYFERAKSILAEIDYANAEARNALLRPSGKMRIHAMTGLGQSHVVSSIVRYQEDNPEVSVELTLAQRMPNLVEEGYDVSIVTASQLPDSGYVAQTCGTSCSVLVASRDYLARHGTPQTPDDLPNHVCLRLDTPASPASEWRLERADGEETVYELQPAPFQVNVPDALCVAVRAGRGIACVALYTVLDDIREGRLIRVLPEYRLQTVSVYAVYATRRYLDAKIRTFLDHLRTTLTPALENDLRELDRLTTEQAQSGGLKRA
>NZ_CP044056.1|WP_006396925.1|541057_541966_-|LysR-family-transcriptional-regulator
MIELHQLRCFVAVAEELHFGRAAKRLFMTQPPLSRQIQLLEHALGIALLERSSRQVSLTAAGERFLRDARHILEFSARAEQAAQRVAHGGAGRITLGFTAVSAYRMIPMLLAHAAHALPDVDVELREMVSTVQIDALASRMLDAGFVRQRAARQPLEYRLVQREPMLVAVAEGAPLAVHERIGPDDLDRQPFIAYSPNEGKYFHDMISGMFASAGRLPNYLHYVGQTHTILGLVRAGLGAALVPASARELHVDGVVFRPLADVDVAAELYLAWRTDNDNPALPVFNAMVERFLTESADGGIA
>NZ_CP044056.1|WP_006403419.1|539847_540936_+|ionic-transporter-y4hA
MPISSNQLPRWTLWAPLAAWLVLALSRVVPAEGLVIALFAAALAGAVFAAVHHAEVVAHRVGEPFGTLVLAVAVTVIEVALIVSVMLGAGPEKSGLARDTVFAAVMIICNGIVGLCLLVGAWKHGEQDFQGRGASKALAVLASLSVLSLVMPNYLSAAPGPMLSKSQLAFAGVSSLVLYGVFVFVQTVRHRDYFLADHDSANEAVHAAPPSGRTALISLALLFASLVAVVLLAKLLSPAVEHAVMKLGAPEAAVGIVIAALVLLPEGLAAVTAARANRLQTSMNLALGSALASIGLTIPTVAAVFIWVGQPLTLGIGPMETVLLALTLLVSTLTLSQGRTTVLHGVVHLSLFAAYLFLSVTH
>NZ_CP044056.1|WP_006403420.1|539666_539849_-|hypothetical-protein
MEGFLIRVATRDASPRVDEARPDNPPNEDDAAEGWRRGSVAEVCGREAATGAGGPEPVAG
>NZ_CP044056.1|WP_150331525.1|537779_539336_-|3-hydroxyacyl-CoA-dehydrogenase
MAVSSAHSTNPGALPLSAVVGVIGAGAMGAGIAQVAAAAGHTVLLYDLNEAACDKALAGIRAQFARLAEKGRLEPAEAEAAGGRIRAVRALADFAPAALIVEAAAGRLDVKREIFATLERHVDDACLLATNTSSISITSIAAGLRAPQRVAGLHFFNPAPLMALVEVVSGLATAPEVAQALYATAAAWGKKPVMAKSTPGFIVNRVARPYYAEALRVLNEQGGTPASIDAVLRDAGGFRMGPFELMDLIGHDVNFAVTESVFRAYFNDPRYTPSLIQQELVNAGFLGRKSGRGFYSYADGAAPPVAEVEPPRDAPVDVVLFAVDGPAAALHARLAERIAGARVQDAHPHELIATAGRASIALTDGRTATERAAQTGMADLVLVDLARDYTQAGVVALARALQCSDAAYADAVGLFQEAGFRVIGLGDVPGMIAMRTVAMLANEAADAVNQGVCSPADLDLAMEKGVNYPCGPLAWADAIGVGRVYRVLSNLAASYGEDRYRVSPRIAARHAAGRSLRA
>NZ_CP044056.1|WP_053298473.1|536407_537730_-|phenylacetate--CoA-ligase
MTYPTHPAAALEPIETASRDELQALQLERLKWSLRHAYDNVAHYRRTFDAAGVHPDDLKTLADLAKFPFSTKHDLRDNYPFGLFAVPREHVVRVHASSGTTGKPTVVGYTARDIDTWANVTARSIRAAGGRPGDTLHNAFGYGLFTGGLGIHYGAERLGCMVVPMSGGQTEKQVQLIRDFEPKIILVTPSYMLNLIDEMVRQGMDPAQSSLKIGIFGAEPWTQALREEVETRAGIDALDIYGLSEVMGPGVACECVETKDGPVIWEDHFYPEIVDPVTGEVLPDGSEGELVFTSLTKEAMPVIRYRTRDLTALLPPTARAMRRLAKITGRSDDMLIVRGVNVFPSQIEELVVAQPKLSGQFQITLSRDGHMDRLDLAVELRSEATASTTDGERAEIARALQHRIKTMIGVSAGVTVLAAGGIPASATGKARRVVDRRIAA
>NZ_CP044056.1|WP_006403411.1|561829_562288_+|(2Fe-2S)-binding-protein
MVTLNINNRRAEVDADPSTPVLWVLRDNLGLTGTKFGCGTGDCGACTVHVDGRPVHSCTLALSSVGSARITTSEHLADDAVGKAVLDAWLRHDVAQCGYCQSGQMMSAAGLLRSNKAPTDADIDSAMAGNLCRCATYQRIRAAIHDAARALA
>NZ_CP044056.1|WP_006403410.1|562309_564793_+|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit
MRIGTAGRPAHSDVVHAEASPEIGAAAPMPGRRGFLKLTMAASGCLALGIPPLRARAEAGAVLRSSPPQAFLIIAPDNTVTVAVNRTEAGQGVSTALPMALADELDADWRNVRTVLAPAGEPYKDPVTGIQMTGSSTSVNHSFTQYRELGASARAMLVAAAAQRWNVDPATCRTANGVVTSGNHRATYGELAPDAMAMPVPQHVTLKSPDQFRLIGKPTPRVDARSMLDGSLKYGMDWRLPDMMVAVVARPPRFGGQVASYNAAAARAVKGVVEVVEIPTARGGTGVAVIANGYWPAKLGRDALQVTWKDAGSTVSSAEQMQAYKQLAGTPGTVVRTADAGTAPAAATRIRTDYEFPYLAHAPMEPLSCTVDVGPASCACGIKIWGGSAMQTTDRAAVAKALAVAPEKVQIFTLTSGGDYGRRSTPTSDYVVEAAHVAAAYLAAGHLGPVKTIWTREDDLRGGYYRPMVLHRVDIGVDGSGGVRDWQHVVVGQSVLKGSPLAPATMRKGGTDPDLTDGVANNPYGFPMQLSVHQPDVDVPVQSWRSGGHTHTAFVMETLVDELAHAAHQDPVAYRMARLSGPEHARHREALALAVDKSGYGTRTLPAGHAWGVAMHETAGTVVAYVTEVSIQAQQPRVHRVTAGVYAGRIVNPTGAEAQIQGGALFGLATTKPGFAIDVDHGAVRNASFVDYPPVRMQEAAPVDVFFVPSDAHPTGLSEAGVPPIAPAVANGAFALTGQRMRALPFAPMLVASTAPTLPAAAEDDPYADLPAGGCRLPRKAKSAALTPKVNHSQAGVGQPSAVPKFLRPKRRAGIPCIDALKKGTVT
>NZ_CP044056.1|WP_053298468.1|565193_566213_-|transglutaminase-family-protein
MVTSKHTTKTPAGAVDATPPATADAAPGRLLRVTHDTEYRYAARVESAQHQARLQPLATPRQQLLAFSLDIEPAPESIGTEIDAFGNARASFALNQPHDALFVRSRSTVRVSAPAWSKGARGKPPQAIAHPAAAHATAWEAVRERLQFRAGQPYDAASEFVFASPHVPCDPALAAYAAASFTPGRPLVQAAWDLMRRIHADFAYTPNSTDITTTGLDALRLRKGVCQDFAHVMIGALRSLGLAARYVSGYLLTQPPPGQPRLIGADASHAWAAVYDPAWPEDGGWLQLDPTNDRAPGDDYVMLSIGRDYADVAPLRGVIRGGGAGQELKVAVTVEPLED
>NZ_CP044056.1|WP_053298467.1|566206_568813_-|circularly-permuted-type-2-ATP-grasp-protein
MPTLFDTGAHPDAAELAAALAAPAAAGRYDELRGSVAGLHAPALAPAWRSFFTAIGSDGVADLDRRADALQRRMRENGLFYQLHEQRAGDGAAGPWSLDLLPMIVTPEDWVAIERGVLQRVRLLNATMADLYGAQTILARGLLPPALVTGHPGYLRAMRGARVPGDTWLHVVAFDLARGPDGQWRMVAQHTQGAAGLGYLLENRLIVSRLFPRGFRGLRVQRLASAYRSLLQSLQALSPARRNSRIVLLTPGPHSATYFEHAYLARYLGLTLVEGGDLTARDNRVFLKTLRGLEPVHGILRRVDDAWLDPLELRPDSLLGVPGLLQAVRAGNVLLANAPGSGFLESPGMLGFMPRLAEAVLGETLTLPAVHSWWCGEAAACDDALPQLARSIVRPSYPADGASAGVQEPVIGARLTQAQLAEWRARILARPEQYTVQADLPLSQAPTWRTHGAPDGNGSARIVPKPLLLRVFALADGAQRWRLLPGGLSRVGTRDALFNAPMPRGGSTVDTWVMTEGIVDSTTLLQTRLGPDDLVERPRAIASRAAENLFWLGRYTERATNLMRLARAALERLRGEDDVESPAHLELIDALCRDTGLVAADAPNAVDAPGAFQHALATSLTRGADRTSGIAACLFGMRGAAAAIRERLSSDQWRLIDDATQLFADSADHPEAEEQIGNEALQLLERLGLLLGAITGAQTDNMTRDDGWRLLSIGRQIDRLDFLCSVLRFAFDGGAVHRQDGFELVLELFDSTITFRSRFQRGFDVAPLLSLVVLDTDNPRSLGWVVQALRGRLTKVERSEGYALSELAETIPDVAAWSLHELCETGDDGRHEALLAALDATAKAVWELSNRIGERYFSHVREAGRALW
>NZ_CP044056.1|WP_150331526.1|569000_572432_-|transglutaminase-family-protein
MPIHVALHHATRYRYDRLVNLGPQVVRLRPAPHCRTPIVAYSMTVEPARHFINWQQDPFSNHLARLVFPERTDHFDITIDLVAEMSVYNPFDFFLESSAEQYPFSYDDALKVELAPYLACDPQTSASPAFRAYLDGVDRTPAGTVNFLVALNQRLQRDIRYLVRMEPGVQTPAQTLELGSGSCRDSGWLLVQLCRHLGIAARFVSGYLIQLAPDQKSLDGPSGTSVDFTDLHAWCEVYLPGAGWIGFDPTSGLLAGEGHIPLACTPQPTSAAPVDGLIDECEVAFEHEMTVTRVYESPRVTKPYSDAQWQAVRALGTQVDSALAAGDVRLTQGGEPTFVSIDDRDGAEWNTDALGPTKRGYATALVQRLRAEYGRGGFLHVGQGKWYPGEQLPRWAMSIFWRADGEPVWDDPSLFADEREPSALGTADAKRFIDALAARLGLSGEFIRPGYEDVWYYLWRERRLPVNVDPFDSRVDDELERARLRNVFDRRLDSVVGYVLPIRRADGTPPLDGARWQTGPWFFRDERMYLVPGDSPMGYRLPLDSLPWVAAGDYPHLYERDPFAPTEALPDAAALRARYGGPAAWADPGAAPRYVPGVHREAQAQTVMQWRDDGKRDDTQGAQDARASRYPERFESAAWVTRTALCAQVRDGILYLFMPPLAALDDYLHLLAAIEATAQALGVKLVLEGYPPPRDARLKMLQVTPDPGVIEVNVHPAANFDDLVAQTEFLYDAAWQSRLSSEKFMVDGRHVGTGGGNHVVLGGATPADSPFLRRPDLLASLIAYWLNHPSLSYLFSGLFIGPTSQAPRVDEARNDQLYELDIAFAAIRRHVQGGEPTPPWLVDRVLRNLLIDVTGNTHRSEFCIDKLYSPDSPTGRLGLLELRAFEMPPHARMSIVQQLLLRALIARFWAAPYTTPLTRWGTALHDRFMLPAFVKMDFDDVLNELRDSGFAFDAAWFAPHFEFRFPLFGKIAVNGMQLTLRGALEPWHVMGEEGAVGGTVRYVDSSVERLEVRVTGLNDNRHVVTVNGRALPLQPTGTAGEYVAGVRYKAWSPPSALHPTLGVDAPLTFDVVDTWLQRSLGGCRYHVAHPGGRNYATFPVNAYEAESRRLARFVGMGHTPGRMDVAAAAPSREFPFTLDLRRP
>NZ_CP044056.1|WP_053298465.1|572519_573503_-|transglutaminase-family-protein
MRLAIRHISRYQFDERATHALQRLRLRPQSGPGQTVRAWQVTIDGAEPTLSYADGLGNRIDLVRHDRGAKPEIVVVAAGVVETQDRAGIVGDPDGYAPPWLFERDTVLTKAGDVVRALAGALPLEPRSLDALHWLMTAVHERIAYAPDGTDTPVDAETALQSGEGTSRDHAHAFIAAARALKIPARFVSGYVLADGAMQRVADAKQNAGGEREKALALQIGDGMQQVLGASHAGQSQSQGPAHAQAALDARPQPVALMQPPAGHAWAEAHVDGLGWVGFDPFMNRCPDERYVRIAVGLDCRDAQPVTGIGAIAVGVDISVAQSPELV
>NZ_CP044056.1|WP_006396908.1|573511_574453_-|alpha-E-domain-containing-protein
MLLGRTASGLYWMYRYIERAENIARIVDAGLRMALTRTSDAPAEWSSVLVSSGADHGYRQKYDAYAADTVTDYLLRDRDNPSSVLSCIDAARSNARMVRTALTREAWESVNGAWLALRRAFAQPVPESALPAVLDEVKRETAMILGSFYSTMLRNEIFDFAQIGAFVERADNTARILDVKYHLLLPSVSHVGTILDNYQWETILRCVAAHRSYRWVYDVQYKPVNIADYLILNGRMPRSLRYCYGRVVSSLNLLAKDYGVTHPCHDTAAKILQMLSDTSVERIFKSGLHEFLTDFIGRNNNLGVDIAEAYNFD
>NZ_CP044056.1|WP_035488112.1|574515_575931_-|circularly-permuted-type-2-ATP-grasp-protein
MKPFDEMLQSGDTVRLPYARLKQWLDTQNPASLAQKAHDAEGVFRRTGITFAVYGDAEAAERLIPFDIVPRIISGAEWNRLSLGIEQRVMALNAFLDDIYHRQEIVRAGIVPKHLIAHNDAFLPEMIDFRPPGNVYTHIIGVDIVRTGENDFYVLEDNARTPSGVSYMLENRETMMQLFPELFQQVKVRPVETYPQMLRQSLAAVCPPGGNADNPTVAVLTPGIHNSAYYEHSFLADQMGVHLVEGSDLQVIDGRVAMRTTEGFQPIDVLYRRVDDAFLDPLTFRADSVLGVAGIMDVYRAGNITIANAPGTGIADDKAIYSYMPEIVEFYTGRKALLQNVPTWRCGDADSLKYVLDHLDELVVKEVHGSGGYGMLVGPCASKAELDAFATKLRVRPANYIAQPTLALSTTPILTEAGLAPRHVDLRPFVLVSDRIRITPGGLTRVALKEGSLVVNSSQGGGTKDTWVLAD
>NZ_CP044056.1|WP_125902435.1|575904_576156_+|hypothetical-protein
MQHFIERFHRLVLHRSAGITHAGPAYTVPCKERAFRIPRFRAASAPPGMPPHHGGAAFAAKRRIDAPRSRTRACIAAGILQAR
>NZ_CP044056.1|WP_012216902.1|576267_576594_+|hypothetical-protein
MKYLPLIALTVAISAHAAGPAVQNVGQSQKPAEDVSACIAKTWADKSQQQVISQNVLANGLATDVYVPGQQPPNGAAAMVRPSWQAGAKTWVGLRGDAAAAGDINACL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044056_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044056_2

1243925-1244361

Orphan

Consensus_repeat	Method
GCACCGGCGATTCACTAGCGG	CRT

6 spacers

The CRISPR arrays of NZ_CP044056_2

>merge|NZ_CP044056|2|1243925-1244361|CRT
GCACTGGCGATTCACTGGCGGGGACGATCCCGTTGGGACTGGCGACCGCTGGCCACCTCGATCGCGTTAGCACCGGCGATGCACTAGCGGCGACCATCCCGCTGGCAGTGGCGATTCACTCGCGGCGATGATCCCACTGGCACCGGCCATTCACTAGCGGGGACGATCCCGTTGGGACTGGCGGCCGCTGGCCACCTCGCTCGCGTTAGCACCGGCGATGCACTAGCGGCGACCATCCCGCTGGCAGTGGCGATTCACTCGCGGCGATGATCCCACTGGCACTGGCGATTCACTAGCGGGGACGATCCCGTTGGGACTGGCGGCCGCTGGCTACCTCGCTCGCATTCGCACCGGCGATTCACTAGCGGCGACGATCCCATTGGTACCGGCGACCGCGGGCCACCTCGACCGCGTTCGCACCGGCGATTCACTGGCGC

>NZ_CP044056|2|1|1243925-1244361|CRT
GCACTGGCGATTCACTGGCGG	GGACGATCCCGTTGGGACTGGCGACCGCTGGCCACCTCGATCGCGTTA
GCACCGGCGATGCACTAGCGG	CGACCATCCCGCTGGCAGTGGCGATTCACTCGCGGCGATGATCCCACTG
GCACCGGCCATTCACTAGCGG	GGACGATCCCGTTGGGACTGGCGGCCGCTGGCCACCTCGCTCGCGTTA
GCACCGGCGATGCACTAGCGG	CGACCATCCCGCTGGCAGTGGCGATTCACTCGCGGCGATGATCCCACTG
GCACTGGCGATTCACTAGCGG	GGACGATCCCGTTGGGACTGGCGGCCGCTGGCTACCTCGCTCGCATTC
GCACCGGCGATTCACTAGCGG	CGACGATCCCATTGGTACCGGCGACCGCGGGCCACCTCGACCGCGTTC
GCACCGGCGATTCACTGGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044056.1\|WP_006397206.1\|1256491_1257352_-\|2-aminoethylphosphonate-ABC-transport-system,-membrane-component-PhnV	unknown	unknown	gnl\|CDD\|132299
NZ_CP044056.1\|WP_006406892.1\|1260470_1260698_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044056.1\|WP_006410336.1\|1229839_1231516_-\|peptidase-S1	unknown	unknown	gnl\|CDD\|225490
NZ_CP044056.1\|WP_035488991.1\|1240536_1241445_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176132
NZ_CP044056.1\|WP_006406895.1\|1257341_1258262_-\|2-aminoethylphosphonate-ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|237888
NZ_CP044056.1\|WP_105775558.1\|1258239_1259334_-\|2-aminoethylphosphonate-ABC-transport-system-ATP-binding-subunit-PhnT	unknown	unknown	gnl\|CDD\|132302
NZ_CP044056.1\|WP_053298205.1\|1241532_1243122_+\|inorganic-phosphate-transporter	unknown	unknown	gnl\|CDD\|376541
NZ_CP044056.1\|WP_053298200.1\|1253177_1253729_-\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|132319
NZ_CP044056.1\|WP_053298203.1\|1245647_1247072_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182502
NZ_CP044056.1\|WP_006409251.1\|1234124_1234589_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP044056.1\|WP_006406897.1\|1253733_1255188_-\|phosphonoacetaldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|132294
NZ_CP044056.1\|WP_006402851.1\|1234655_1235570_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP044056.1\|WP_006405922.1\|1231588_1233178_-\|S8/S53-family-peptidase	unknown	unknown	gnl\|CDD\|173788
NZ_CP044056.1\|WP_053298196.1\|1259377_1260469_-\|2-aminoethylphosphonate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|237887
NZ_CP044056.1\|WP_006402855.1\|1233366_1233990_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP044056.1\|WP_006402847.1\|1236716_1238057_+\|MHS-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP044056.1\|WP_006402845.1\|1238115_1240410_-\|5-methyltetrahydropteroyltriglutamate---homocysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|235367
NZ_CP044056.1\|WP_006402848.1\|1235708_1236665_+\|agmatinase	unknown	unknown	gnl\|CDD\|212538
NZ_CP044056.1\|WP_053298198.1\|1255184_1256495_-\|phosphonoacetate-hydrolase	unknown	unknown	gnl\|CDD\|131388
NZ_CP044056.1\|WP_053298204.1\|1244810_1245554_+\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|378278

Protein	Function_ID	Function_description	E-value
NZ_CP044056.1\|WP_006397206.1\|1256491_1257352_-\|2-aminoethylphosphonate-ABC-transport-system,-membrane-component-PhnV	gnl\|CDD\|132299	TIGR03255, PhnV, 2-aminoethylphosphonate ABC transport system, membrane component PhnV. This membrane component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.	3.84996e-99
NZ_CP044056.1\|WP_006410336.1\|1229839_1231516_-\|peptidase-S1	gnl\|CDD\|225490	COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism].	5.91854e-104
NZ_CP044056.1\|WP_035488991.1\|1240536_1241445_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176132	cd08441, PBP2_MetR, The C-terminal substrate binding domain of LysR-type transcriptional regulator metR, which regulates the expression of methionine biosynthetic genes, contains type 2 periplasmic binding fold. MetR, a member of the LysR family, is a positive regulator for the metA, metE, metF, and metH genes. The sulfur-containing amino acid methionine is the universal initiator of protein synthesis in all known organisms and its derivative S-adenosylmethionine (SAM) and autoinducer-2 (AI-2) are involved in various cellular processes. SAM plays a central role as methyl donor in methylation reactions, which are essential for the biosynthesis of phospholipids, proteins, DNA and RNA. The interspecies signaling molecule AI-2 is involved in cell-cell communication process (quorum sensing) and gene regulation in bacteria. Although methionine biosynthetic enzymes and metabolic pathways are well conserved in bacteria, the regulation of methionine biosynthesis involves various regulatory mechanisms. In Escherichia coli and Salmonella enterica serovar Typhimurium, MetJ and MetR regulate the expression of methionine biosynthetic genes. The MetJ repressor negatively regulates the E. coli met genes, except for metH. Several of these genes are also under the positive control of MetR with homocysteine as a co-inducer. In Bacillus subtilis, the met genes are controlled by S-box termination-antitermination system. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.86438e-104
NZ_CP044056.1\|WP_006406895.1\|1257341_1258262_-\|2-aminoethylphosphonate-ABC-transporter-permease-subunit	gnl\|CDD\|237888	PRK15050, PRK15050, 2-aminoethylphosphonate transport system permease PhnU; Provisional.	1.68398e-139
NZ_CP044056.1\|WP_105775558.1\|1258239_1259334_-\|2-aminoethylphosphonate-ABC-transport-system-ATP-binding-subunit-PhnT	gnl\|CDD\|132302	TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.	1.12869e-176
NZ_CP044056.1\|WP_053298205.1\|1241532_1243122_+\|inorganic-phosphate-transporter	gnl\|CDD\|376541	pfam01384, PHO4, Phosphate transporter family. This family includes PHO-4 from Neurospora crassa which is a is a Na(+)-phosphate symporter. This family also contains the leukaemia virus receptor.	5.6639e-53
NZ_CP044056.1\|WP_053298200.1\|1253177_1253729_-\|HD-domain-containing-protein	gnl\|CDD\|132319	TIGR03276, Phn-HD, phosphonate degradation operons associated HDIG domain protein. This small clade of proteins are found adjacent to other genes implicated in the catabolism of phosphonates. They are members of the TIGR00277 domain family and contain a series of five invariant histidines (the domain in general has only four).	3.69201e-90
NZ_CP044056.1\|WP_053298203.1\|1245647_1247072_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|182502	PRK10504, PRK10504, putative transporter; Provisional.	2.40115e-82
NZ_CP044056.1\|WP_006409251.1\|1234124_1234589_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	6.39461e-43
NZ_CP044056.1\|WP_006406897.1\|1253733_1255188_-\|phosphonoacetaldehyde-dehydrogenase	gnl\|CDD\|132294	TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase. This family of genes are members of the pfam00171 NAD-dependent aldehyde dehydrogenase family. These genes are observed in Ralstonia eutropha JMP134, Sinorhizobium meliloti 1021, Burkholderia mallei ATCC 23344, Burkholderia thailandensis E264, Burkholderia cenocepacia AU 1054, Burkholderia pseudomallei K96243 and 1710b, Burkholderia xenovorans LB400, Burkholderia sp. 383 and Polaromonas sp. JS666 in close proximity to the PhnW gene (TIGR02326) encoding 2-aminoethyl phosphonate aminotransferase (which generates phosphonoacetaldehyde) and PhnA (TIGR02335) encoding phosphonoacetate hydrolase (not to be confused with the alkylphosphonate utilization operon protein PhnA modeled by TIGR00686). Additionally, transporters believed to be specific for 2-aminoethyl phosphonate are often present. PhnW is, in other organisms, coupled with PhnX (TIGR01422) for the degradation of phosphonoacetaldehyde (GenProp0238), but PhnX is apparently absent in each of the organisms containing this aldehyde reductase. PhnA, characterized in a strain of Pseudomonas fluorescens that has not het been genome sequenced, is only rarely found outside of the PhnW and aldehyde dehydrogenase context. For instance in Rhodopseudomonas and Bordetella bronchiseptica, where it is adjacent to transporters presumably specific for the import of phosphonoacetate. It seems reasonably certain then, that this enzyme catalyzes the NAD-dependent oxidation of phosphonoacetaldehyde to phosphonoacetate, bridging the metabolic gap between PhnW and PhnA. We propose the name phosphonoacetaldehyde dehydrogenase and the gene symbol PhnY for this enzyme.	0
NZ_CP044056.1\|WP_006402851.1\|1234655_1235570_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	5.68343e-38
NZ_CP044056.1\|WP_006405922.1\|1231588_1233178_-\|S8/S53-family-peptidase	gnl\|CDD\|173788	cd04056, Peptidases_S53, Peptidase domain in the S53 family. Members of the peptidases S53 (sedolisin) family include endopeptidases and exopeptidases sedolisin, kumamolysin, and (PSCP) Pepstatin-insensitive Carboxyl Proteinase. The S53 family contains a catalytic triad Glu/Asp/Ser with an additional acidic residue Asp in the oxyanion hole, similar to that of Asn in subtilisin. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values. Characterized sedolisins include Kumamolisin, an extracellular calcium-dependent thermostable endopeptidase from Bacillus. The enzyme is synthesized with a 188 amino acid N-terminal preprotein region which is cleaved after the extraction into the extracellular space with low pH. One kumamolysin paralog, kumamolisin-As, is believed to be a collagenase. TPP1 is a serine protease that functions as a tripeptidyl exopeptidase as well as an endopeptidase. Less is known about PSCP from Pseudomonas which is thought to be an aspartic proteinase.	7.04876e-120
NZ_CP044056.1\|WP_053298196.1\|1259377_1260469_-\|2-aminoethylphosphonate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|237887	PRK15046, PRK15046, 2-aminoethylphosphonate ABC transporter substrate-binding protein; Provisional.	0
NZ_CP044056.1\|WP_006402855.1\|1233366_1233990_-\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	4.35552e-36
NZ_CP044056.1\|WP_006402847.1\|1236716_1238057_+\|MHS-family-MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.30453e-136
NZ_CP044056.1\|WP_006402845.1\|1238115_1240410_-\|5-methyltetrahydropteroyltriglutamate---homocysteine-S-methyltransferase	gnl\|CDD\|235367	PRK05222, PRK05222, 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase; Provisional.	0
NZ_CP044056.1\|WP_006402848.1\|1235708_1236665_+\|agmatinase	gnl\|CDD\|212538	cd11592, Agmatinase_PAH, Agmatinase-like family includes proclavaminic acid amidinohydrolase. This agmatinase subfamily contains bacterial and fungal/metazoan enzymes, including proclavaminic acid amidinohydrolase (PAH, EC 3.5.3.22) and Pseudomonas aeruginosa guanidinobutyrase (GbuA) and guanidinopropionase (GpuA). PAH hydrolyzes amidinoproclavaminate to yield proclavaminate and urea in clavulanic acid biosynthesis. Clavulanic acid is an effective inhibitor of beta-lactamases and is used in combination with amoxicillin to prevent the beta-lactam rings of the antibiotic from hydrolysis and, thus keeping the antibiotic biologically active. GbuA hydrolyzes 4-guanidinobutyrate (4-GB) into 4-aminobutyrate and urea while GpuA hydrolyzes 3-guanidinopropionate (3-GP) into beta-alanine and urea. Mutation studies show that significant variations in two active site loops in these two enzymes may be important for substrate specificity. This subfamily belongs to the ureohydrolase superfamily, which includes arginase, agmatinase, proclavaminate amidinohydrolase, and formiminoglutamase.	3.75541e-173
NZ_CP044056.1\|WP_053298198.1\|1255184_1256495_-\|phosphonoacetate-hydrolase	gnl\|CDD\|131388	TIGR02335, phosphonoacetate_hydrolase, phosphonoacetate hydrolase. This family consists of examples of phosphonoacetate hydrolase, an enzyme specific for the cleavage of the C-P bond in phosphonoacetate. Phosphonates are organic compounds with a direct C-P bond that is far less labile that the C-O-P bonds of phosphate attachment sites. Phosphonates may be degraded for phosphorus and energy by broad spectrum C-P lyase encoded by large operon or by specific enzymes for some of the more common phosphonates in nature. This family represents an enzyme from the latter category. It may be found encoded near genes for phosphonate transport and for pther specific phosphonatases.	0
NZ_CP044056.1\|WP_053298204.1\|1244810_1245554_+\|2OG-Fe(II)-oxygenase	gnl\|CDD\|378278	pfam09859, Oxygenase-NA, Oxygenase, catalyzing oxidative methylation of damaged DNA. This family of bacterial sequences is predicted to catalyze oxidative de-methylation of damaged bases in DNA.	3.9699e-126

>NZ_CP044056.1|WP_053298205.1|1241532_1243122_+|inorganic-phosphate-transporter
MNQPAPSAANQGSVERTRQIGYAAFLLVLVGGGVYIATHLLADLAPVREGSLFPYLMLGAALLIALGFEFVNGFHDTANAVATVIYTHSLTPNVAVIWSGMWNFLGVMVSSGAVAFGILQLLPVELILQVGSGAGFAMVFALLIAAIVWNLATWYFGLPSSSSHTLIGSIIGVGLMNQLMHGSSGTSGVDWGQALGVGKSLLFSPIVGFVCAALLLLALKAVVRIPELYSEPQKDQPPPFWIRCLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYALNKAVTPAESQTFVAVANQAAATLGKYANGVAPSANPRADVEHYVQHRELTPAVIPAVQQLSRSLAGAVGSSGSMAAVPQGDVDNVRNTMYLVSEAIRLIEKSGQPAFAADDKLAIDNYRSQLDHATKFIPTWVKVAVAIALGLGTMVGWKRIVVTVGEKIGKQHLTYGQGASAELVAMLTIGAADAYGLPVSTTHVLSSGVAGTMAANGSGLQWGTVRSLVLAWVLTLPASIVLAGALYWLFRSLA
>NZ_CP044056.1|WP_035488991.1|1240536_1241445_+|LysR-family-transcriptional-regulator
MLERFHLVVIREVERQGSLTAAANALHLTQSALSHTVKKLEQQLGTPIWDREGRGLRLTQGGQYLLRLAHRLLPQFEFAEERMKQYAKGERGTLRIGMECHPCYQWLLKVVSPYLSRWPDVDVDVKQRFQFGGIGALFSYDIDVLVTPDPLNKPGLRFDPVFDYEQVLVVADAHRFARADYVTPEQLVDEVLITYPVETDRLDIYNQFLTPAGIVPRRHKSIETTDIMLQMVASGRGVAALPRWLADEYADRMPVVPVKLGKKGIAKQIFLGIREADAQIDYLAAFVALARESTWHAPRLLR
>NZ_CP044056.1|WP_006402845.1|1238115_1240410_-|5-methyltetrahydropteroyltriglutamate---homocysteine-S-methyltransferase
MVTTHNLGFPRIGAKRELKFGLERYWNGESSRDELTALGAALRRQHWNDQRGLDLVPIGDFAFYDQVLDMSFTLGNLPKRVRDFHGDPLDNYFRVARGRSAQSADAHAACCGGVAAGEMTKWFDTNYHYIVPEFHADTNFSLDPSRLLQHLAEARAAGVTAKPVILGPVTYLWLGKSKDDSDRLALLPKLLPVYGALLDTLTAQGVEWVQVDEPILVTELDAEWRHALRTAYAALETRRIKLLLATYFGELQDNLTLAASLPVDGLHVDAINARDEIAAVVRELPADRVLSVGAINGRNIWKTDLNATLDWLEPLAKQLGDRLWLAPSCSLLHVPVDLASEDRLDADIRSWLAFALQKLDELKVLATALNEGRDKVADALAANAAAIDSRRRSPRVHNAAVKDAIARIDARLGDRASPYPQRAAKQAAQLNLPAFPTTTIGSFPQTAEIRHARSRFKAGTLDEAGYRAAMRAEIERSVREQESLELDVLVHGEAERNDMVEYFGEQLDGFAFSRFGWVQSYGSRCVKPPILFGDISRPKAMTVEWIAYAQSLTHKPMKGMLTGPVTILNWSFVRDDQPRSVSCRQLALAIRDEVLDLEKAGVRVIQIDEAALREGLPLRRSQWSAYLQWAVESFRIAANGVRDDTQIHTHMCYSEFNDIIASIADMDADVITIETSRSDMELLDAFDSFRYPNEIGPGVYDIHSPNIPTQDHIVALMKKAAERIPADRLWVNPDCGLKTRRWEEVIPALANMVAAAKTLRAQQR
>NZ_CP044056.1|WP_006402847.1|1236716_1238057_+|MHS-family-MFS-transporter
METSVKQPKRAALASFVGTTIEWYDFYSYATAAAIVFGPLFFPGENRFVSLLASFGSFAVGFFARPFGGVLFGYLGDRFGRKRSLLATLMLMAVSTVAIGLLPTYATAGMLAPILLVLMRVLQGIAVGGEWGGAVLLAGEHAPAGKRTFFASFAQLGSASGLILSMLAFGAISTLPKEDLMSWGWRLPFLASAVLLAVGFVIRASVSESPEFEEVRKSGDTARNPVREALKYWPLLLLAIGANVYGIAGVYFSNIFMISYATQFLSLDRSMVLHCMTIVAVLQFVVQLAAAFFAQRFGTTRVLLITGAWAAIVPFVMLPLVHVGTPLSITVGVGLATLAESGYYSVVAGFVSGIFVARIRYTAISIAYQVCGALAGGLTPLVATIIAQNTAPQWWPLAIQYTSAAVLSSLCVWLISRRVSIDDAGSSAKDVDALPRAGAHTAARTA
>NZ_CP044056.1|WP_006402848.1|1235708_1236665_+|agmatinase
MNDHTHFQPLGGNEMPRCGGIATMMRLPHVASAAGLDACFVGVPFDLGTSNRTGARFGPRQIRTESVLLRPYNMATRAAPFDSLQIADIGDVAINPYNLHDSIARIEAAYDAILEHDCKPITLGGDHTIALPILRAIHRKHGKVALIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLHGDKVTQIGLRGTGYAAEDFDWCREQGFRVVQAEECWNKSLVPLMDEVRERVGDTPVYISFDIDGIDPAYAPGTGTPEIAGLTVPQALEIIRGARGLNIVGCDLVEVAPPYDPFGTTALLGANLAYELLCVLPGVAYRD
>NZ_CP044056.1|WP_006402851.1|1234655_1235570_-|LysR-family-transcriptional-regulator
MLGNLSTLDLRLIRVFLAVTDAGGVSAAQAVLNVGQSTISAQLSSLETRLGYRLCERGRSGFRLTPKGERFHAMSRKLLAALDEFGMAARHMDRQLVGTLNIGLIGHTPVSQNARIAEAIAAFRTRDEAVRFSISVRAPGDLEEKLLSDEIQIAVGYFWHRVPSLEYTPLFVERQVAYCGRGHPLFARAGTLTPEDVAGFEWAWRSYPLPEAQMSTTPDRVTATADNMEAVALLILSGHHLGYLPQHFAAPYVAQGLLAPLDPERLRYDVTFHMVVARSGRGNPLVEAFLEDLERAHHTPDTPA
>NZ_CP044056.1|WP_006409251.1|1234124_1234589_+|Lrp/AsnC-family-transcriptional-regulator
MTELDKTDRAILAAVQRDGRLSIARLADSVGLSETPCARRLKRLENDGYIERYRAQLSRKALGFGVVSFVLVRFATHDRKVADRFEREVLGIERILSCHNVAGTADYLLQIVARDLDDYGTFLRDSLRMLPGVTSIESALSLREVKHDAGLPVP
>NZ_CP044056.1|WP_006402855.1|1233366_1233990_-|LysE-family-translocator
MISTHLLFIYLAALAAIYAVPGPDMALVLQTSIGRGVRPGIAAAAGLSLSRSAHVTLSACGVAALIRGAPWLYEAIRYGGALYLGYVAIQVFRSPVFDVGNGDAAAAGELRQSFVKGLLTNLLNPKALLFCSVLLPQFVRPEAGPVVWQMFALGALLVAAGVCFDLACVFGASRIAAWMRAHPLAQTVQRWTFSAALLGFALRLSMD
>NZ_CP044056.1|WP_006405922.1|1231588_1233178_-|S8/S53-family-peptidase
MARHLHADREPRIVADSKCLGPCDPAERIHVTIMLRRQEEGQLDTLLQRLASGDPQANPLSRDAFAQRFSASPDDIRKTEDFARRHQLTVDRVDPAESVVVLSGTIKQFETAFGVTLERFEHHAIGQYRGRSGPIALPDELGDAVTAVLGLDSRPQARPHFRLRPPFKPARGAASVTFTPPQLASLYGFPAGDGAGQCIAIVELGGGYRAADIARYFSGLGIKTPPTLVDVNVGTGRNAPTGDPNGPDGEVALDIEIAGAIAPAAKIAVYFAPNSDAGFIQAVNAAVNDTKNKPSVISISWGGPEAIWQAQSAQAFNRVLQAAAAQGITVCAASGDSGSGDGLQDGADHVDFPASSPYVLGCGGTQLDALPGQGIRSEVAWNDEASGGGAGGGGVSALFDLPAWQHGLSLTRADGSRAPLAKRGVPDVAGDASPQTGYEVSVAGTPAVMGGTSAVAPLWAALIARINAAAGTSAGWINPKLYRHPDALRDITKGSNGTFAAAAGWDACTGLGSPDGAKLAAILARKPSS
>NZ_CP044056.1|WP_006410336.1|1229839_1231516_-|peptidase-S1
MGIDSASSGGVYPLHHGDHNSHGVPPSVDPVALSHGRDQPFFDPVAYGNGPDDSVTDTTEAAAITHHTILIGGRRIAYTATVGHLVTVDPSSSQPAAKIFYVAFTADNAKEETRPVTFFYNGGPGSSSVFVLLGSFAPKRIKTAMPGFTPPAPYQIEDNPDSLIDHSDLVFINPVGTGYSAAVAPNKNRDFWGVDQDADSLKQFIKRYLTKNNRWNSPKYLFGESYGTARSCVLAYKLHEDGVDLNGITLQSSILDYRQAGNPVGTLPTAAADAWYHKRLGITPAPADLGAFVEEVAQFARTDYLNALRKRPHADPAVVKKLSDYTGIDTDTLKSWNLDIAGYDARGNSLFLTTLLHARGLALGAYDGRVTAISTGIAGKIDPNSGGNDPTMTAVTGVYTAMWNSYLNEQLKFTSNSAFTDLNDQAFRNWDFSHIDPTGEQQGIDAKGNLILYTAGDLAAVMALNVDLKVLSANGLYDFVTPFYQTVIDLQQMPLEDQKVRQNLSARFYPSGHMVYLDAGSRTALKRDLATMYDATVADTGARMRIRALQAKKTGGHA
>NZ_CP044056.1|WP_053298204.1|1244810_1245554_+|2OG-Fe(II)-oxygenase
MNIADLPRTAEPVDVASRVDALDWHLIDTDLDGYGCAHVPRLLSPDECRALAALYPDDTRYRSRVVMARHGFGRGEYKYFAYPLPTLVDALRTALYRYLAPIANRWNRALGTDTRYPADLRAFLARCHEAGQTRPTPLLLQYGPGDYNCLHQDLYGEHVFPLQVAILLSAPERDFTGGEFVLTEQRPRMQSRAEVVPLAQGDAVVFAVHSRPVQGTRGIYRVNLRHGVSRIRSGHRHTVGIIFHDAQ
>NZ_CP044056.1|WP_053298203.1|1245647_1247072_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MTARSASGDRTTDFLPYLVAATFFMEYLDTTVIATALPQMAHTFGVGPNALSLGMTAYMLALAVFIPISGWIADRYGSRTVFGSAIVVFTGASVLCGLSNGVGTFTAARLLQGVGGAMMVPVGRMIVVRSTEKSRLMRAIATITWPGIVAPVVGPPIGGFITTYASWRWIFLLNVPFGIAALVSTWLIVRNTRAEQQRPLDWIGFVLAGGALTCLLLGTETAGQQNARFAQAGMLVGASLLFGIAAWVHARRCAHPLLDFTTLKVPTFSVTVITGSITRIAINAVPYLLPLLFQIGFGLSPFQSGLLLLASALGNLGMKAGTSWILDRFGFRRVALVDVTIVGICTIACGWLTASTPLAITLLVVFVYGLTRSMQFTTLATLAYADIPTQQTSAASTLWSAAQQMTIGMGIAFGALSLRLAASLRGDTGGVHYLLEDFRWAFVAAGVLALLTLPGYARLARDAGDRLRASAARG
>NZ_CP044056.1|WP_053298200.1|1253177_1253729_-|HD-domain-containing-protein
MALTVEDIDRLYREHGHVAYSGEPVTQLEHALQSGLLAEEAGADEALVAAAFLHDLGHLLNRQGETPSARGIDDLHQYFVLPFLRPLFSDAVLEPIRLHVDAKRCLCRTDAGYLQSLSPDSVRSLALQGGVFGEEEAATFVRRPYAEDALRLRRWDDTAKAEGKPTPDLDHYMEIVARQVRAA
>NZ_CP044056.1|WP_006406897.1|1253733_1255188_-|phosphonoacetaldehyde-dehydrogenase
MMAHPRQDHPAFRAEALRWCGTRAPRERTFDVRDPYTGTRVGTAPLASVDDVRAAFDYAVAYRPTLTRYERSQILERAAALLRERAEEGADLITLESGLSKQDSRYEIGRVADVLKFAAVEALRDDAQSFSCDLTPHGKARRVFSQRQPLEGVIVAITPFNHPMNQVAHKIAPAIATNNRVIVKPSEKVPLSAFYLADLLYEAGLPEPMLQVLTGDPREIADELVTHAQASLITFTGGVAIGKAIAAKAGYRRVVLELGGNDPLIVLDDADAERAASLAALGSYRNSGQRCTAVKRILVQRSIAPAFTEALVEKTRAWRYGDPFDPTNEMGTVIDDAAARLFEARVADALAHGARLLTGNIRRGALYAPTVLDRVDPSMTLVREETFGPVSPVIAFDTIDDAIRISNGTAFGLSSGVCTDSTAAIVRFVNELNVGTVNVWEVPGYRLELTPFGGIKDSGLGYKEGVQEAMKSFTNLKTFSLPWE
>NZ_CP044056.1|WP_053298198.1|1255184_1256495_-|phosphonoacetate-hydrolase
MNAAFALRAPGAAPAGYGAPADLAGRFVDVNGRRYRLPSEPTAVVCIDGCGYDDLVRAVDAGVAPFIGRMIAEGSAWRADCVVPTFTNPNNVSIVCGVPPSVHGICGNYFWDPDADGGRGAEVMMNDPAYLRAGTLLAAASDAGARVAVVTAKDKLRRLLGWQLNGVCFSAEKAAQANLAENGIADVLDWVGLPSPDVYSAALSEFVFAAGVRLAQTRQIDLMYLSTTDYVQHKCAPGSAAANAFYAMTDRYLAQLDALGWAIGVTADHGMNAKHDPATGRPNVVYLQDALDGWFGARAARVILPITDPYVVHHGALGSFATVYLAPAIDRTDAMWRVGGLDGVECVLDNAEAVARFSLPADRIGDLVVIARRDTTLGTRERDHDLSGLTVPLRSHGGVSEQEVPLLFNRRIVRRDVERRPRNFDVFDFVLNRVAR
>NZ_CP044056.1|WP_006397206.1|1256491_1257352_-|2-aminoethylphosphonate-ABC-transport-system,-membrane-component-PhnV
MSAEIHVAHAVPRRRADWRDALLKHAARAALALAAFACFWLFVLPVIVVALSSVATQWSGTILPAGYSLRWFARLGSPEYDALLTSLEIGFGVAALGTLLGLWLALALEGRDRRGIGAVVDALVMVPNGVPSVVLGLAVLIAYHQKPVDLSSSAAIVVLVQLALILPFCYRCAAAALRPELTVLREAAASLGAPPAMVLRRVLLPQLVPALRASLALGFALSLGELGATLTVYPPGFATVPIVVIGQVERGYYLPASALSLLMLGASLAALLLIAARVPRGTRSAA
>NZ_CP044056.1|WP_006406895.1|1257341_1258262_-|2-aminoethylphosphonate-ABC-transporter-permease-subunit
MSSLSTPEAGLPPQVRASAAAHAAAAKRRKRIADFHLLALAIVVLGPLVVYPLVRLVLLSLSGDHGLSFAAYRTFFGNPDTRQVLLTTLGVLFASAGTASLLGVMLAALLFFRPFPGAALVTRFLELYVAFPSFLVAFTLIFLYGSQGSVSIALQQLFHLEAPPLDFLFGIGGVILAQTVFYTPFVVRPTLASFATLDLRLIEAARSLGASGWMLARRVVLPIAWPGIAAGTVLCFLLTLNEFGILLVLGSARLVTLPVAIYSSATVDLDLPTASAGAVAMLALSLALYAVYRRVNRRATGGNDVR
>NZ_CP044056.1|WP_105775558.1|1258239_1259334_-|2-aminoethylphosphonate-ABC-transport-system-ATP-binding-subunit-PhnT
MDTALTHPGAFGAAEPRTTLRSGAPGGVQIEHLSVRYGARTVLEDLSLSIGAGEFLTVLGKSGCGKTTLLRFIAGFVKADGLTGTLTVAGRDLTDAPPHKRNLGLLFQNYALFPHLSVFENVAFGLRARRMASPEVTRRVADALKLVQLGDAGHHLPAQLSGGMQQRVALARALVIEPDVLLLDEPLSALDANLRASVRSELKALHERLPNLTVVCVTHDRDDALVLSDRALLLRDGRIAQLGTPQQLYDAPNDGYVARYLGPANLLPPHVIFPLGDARHDVRDKVVCVRPERLTVMPLAAGGLHGTVASVEWQGADLSIAVVLDAAPDEPVRVTMQRGRAAAPTRGARVSLHCEADDVVLIDP
>NZ_CP044056.1|WP_053298196.1|1259377_1260469_-|2-aminoethylphosphonate-ABC-transporter-substrate-binding-protein
MTLQNSTRAAAGAFRKLALAACAAGLLQGAALPAHAANAVVLYTADGLENLYRDVLPAFEKKEGVRVNIVTAGSGEVVNRANIEKNSPKADVIVTLPPFIQQAGQMGLLQAYQSVNYKNVPAIAKAEDGTWATFVNNYFSFAINPEVVKSQPKTFADLLSPSYAGKVAYSNPATAGDGMAVLILTTSLMGEDKAFDYLAKLSQSVKFHTKGTGYLNVLLSRNEIAVANGDLQMDLDDAEHGALSVKPIFLAAKEGDQPTTFQLPYGIGLIKGGPNQDAGKKLIDYLMSTDVQSKVPDMYGIPGRTDVPLTGKNGEAVKKAIAGVKLIPVDWNQVMAKKPVWLERWKKDVIGSSGKPLDVVKPK
>NZ_CP044056.1|WP_006406892.1|1260470_1260698_-|hypothetical-protein
MSFCGNCGARHGFVIERCDPSGAAHERRARRRRGPIGRLAPDRQPLGPEPPHGARPARRAEPDVPRPFGVPPTEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044056_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044056_3

1366931-1367145

Orphan

Consensus_repeat	Method
CCGCCGCCGAGCGCGCCGCCGAT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP044056_3

>merge|NZ_CP044056|3|1366931-1367145|CRISPRCasFinder
CCGCCGCCGACGGCCGCGCCGAGCAGGCCGCCCGTACGGCCGCCCATGGCGTTGCCGGCCGCGGTGCCCGCACCGCCGCCGAGCGCGCCGCCGATGATCGCGCCGGTACGCTCGCGACGGTTCGACGTAATCGCGCCACCTGCGCCGCCGCCGAGCGCGCCGCCGATCACGGAACCCGTGCTGCCGCCGACCGCGCCGCCGACCGCCGCGCCGGC

>NZ_CP044056|3|1|1366931-1367145|CRISPRCasFinder
CCGCCGCCGACGGCCGCGCCGAG	CAGGCCGCCCGTACGGCCGCCCATGGCGTTGCCGGCCGCGGTGCCCGCA
CCGCCGCCGAGCGCGCCGCCGAT	GATCGCGCCGGTACGCTCGCGACGGTTCGACGTAATCGCGCCACCTGCG
CCGCCGCCGAGCGCGCCGCCGAT	CACGGAACCCGTGCTGCCGCCGACC
GCGCCGCCGACCGCCGCGCCGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044056.1\|WP_053298151.1\|1368585_1370031_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP044056.1\|WP_053298166.1\|1357367_1358450_+\|hemin-degrading-factor	unknown	unknown	gnl\|CDD\|226243
NZ_CP044056.1\|WP_053298149.1\|1370987_1372190_+\|trans-2-enoyl-CoA-reductase-family-protein	unknown	unknown	gnl\|CDD\|237460
NZ_CP044056.1\|WP_006397321.1\|1374128_1374611_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176904
NZ_CP044056.1\|WP_045593484.1\|1358446_1359361_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226928
NZ_CP044056.1\|WP_053298147.1\|1375637_1376621_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP044056.1\|WP_053298150.1\|1370055_1370703_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198289
NZ_CP044056.1\|WP_053298153.1\|1362148_1364293_-\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP044056.1\|WP_006406742.1\|1374629_1374779_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176904
NZ_CP044056.1\|WP_053298148.1\|1374940_1375579_+\|2-hydroxychromene-2-carboxylate-isomerase	unknown	unknown	gnl\|CDD\|239320
NZ_CP044056.1\|WP_053298156.1\|1355052_1357320_+\|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor	unknown	unknown	gnl\|CDD\|273808
NZ_CP044056.1\|WP_053298155.1\|1359372_1360464_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP044056.1\|WP_053298152.1\|1364401_1365304_+\|3'-kinase	unknown	unknown	gnl\|CDD\|226100
NZ_CP044056.1\|WP_053298154.1\|1360483_1361326_+\|heme-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|184132
NZ_CP044056.1\|WP_053298165.1\|1373105_1373636_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP044056.1\|WP_081000663.1\|1366369_1366729_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044056.1\|WP_035947416.1\|1372455_1373034_-\|membrane-protein	unknown	unknown	unknown
NZ_CP044056.1\|WP_006406758.1\|1361525_1362137_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP044056.1\|WP_006406752.1\|1367973_1368393_-\|HIT-domain-containing-protein	unknown	unknown	gnl\|CDD\|238608
NZ_CP044056.1\|WP_006406755.1\|1365384_1366221_-\|(S)-ureidoglycine-aminohydrolase	unknown	unknown	gnl\|CDD\|183011

Protein	Function_ID	Function_description	E-value
NZ_CP044056.1\|WP_053298166.1\|1357367_1358450_+\|hemin-degrading-factor	gnl\|CDD\|226243	COG3720, HemS, Putative heme degradation protein [Inorganic ion transport and metabolism].	1.19269e-138
NZ_CP044056.1\|WP_053298149.1\|1370987_1372190_+\|trans-2-enoyl-CoA-reductase-family-protein	gnl\|CDD\|237460	PRK13656, PRK13656, enoyl-[acyl-carrier-protein] reductase FabV.	0
NZ_CP044056.1\|WP_045593484.1\|1358446_1359361_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|226928	COG4558, ChuT, ABC-type hemin transport system, periplasmic component [Inorganic ion transport and metabolism].	1.74978e-74
NZ_CP044056.1\|WP_053298147.1\|1375637_1376621_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.8306e-49
NZ_CP044056.1\|WP_053298150.1\|1370055_1370703_-\|glutathione-S-transferase	gnl\|CDD\|198289	cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	3.28946e-47
NZ_CP044056.1\|WP_053298153.1\|1362148_1364293_-\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP044056.1\|WP_006406742.1\|1374629_1374779_+\|hypothetical-protein	gnl\|CDD\|176904	cd08895, SRPBCC_CalC_Aha1-like_2, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	1.44162e-11
NZ_CP044056.1\|WP_053298148.1\|1374940_1375579_+\|2-hydroxychromene-2-carboxylate-isomerase	gnl\|CDD\|239320	cd03022, DsbA_HCCA_Iso, DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway. It converts HCCA, a hemiketal formed spontaneously after ring cleavage of 1,2-dihydroxynapthalene by a dioxygenase, into cis-o-hydroxybenzylidenepyruvate (cHBPA). This is the fourth reaction in a six-step pathway that converts napthalene into salicylate. HCCA isomerase is unique to bacteria that degrade polycyclic aromatic compounds. It is closely related to the eukaryotic protein, GSH transferase kappa (GSTK).	5.31931e-59
NZ_CP044056.1\|WP_053298156.1\|1355052_1357320_+\|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor	gnl\|CDD\|273808	TIGR01786, hemoglobin-haptoglobin-binding_protein, TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein. This model represents a family of TonB-dependent outer membrane receptor/transporters acting on iron-containing proteins such as hemoglobin, transferrin and lactoferrin. Two subfamily models with a narrower scope are contained within this model, the heme/hemoglobin receptor family protein model (TIGR01785) and the transferrin/lactoferrin receptor family model (TIGR01776). Accessions which score above trusted to this model while not scoring above trusted to the more specific models are most likely to be hemoglobin transporters. Nearly all of the species containing trusted hits to this model have access to hemoglobin, transferrin or lactoferrin or related proteins in their biological niche. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	2.70585e-115
NZ_CP044056.1\|WP_053298155.1\|1359372_1360464_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	4.52499e-77
NZ_CP044056.1\|WP_053298152.1\|1364401_1365304_+\|3'-kinase	gnl\|CDD\|226100	COG3570, StrB, Streptomycin 6-kinase [Defense mechanisms].	1.36782e-80
NZ_CP044056.1\|WP_053298154.1\|1360483_1361326_+\|heme-ABC-transporter-ATP-binding-protein	gnl\|CDD\|184132	PRK13547, hmuV, heme ABC transporter ATP-binding protein.	3.88099e-157
NZ_CP044056.1\|WP_053298165.1\|1373105_1373636_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	6.0791e-10
NZ_CP044056.1\|WP_006406758.1\|1361525_1362137_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	2.7377e-63
NZ_CP044056.1\|WP_006397321.1\|1374128_1374611_+\|SRPBCC-family-protein	gnl\|CDD\|176904	cd08895, SRPBCC_CalC_Aha1-like_2, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	5.09771e-70
NZ_CP044056.1\|WP_053298151.1\|1368585_1370031_+\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	2.8756e-38
NZ_CP044056.1\|WP_006406752.1\|1367973_1368393_-\|HIT-domain-containing-protein	gnl\|CDD\|238608	cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides. This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression.	2.38166e-47
NZ_CP044056.1\|WP_006406755.1\|1365384_1366221_-\|(S)-ureidoglycine-aminohydrolase	gnl\|CDD\|183011	PRK11171, PRK11171, (S)-ureidoglycine aminohydrolase.	0

>NZ_CP044056.1|WP_081000663.1|1366369_1366729_+|hypothetical-protein
MLDGPGAGRDVRRHAAARGPERSIRYAGSTDDSEVVFDRPIKCCDGLHSISHCSPDASGASRQPRRHIRLRARRRRNGRSQSTPGRRHTHAPVEERREIQGEEENAARDSRASHREPLK
>NZ_CP044056.1|WP_006406755.1|1365384_1366221_-|(S)-ureidoglycine-aminohydrolase
MSKTTYYAPHGGHPPQTDLLTDRAMFTEAYAVIPKGVMRDIVTSWLPFWTHTRLWVIARPLSGFAETFSQYIVEVNPGGGSDKPEQDKNAEAVLFVVEGQAELTLQGTKHTLTPGGYAFIPPGADWTLHNVSDAAVRFHWIRKHYQAVDGIPLPEAFVTNEQDVEPIPMPGTNGAWVTTRFVDMSDMRHDMHVNIVTFEPGGVIPFAETHVMEHGLYVLEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYSGGPGRFRYLLYKDVNRHMNLTLNPAR
>NZ_CP044056.1|WP_053298152.1|1364401_1365304_+|3'-kinase
MLGWLNFIEESTPHRPTQRHTHRRADAPVRLYHFRMFAAHLRSWSLTPDGGPILTASGGVLPVVWRGRPAMLKIATCEEERRGNALMTWWDGHGAAQVWAHDDDAILLERAQPQPALADFSAAGHDDDAIRIACDVVAQLHAYRAPDPPSLVALRDWFASLLASDATDAILRRSQATAAALLAEPPVDEAVLHGDIHHRNVLHFGDRGWRAIDPKALRGARAFDYANLFCNPSHDIAVDRTRFERRVAIVADAARLDARTLLRWILAWCGLSAIWLIEDDQPADTRLQVAALAAHALDSR
>NZ_CP044056.1|WP_053298153.1|1362148_1364293_-|PBP1A-family-penicillin-binding-protein
MTDRTDSRPTPPAPPPRRRVWRMLAGALLGLMLAGAGIAGWTIHRIWTQLPSVEQLAVYRPALPLRIFSRDGELLAEYGVERREFVPLERMPARMRDALLAAEDAQFYRHGAIDIGGLARATFANVVTGQPAQGGSTITMQVARNFYLTRDKVLSRKLAEILMAVKLERAYGKDKLLELYMNEIYLGERAYGFAAAAHVYFGKPLDALSVGEAAVLAGLPKAPSAFNPVVNPARATARRNYVLGRMLALGKLDDATYRAAVDAPIALSPQAPPGIVAAPYVAERARQMMVERFRDDAYTLGLDVTTTISMRDQRAAEAALERTLRRQRTTRDAQRTLEGALVSLDAATGDMLALVGGADFSRNVFDHALQAYRQPGSSFKPFVYSAALEKGYFPGVLVDDTQRTLTPAETGARPWRPRNYGNHYEGFIAVRRGLVRSKNLVAVSLMQAADPQYVQQHAMRFGFDARRNPASLPLALGAGAVTPLELASAYGVFANGGTRVEPRLILSVKQRHGGVLYDAPAPSGTRVVSARNAFVMDSMLRDVVRAGTARGALALRRDDTAGKTGTSNGSKDVWFAGYSSGIVAVAWLGYDTPRSMGRATGATLALPVWLDYMKTAVDGRTPAEAVEPPDVARVDGDFVYAEYTRGACTADVPAFVRSRFACDGAARAEAASAGFAASAASTAANGGAMSVAPTPAPVDAAERARVLDLFRTDD
>NZ_CP044056.1|WP_006406758.1|1361525_1362137_-|trimeric-intracellular-cation-channel-family-protein
MHTLYLIAIVAEAMSGALMGMRRGMDRFGLALVGAVTALGGGTVRDVLLGHYPLGWIAHPQYLVITLVAATVASRLARHVARMKTLFVAVDALGLAAFTIIGCDVGASTGAAPIIVVLAGAITGVCGGMLRDLLCNEMPLILRRELYASVAFFTGALYVALQHVGIDARVATIVALAAGFAMRMLAVRFGWEMRTFGAADVEH
>NZ_CP044056.1|WP_053298154.1|1360483_1361326_+|heme-ABC-transporter-ATP-binding-protein
MLTVQHLRVARRHRVILHDLSLTIEPGRVTALLGRNGAGKSTLLKALAGELAGSAAPNGVRVTGRIALNGEPLAQIDAQRLARLRAVLPQAAQPAFPFSVDEIVLLGRYPHARGRGGALSRRDRGIAWHALARAGADTLLGRDVTTLSGGELARVQFARVLAQLWPSDDEAGRDARDASPTRYLLLDEPTAALDLAHQHRLLDTVRAIAREWRIGVLAIVHDPNLAARHADTIAMLADGTIVAHGTPHDVMTPEHIARCYGFAVKRIDSGDGTPPVMVPA
>NZ_CP044056.1|WP_053298155.1|1359372_1360464_+|iron-ABC-transporter-permease
MSARLSSIRASSVAAGAHGARRIGTQRRFAPVALGALAVLVGAMSVVALCVGAYRISPADAWAALAGDPAAQQARAVLLGIRAPRVVLALLVGGGFGAAGAAMQALFRNPLADPGLVGVSSGAALGATAAIVLGPALFAAHAGAAALPAAAFVGALAIAALVYRLAASRGRLALPLLLLAGIAINALVGAAIGLLTFVADDAQLRSLTFWSLGSLGGAQWSTLAAVAPCAVLGCALLMRERDALNALQLGETEALHLGVPVQRLKRRVLVAVALAVGALVSCAGIVGFIGLVAPHCVRLACGPDQRIVLPGAALLGALLTLAADLAARTLAAPAEIPLGVLTALLGAPFFLALLWKSRGSLGA
>NZ_CP044056.1|WP_045593484.1|1358446_1359361_+|ABC-transporter-substrate-binding-protein
MSARTFDPRRRAVLAGAAASALAATVPARAIAAVQSAPKRVVVIGGALAETAFALGGEHARGYRLVGADTTCTYPEAAKRLPKVGYQRALSAEGLLSLRPDLVLASAEAGPPAAIAQVARAGVAVQTFDERHNAESVRAKIAGIAQALDMRDAGVALLRQFDRDWQAARATVAAHVPGGAQPPRVLFVLNHTGNQALVAGRRTAADAMIRYAGARNAMQGFDHYKPLTSEALAAAAPDVVLISDEGLAAVGGRAALLGAPGFAATPAGRAQRIVSLDALLLLGFGPRLPLAVTTLHRRLSDTLA
>NZ_CP044056.1|WP_053298166.1|1357367_1358450_+|hemin-degrading-factor
MMQSPVSAPSVRTSTSLRDAFVKLKRERRLRNRDVAQALGVSEGEALAAFVGEHVVRLDARFPELFEEMPRLGRVMALTRNDAAVHEKDGAYAQMSHDGPVGLALGDIDLRIFYRQWASAFAVRDDTPHGPLKSLQFFDAQGHAIHKVYLRAHSDHAEYDAFVARWRAASQQPGLDVAPAAPKKPERADSAIDVVGFRAAWDAMTDTHQFFGITQRFGVSRLQALRLADPQHAYPLDAARALRHVLERAAQSGQPIMVFVGNAGMIQIHTGPIANVREVGAWINVLDPGFNLHVREDMIATAWVVKKPTSDGIVTSVELFDRNGEHVALLFGERKPGQPERDDWRALVASLAPAARGDAR
>NZ_CP044056.1|WP_053298156.1|1355052_1357320_+|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor
MHRSTLARQPIFAALIGAVGLSAATAHADSSPSHAAASSVMADAAAARAGSALLDPVTVTATRTATAASRTAASVSVIDADDLDEQQATNIKDALRYEPGITVRRTAYRPGSAALGGGRDGDSSINIRGLEGNRVMLMEDGIRLPNAFSFGPLEAGRGDYTDLDTLKRIEIVRGPASALYGSDGLTGAVNFITKDPQDLLSIYRKPIYFSFRPSYDSTDRSIGATVSAAGGNDRIQGMIIADGRRGHEIDTRGSNNAAGTLRTTSNPQHVYSESLLGKLVLTPTVRDTIRLTAETVQRRVGTDVLSAIVAPATLGLTTSDRLERNRFSADYAFRDDASRWLQNAHVQFYYQEATQDQYAFETRGTLPSRSRDNRYRERTFGGSAFAESGFSTGPLAHKLLGGVDGSLSRITNLRDGTVPGVGETFPNKAFPDTDYTLFGAFVQDQIGYGRLLVTPGLRFDTYRLKPAGNDPLFTGRAVSTHANELSPRVAVLYEIAPALIPYLQYAHGFRAPTPDQVNSSFSNPVYGYTSIGNPNLKPETSDTFEAGLRGRAGTGYGTIRYSAAAFTGRYRNFIARTTIAGSGRPTDPFVFQYVNFADARVHGIEGRADWAMPNGITLRTALALTRGSTQNNGAASQPLNTVNPFSAVFGVRYEPTERWFVQTDLLFQAAKRDKDIDRSDCSKRACFAPPSSFVVDLRGGYRFNKHVSATVGIRNLFDRKYWNWSDVRGIAADSPVLDAYTSPGRTVAVSMKVDF
>NZ_CP044056.1|WP_006406752.1|1367973_1368393_-|HIT-domain-containing-protein
MSYDDNNPFAKILRGELPCVKVAEDDATLAIMDLMPQADGHVLVIPKEPAAQIFDLSGDAAAASIRMTQRVAAAVRAALAPDGLFIGQFNGAAAGQTVPHVHFHVIPRTEGVALRMHARDVADAATLESIAQRIRAHIA
>NZ_CP044056.1|WP_053298151.1|1368585_1370031_+|serine-hydrolase
MTIPLRPLIRRGIALALIAAIGYAGYQLSRLAPIATGYAAKALCSGVFVSGRPAASVIDVDIMAGVHPLLKLVRPSIDAEHHRAHATFAGFAARDAEFRPGLGCTLALGPAAAALPAALPPLPAAPAATAVPASLAIASASASASSTTSAPNGVDMRKLHTALDRAFDEPDPARPRRTRAVVVMWRGRVIAERYAPGFTGDTPLPGWSMTKTVTAVLIGMLVGQHRLSPDTAALLPEWRGAGDPRAAITLDDLLRMTSGLQFNEDYDDPLSDVAVMLFTQRDTARFASNKPLAAAPGTRWDYSSGTSEIVARVMRVALGGSTDDYLSFPRRALFAPLGMRSAVFEPDASGTLAAASFMYASARDWARFGQFLLQDGVWDGQRLLPEGWVRYLARATPQSSRAAFGAHLWVKVPEPFDDRDPHARALPADAFHAVGHEGQFVSVVPSRDLVVVRLGLSRPESAWNHEAFLARVLDAIPASGT
>NZ_CP044056.1|WP_053298150.1|1370055_1370703_-|glutathione-S-transferase
MLHILGKIPSINVRKVLWLCTELNLPFEREDWGAGFRSTDDPAYLALNPNGLVPVIRDGDFVLWESNAILRYLANRYGDRLGNGAVAPSLYPTDPQARARVDQWIDWQGTDLNRSWVGAFLGLVRKSPDHQDPAAIAQSIANWTKHMRVLNGQLDATGAFVAGEHFTIADIAIGLSVNRWFGTPFERPELPAVKRYADRLATREGFKTYAGSANP
>NZ_CP044056.1|WP_053298149.1|1370987_1372190_+|trans-2-enoyl-CoA-reductase-family-protein
MIIKPRVRGFICVTTHPVGCEANVKEQIDYVTSHGPIANGPKKVLVIGASTGYGLAARISAAFGAGADTLGVFFERPGSETKPGTAGWYNSAAFERFATEKGLYARSINGDAFSDQVKQVTIDTIKQDLGKVDLVVYSLAAPRRTHPKTGETISSTLKPIGKSVTFRGIDTDKEVIRETVLEPATQEEIDGTVAVMGGEDWQMWIDALDEAGVLADGAKTTAFTYLGEQITHDIYWNGSIGEAKKDLDKKVLSIRDKLAAHGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEAGTHEGCIEQVYGLFKDSLYGATPHLDDEGRLRADYKELDPQIQKKVVELWDQVTNENLYELTDFAGYKTDFLRLFGFEIAGVDYDADVNPDVKIPRIIDTTA
>NZ_CP044056.1|WP_035947416.1|1372455_1373034_-|membrane-protein
MKRTHVVMGCAALLVALPIAAYALVKPLRVAMPALVPGVSCVHAQICIDDASKLADAQQLYRDGYARAAAAVGAFGDAPRVVFCSTRACADAFGLGERAALTLGTVGVVIAPRGWHAYFVAHELIHHRQAETLGNLAVLTKPRWLIEGMAYSLSGDPRHPLKEPFEAWRARFDAWHAALGTRPLWDAARAVE
>NZ_CP044056.1|WP_053298165.1|1373105_1373636_-|GNAT-family-N-acetyltransferase
MTESVTVRRVGANEAIAYVDALSDVLIDCVEGGASVSFMLPIARSTAVAFWTGVAQSVANGERILLVAEDASGRVVGTVQIVTAQPENQPHRADIAKMLVARHARRQGVAARLLAAADAAARDAGKTVLVLDTVTGGDAERLYERAGWQRVGVVPNFALMPDGAPCATTFFHKQLA
>NZ_CP044056.1|WP_006397321.1|1374128_1374611_+|SRPBCC-family-protein
MMHSHTTRISRHVNAPRNRVYRALLDPHAVEQWKVPDGMTCRVHAFDAREGGALRVSLTADAAAPAGKTDAHTDTYHGRFVTLVPDRQVVEIDVFETDDPMLRGAMTITITLSDEDGGTRVDAVHDGVPPGVPAADNETGWRMALARLAALVEDGGRPHA
>NZ_CP044056.1|WP_006406742.1|1374629_1374779_+|hypothetical-protein
MSDEDAGTRVDAVHGGVPPGVPASDNETGWRMALARLAALVEDGGRPHA
>NZ_CP044056.1|WP_053298148.1|1374940_1375579_+|2-hydroxychromene-2-carboxylate-isomerase
MNAARTATWYFDFVSPFAYLQQEQFDGLPPAAAFEPTPIVLGALLAHWGQKAPAEIATKRIFTYRHAQYRADKLGIPFRMPPAHPFNPIRPLRLAIAMGGSMDAIGRIFRHIWRDGQDVATPDGFAALCEAVGFPEGVTAVDAQPVKDALRANTDRAIAHGVFGVPTFELDGDLFWGEDATDMFVDCATSRAWLDSPEVRRISTLPEGIRRG
>NZ_CP044056.1|WP_053298147.1|1375637_1376621_-|LysR-family-transcriptional-regulator
MTAKSDDSRDAQGASHIPTVPVDGAGYRFELMETFVRIVEAGSLSAAAAQMHTTQPTVSRRLQALERSLGVRLLQRTTHAMRLTVDGERCFTRAKELLAHWAAFEADLRGAQEEPDGLLRVAVPHAFGQERFVAPLARFLRDYPRVSVEWLLQDDVRDFVGSGIDCAIQVGEPTDPGVVAIRLTKVPRFVVAAPSVLNGADVPADPDALAALPWLALRTYYRTELTLTHAVTGDTRRIAIRPRITTANLYALRSAALLGVGACVGSSWMLADDLARGDLVHLARDWQAAPLPVYITYPHAQFYPSRLVRFVAMMRDAVPALVEGRDA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP044056_2	2.1\|1243946\|48\|NZ_CP044056\|CRT	1243946-1243993	48	NZ_CP044056.1	1243842-1243889	1	0.979

1. spacer 2.1|1243946|48|NZ_CP044056|CRT matches to position: 1243842-1243889, mismatch: 1, identity: 0.979

ggacgatcccgttgggactggcgaccgctggccacctcgatcgcgtta	CRISPR spacer
ggacgatcccgtcgggactggcgaccgctggccacctcgatcgcgtta	Protospacer
************.***********************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NC_015377	Burkholderia gladioli BSR3 plasmid bgla_2p, complete sequence	95186-95210	2	0.92
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	483657-483681	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	473988-474012	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP007050	Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence	137934-137958	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	483841-483865	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP054025	Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence	38149-38173	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	603995-604019	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	362095-362119	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP054034	Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence	1162-1186	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP022569	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence	96046-96070	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1337174-1337198	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	38175-38199	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	MT708550	Achromobacter phage Mano, complete genome	39318-39342	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP050094	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence	87328-87352	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NC_008379	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence	70309-70333	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP018233	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence	186867-186891	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NZ_CP048283	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence	27894-27918	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	KJ944841	Mycobacterium phage Cheetobro, complete genome	16587-16611	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	KY087992	Mycobacterium phage Mitti, complete genome	16500-16524	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	MF140402	Mycobacterium phage Chancellor, complete genome	16587-16611	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	KT361920	Mycobacterium phage Slarp, complete genome	16587-16611	4	0.84
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	NC_016115	Streptomyces pratensis ATCC 33331 plasmid pSFLA02, complete sequence	75744-75768	5	0.8
NZ_CP044056_3	3.3\|1367098\|25\|NZ_CP044056\|CRISPRCasFinder	1367098-1367122	25	MN234216	Streptomyces phage Gilgamesh, complete genome	17479-17503	5	0.8

1. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NC_015377 (Burkholderia gladioli BSR3 plasmid bgla_2p, complete sequence) position: , mismatch: 2, identity: 0.92

cacggaacccgtgctgccgccgacc	CRISPR spacer
catcgaacccgtgctgccgccgacc	Protospacer
**. *********************

2. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

3. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

4. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP007050 (Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

5. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

6. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP054025 (Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

7. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
tgcggaaaccgtgctgccgccgaac	Protospacer
..***** *************** *

8. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

9. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP054034 (Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

10. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP022569 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

11. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
ggcggaacccttgctgccggcgacc	Protospacer
 .******** ******** *****

12. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

13. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to MT708550 (Achromobacter phage Mano, complete genome) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
ggcggaacgcctgctgccgccgacc	Protospacer
 .****** * **************

14. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP050094 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

15. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NC_008379 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

16. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP018233 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

17. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NZ_CP048283 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

18. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to KJ944841 (Mycobacterium phage Cheetobro, complete genome) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
gccggcacccgtgctgccgccgatc	Protospacer
  *** *****************.*

19. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to KY087992 (Mycobacterium phage Mitti, complete genome) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
gccggcacccgtgctgccgccgatc	Protospacer
  *** *****************.*

20. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to MF140402 (Mycobacterium phage Chancellor, complete genome) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
gccggcacccgtgctgccgccgatc	Protospacer
  *** *****************.*

21. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to KT361920 (Mycobacterium phage Slarp, complete genome) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
gccggcacccgtgctgccgccgatc	Protospacer
  *** *****************.*

22. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to NC_016115 (Streptomyces pratensis ATCC 33331 plasmid pSFLA02, complete sequence) position: , mismatch: 5, identity: 0.8

cacggaacccgtgctgccgccgacc	CRISPR spacer
gccctcacccgtgctgccgccgacc	Protospacer
  *   *******************

23. spacer 3.3|1367098|25|NZ_CP044056|CRISPRCasFinder matches to MN234216 (Streptomyces phage Gilgamesh, complete genome) position: , mismatch: 5, identity: 0.8

cacggaacccgtgctgccgccgacc	CRISPR spacer
gacggaaaccgtgctgccgccggag	Protospacer
 ****** **************.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1813373 : 1856848

Burkholderia_phage(91.49%)

terminase,transposase,head,tail,capsid,plate,integrase

attL 1817431:1817449|attR 1853098:1853116

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297954.1\|1813373_1816130_+	hsp70 family protein	G8DDB7	Micromonas_pusilla_virus	8.4e-07	28.0
WP_053297953.1\|1816287_1817271_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
1817431:1817449	attL	NA	NA	NA	NA
WP_150331558.1\|1817436_1817871_-\|tail	tail fiber assembly protein	A4JWL9	Burkholderia_virus	4.0e-28	50.9
WP_150331559.1\|1817873_1818719_-	hypothetical protein	B5TAB2	Burkholderia_phage	1.6e-12	44.1
WP_150331560.1\|1818731_1819328_-	DUF2313 domain-containing protein	B5TAB0	Burkholderia_phage	1.2e-59	61.2
WP_150331561.1\|1819327_1820449_-\|plate	baseplate J/gp47 family protein	B5TAA9	Burkholderia_phage	7.3e-151	72.9
WP_105799272.1\|1820445_1821033_-\|tail	phage tail protein	B5TAA8	Burkholderia_phage	2.3e-79	70.6
WP_150331562.1\|1821118_1821634_-\|plate	baseplate assembly protein	B5TAA7	Burkholderia_phage	2.6e-50	58.5
WP_150331563.1\|1821630_1822797_-	hypothetical protein	B5TAA6	Burkholderia_phage	5.4e-181	78.5
WP_150331564.1\|1822800_1824177_-	multidrug DMT transporter	B5TAA5	Burkholderia_phage	2.0e-195	76.9
WP_150331565.1\|1824180_1826856_-\|tail	phage tail tape measure protein	B5TAA4	Burkholderia_phage	5.3e-216	61.1
WP_150331566.1\|1826904_1827453_-	hypothetical protein	B5TAA3	Burkholderia_phage	1.9e-64	70.1
WP_105842231.1\|1827542_1827914_-	hypothetical protein	B5TAA2	Burkholderia_phage	1.1e-47	73.2
WP_105822493.1\|1827961_1829440_-\|tail	phage tail protein	B5TAA1	Burkholderia_phage	1.2e-220	76.0
WP_150331567.1\|1829746_1830367_-	hypothetical protein	B5TA99	Burkholderia_phage	1.5e-52	54.9
WP_105822496.1\|1830366_1830801_-	virion morphogenesis protein	B5TA98	Burkholderia_phage	1.7e-55	75.7
WP_150331568.1\|1830797_1831301_-	DUF1320 family protein	B5TA97	Burkholderia_phage	2.3e-88	92.8
WP_150331569.1\|1831297_1831675_-	hypothetical protein	B5TA96	Burkholderia_phage	1.2e-09	62.3
WP_150331570.1\|1831748_1832696_-\|capsid	phage capsid protein	B5TA95	Burkholderia_phage	2.0e-165	93.0
WP_105822499.1\|1832747_1833104_-	DUF2190 family protein	B5TA94	Burkholderia_phage	3.2e-44	83.1
WP_150331571.1\|1833138_1834293_-	hypothetical protein	B5TA92	Burkholderia_phage	1.5e-191	88.4
WP_105822501.1\|1834506_1834905_-	hypothetical protein	B5TA91	Burkholderia_phage	5.5e-69	98.5
WP_045602036.1\|1834901_1835342_-	regulatory protein GemA	B5TA90	Burkholderia_phage	9.4e-70	92.5
WP_105842239.1\|1835343_1835667_-	hypothetical protein	B5TA89	Burkholderia_phage	2.0e-48	87.6
WP_150331572.1\|1835830_1836115_-	hypothetical protein	B5TA88	Burkholderia_phage	1.0e-08	66.0
WP_045602031.1\|1836190_1836463_-	HU family DNA-binding protein	B5TA87	Burkholderia_phage	1.1e-36	93.3
WP_045602029.1\|1836525_1836918_-	hypothetical protein	B5TA86	Burkholderia_phage	1.8e-67	94.6
WP_105822503.1\|1836928_1837555_-	DUF3164 family protein	B5TA85	Burkholderia_phage	1.1e-103	93.3
WP_105822504.1\|1837551_1838139_-	hypothetical protein	B5TA84	Burkholderia_phage	4.9e-82	91.2
WP_105822505.1\|1838125_1838431_-	hypothetical protein	B5TA83	Burkholderia_phage	1.6e-39	87.1
WP_105822537.1\|1838427_1838616_-	hypothetical protein	B5TA82	Burkholderia_phage	1.1e-14	69.4
WP_045602021.1\|1838623_1839616_-	AAA family ATPase	B5TA81	Burkholderia_phage	2.4e-174	93.9
WP_150331573.1\|1839625_1841251_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	B5TA80	Burkholderia_phage	8.3e-305	95.4
WP_150331574.1\|1841768_1842815_-	hypothetical protein	B5TA79	Burkholderia_phage	4.8e-136	76.5
WP_045602015.1\|1842811_1843003_-	DNA-binding protein	B5TA78	Burkholderia_phage	6.0e-21	76.3
WP_045602013.1\|1843067_1843568_+	helix-turn-helix transcriptional regulator	K4NXA8	Burkholderia_phage	1.3e-11	35.3
WP_150331575.1\|1843611_1844148_+	hypothetical protein	B5TA76	Burkholderia_phage	8.3e-60	66.9
WP_150331576.1\|1844355_1844871_+	hypothetical protein	NA	NA	NA	NA
WP_045602010.1\|1844909_1845392_+	DUF2778 domain-containing protein	NA	NA	NA	NA
WP_105799267.1\|1845388_1845661_+	hypothetical protein	NA	NA	NA	NA
WP_150331577.1\|1845777_1846095_+	hypothetical protein	B5TA74	Burkholderia_phage	2.4e-38	70.2
WP_150331578.1\|1846091_1846763_+	transglycosylase SLT domain-containing protein	B5TA73	Burkholderia_phage	1.5e-98	79.3
WP_105822511.1\|1846759_1847221_+	hypothetical protein	NA	NA	NA	NA
WP_150331604.1\|1847331_1847562_+	hypothetical protein	B5TA71	Burkholderia_phage	5.0e-30	91.4
WP_105822512.1\|1847548_1847839_+	hypothetical protein	B5TA70	Burkholderia_phage	2.2e-30	74.0
WP_105822513.1\|1847842_1848340_+	DUF1804 family protein	B5TA69	Burkholderia_phage	1.3e-83	96.4
WP_150331579.1\|1848346_1849963_+\|terminase	phage terminase large subunit	B5TA68	Burkholderia_phage	3.0e-312	95.3
WP_150331580.1\|1849952_1851485_+	DUF935 family protein	B5TA67	Burkholderia_phage	7.5e-247	88.1
WP_105822516.1\|1851529_1851790_+	hypothetical protein	B5TA66	Burkholderia_phage	6.2e-29	83.7
WP_150331581.1\|1851790_1853023_+\|head	phage head morphogenesis protein	B5TA65	Burkholderia_phage	7.7e-210	84.9
WP_053297952.1\|1853321_1855052_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-30	33.5
1853098:1853116	attR	NA	NA	NA	NA
WP_006408809.1\|1855048_1856848_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.2e-31	30.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP044058

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044058_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044058_1

2432896-2432966

Orphan

Consensus_repeat	Method
GGCGGCGGTGCATACACGGGCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044058_1

>merge|NZ_CP044058|1|2432896-2432966|CRISPRCasFinder
GGCGGCGGTGCATACACGGGCGCCGGCTGATAGACAACCGGCGGCGGAGGCGGCGGCGCATACACGGGCGC

>NZ_CP044058|1|1|2432896-2432966|CRISPRCasFinder
GGCGGCGGTGCATACACGGGCGC	CGGCTGATAGACAACCGGCGGCGGA
GGCGGCGGCGCATACACGGGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044058.1\|WP_035488286.1\|2421271_2421736_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP044058.1\|WP_053297115.1\|2430701_2432585_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173862
NZ_CP044058.1\|WP_006409815.1\|2425997_2426672_-\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|223862
NZ_CP044058.1\|WP_006402938.1\|2433687_2434296_-\|cytochrome-o-ubiquinol-oxidase-subunit-III	unknown	unknown	gnl\|CDD\|131889
NZ_CP044058.1\|WP_053297120.1\|2420384_2421263_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_CP044058.1\|WP_053297117.1\|2426799_2428422_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226641
NZ_CP044058.1\|WP_053297109.1\|2442731_2444138_-\|tRNA-lysidine(34)-synthetase-TilS	unknown	unknown	gnl\|CDD\|182626
NZ_CP044058.1\|WP_006401893.1\|2445258_2446140_-\|DNA-3-methyladenine-glycosylase-2-family-protein	unknown	unknown	gnl\|CDD\|223200
NZ_CP044058.1\|WP_053297114.1\|2437458_2438988_-\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NZ_CP044058.1\|WP_006408212.1\|2441138_2442389_-\|aspartate-kinase	unknown	unknown	gnl\|CDD\|235843
NZ_CP044058.1\|WP_006397282.1\|2439578_2440799_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|225995
NZ_CP044058.1\|WP_006408210.1\|2444184_2445156_-\|acetyl-CoA-carboxylase-carboxyltransferase-subunit-alpha	unknown	unknown	gnl\|CDD\|235580
NZ_CP044058.1\|WP_006402610.1\|2419719_2420214_-\|RraA-family-protein	unknown	unknown	gnl\|CDD\|236487
NZ_CP044058.1\|WP_053297119.1\|2423286_2424696_-\|glutamate--tRNA-ligase	unknown	unknown	gnl\|CDD\|234953
NZ_CP044058.1\|WP_035488288.1\|2424974_2425901_+\|patatin-like-phospholipase-family-protein	unknown	unknown	gnl\|CDD\|224666
NZ_CP044058.1\|WP_006402937.1\|2433354_2433687_-\|cytochrome-o-ubiquinol-oxidase-subunit-IV	unknown	unknown	gnl\|CDD\|131894
NZ_CP044058.1\|WP_035488290.1\|2436305_2437193_-\|ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|182518
NZ_CP044058.1\|WP_006408218.1\|2434295_2436302_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|131890
NZ_CP044058.1\|WP_006409818.1\|2429591_2430635_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|226642
NZ_CP044058.1\|WP_053297116.1\|2428418_2429516_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226690

Protein	Function_ID	Function_description	E-value
NZ_CP044058.1\|WP_035488286.1\|2421271_2421736_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	8.85012e-11
NZ_CP044058.1\|WP_053297115.1\|2430701_2432585_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173862	cd08497, PBP2_NikA_DppA_OppA_like_14, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP044058.1\|WP_006409815.1\|2425997_2426672_-\|C40-family-peptidase	gnl\|CDD\|223862	COG0791, Spr, Cell wall-associated hydrolases (invasion-associated proteins) [Cell envelope biogenesis, outer membrane].	1.03839e-42
NZ_CP044058.1\|WP_006402938.1\|2433687_2434296_-\|cytochrome-o-ubiquinol-oxidase-subunit-III	gnl\|CDD\|131889	TIGR02842, Cytochrome_bo3_ubiquinol_oxidase_subunit_3, cytochrome o ubiquinol oxidase, subunit III. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	6.25553e-98
NZ_CP044058.1\|WP_053297120.1\|2420384_2421263_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	7.44616e-31
NZ_CP044058.1\|WP_053297117.1\|2426799_2428422_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226641	COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only].	0
NZ_CP044058.1\|WP_053297109.1\|2442731_2444138_-\|tRNA-lysidine(34)-synthetase-TilS	gnl\|CDD\|182626	PRK10660, tilS, tRNA(Ile)-lysidine synthetase; Provisional.	3.52459e-71
NZ_CP044058.1\|WP_006401893.1\|2445258_2446140_-\|DNA-3-methyladenine-glycosylase-2-family-protein	gnl\|CDD\|223200	COG0122, AlkA, 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair].	2.54477e-54
NZ_CP044058.1\|WP_053297114.1\|2437458_2438988_-\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	0
NZ_CP044058.1\|WP_006408212.1\|2441138_2442389_-\|aspartate-kinase	gnl\|CDD\|235843	PRK06635, PRK06635, aspartate kinase; Reviewed.	0
NZ_CP044058.1\|WP_006397282.1\|2439578_2440799_-\|ISL3-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.01353e-89
NZ_CP044058.1\|WP_006408210.1\|2444184_2445156_-\|acetyl-CoA-carboxylase-carboxyltransferase-subunit-alpha	gnl\|CDD\|235580	PRK05724, PRK05724, acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated.	0
NZ_CP044058.1\|WP_006402610.1\|2419719_2420214_-\|RraA-family-protein	gnl\|CDD\|236487	PRK09372, PRK09372, ribonuclease E inhibitor RraA.	9.89225e-92
NZ_CP044058.1\|WP_053297119.1\|2423286_2424696_-\|glutamate--tRNA-ligase	gnl\|CDD\|234953	PRK01406, gltX, glutamyl-tRNA synthetase; Reviewed.	0
NZ_CP044058.1\|WP_035488288.1\|2424974_2425901_+\|patatin-like-phospholipase-family-protein	gnl\|CDD\|224666	COG1752, RssA, Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only].	1.06028e-63
NZ_CP044058.1\|WP_006402937.1\|2433354_2433687_-\|cytochrome-o-ubiquinol-oxidase-subunit-IV	gnl\|CDD\|131894	TIGR02847, Cytochrome_bo3_ubiquinol_oxidase_subunit_4, cytochrome o ubiquinol oxidase subunit IV. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	4.64212e-38
NZ_CP044058.1\|WP_035488290.1\|2436305_2437193_-\|ubiquinol-oxidase-subunit-II	gnl\|CDD\|182518	PRK10525, PRK10525, cytochrome o ubiquinol oxidase subunit II; Provisional.	3.86008e-154
NZ_CP044058.1\|WP_006408218.1\|2434295_2436302_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	gnl\|CDD\|131890	TIGR02843, Cytochrome_bo3_ubiquinol_oxidase_subunit_1, cytochrome o ubiquinol oxidase, subunit I. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	0
NZ_CP044058.1\|WP_006409818.1\|2429591_2430635_-\|ABC-transporter-permease-subunit	gnl\|CDD\|226642	COG4174, COG4174, ABC-type uncharacterized transport system, permease component [General function prediction only].	0
NZ_CP044058.1\|WP_053297116.1\|2428418_2429516_-\|ABC-transporter-permease	gnl\|CDD\|226690	COG4239, COG4239, ABC-type uncharacterized transport system, permease component [General function prediction only].	3.88003e-166

>NZ_CP044058.1|WP_053297115.1|2430701_2432585_-|ABC-transporter-substrate-binding-protein
MTMGSRWTAATRVRGRAAQALRTAGAAAAAFALHAALAATAAHAAYAIAQYGEPKYPPGFRHFDYVNPNAPKGGTLVLANPNRLTSFDKFNPYTLRGNVAPGIDLLFESLATGSLDEPASAYGLLADDIAVAPDRRSVTFHLNPRARFSNGDPVTADDVKYSFDTLKSKQAAPQFAAYFAEISRAVVVDPATVRFEFRSTNRELPLIAGGVPIFSHKWGLRADGSRIPFDQLAFEQPIGSGPYLIDHYDNGRTITYRRNPAYWGADLPVRVGTNNFDRIVYKLYGDGIARLEAFKAGEYDVLVEYIARNWVRRDVGKRFDSGELVKREFRQHNGAGMQGFFMNLRRPLFRDVRVRKALDLAFDFEWLNRQLFFGGYTRLDSYFADTDLQATGTPGEGELKLLEPLRAQLDPAVFGPMVTQPSTNPPGSLRANLLKARALLAEAGWTYRDGALRNANGDPFTFEILDDAGSAFAPVVTAYQRNLAKLGIDVRFRTADFALLQKRLDAFDYDMTTVRYPGVQVPGTEQLARFGSQFADTPGSDNLIGLKSPAVDTLLRALTAAQTREQLLDATHALDRVLMHGYYAIPQWYSTTHRIAYKRTLAYPQTLPLYYSAESWVVSTWWAKPDH
>NZ_CP044058.1|WP_006409818.1|2429591_2430635_-|ABC-transporter-permease-subunit
MWSYILKRLLLMIPTLVGVLTLTFVVIQFVPGGPVEQAVQELRKGATEQGATPFGMRAHTGVDPQQIAQLKALYGFDKPPLERYWLMLERFARFDLGDSYFRHQSVWSLIVQKLPVSISIGLWTFFLTYLISVPLGIAKAVRNGSPFDVATSLVVLVGYAIPGFVLGVLLLVLFGGGSFWQLFPLRGLTSDNFAQLSVAGKVLDYLWHIALPITASVVGSFAVVTMLTKNAFLDEIRRQYVLTARAKGLGERTVLWKHVFRNAMLPLIVGFPAAFIGAFFTGSLLIETLFSLDGLGLLSYESVVRRDYPVVLGTLYLFTLIGLATKLISDLCYVWVDPRIQFENLER
>NZ_CP044058.1|WP_053297116.1|2428418_2429516_-|ABC-transporter-permease
MSRVAAPSRVEAARAHVSPSPARRVWQRFRQQKLGYWSFVIFVVAFAASIAAPLWSNDKPLVVRYDGHYYFPLFHAYPETTFGGDFPTPADYLDPDVRKRLEAPGNFVVYPPNRYYYDTLNYFSKEPNPAPPSRENWLGTDAQGRDLFARLVYGFRVSVEFGLILTAIGTLLGIAAGAVQGFFGGRIDIVGQRLIEIWSSLPELYLLIIFASIFEPSFLLLIVLLSLFGWIGLADYVRAEFLRNRTQDYVRAARAMGLTNWQIIWRHVLPNSLTPVITFLPFRMSGAILALTSLDFLGLGVPPPTPSLGELLAQGKGNLDAWWISLSTFGVLVATLLLLTFMGDALRNALDTRIADSMRAAGGQR
>NZ_CP044058.1|WP_053297117.1|2426799_2428422_-|ABC-transporter-ATP-binding-protein
MNGATVSTHDEPLLALQHLNVRFGDTVAVDDVTFAIGRGERVALVGESGSGKSVTALSILRLLRDADVRGTIRFAGQDLGAKSEREMRALRGADIAMIFQEPMTALNPLYTIGAQIAETIVLHDGVSAAEARKRAIALLARTGIAEPDRRVDSYAHQLSGGQRQRAMIAMALACRPRLLLADEPTTALDVTIRAQIVDLLLELQREEAEKRGMAILLITHDLNLVRRFAERVAVMERGRLVESGPVERIFAEPQHPYTQRLLNSRPQRAVAPVMPIAPVLLDARHVSVQFARKRPGLAGWFGTTPVTAVSDVSVSVRQGETLGIVGESGSGKSTLAMALLGLQKTVHGDIEFQGRALSTYRGREQTALRANMQVVFQDPFSSLSPRHTIERIVGEGLELHRPDLTPDARRAKSVAVLREVGLDRTVLHRYPHEFSGGQRQRIAIARALVLEPRVLILDEPTSALDVSIQQQVLKLLANLQQKYNLGYVFISHDLEVIGAMAHRVAVMQGGMIVESGDVEQIFARPSHPYTQKLLKAVWKA
>NZ_CP044058.1|WP_006409815.1|2425997_2426672_-|C40-family-peptidase
MQHRSLTQACARTLAGLFIGALFAAAPGAFADEVSSFNQNVTNSTQIGSGSSLQQPNAQPSSGGAKSFLSGMAGKAGDVVVSALNMIGVRYRWGGNSPDSGLDCSGFVRYVFQDTLGMSLPRRAEEMSRVGEKVSMSNLKPGDLVFFNTMRRTFSHVGIYIGDNKFVHSPSTGSTVRVDDLDSSYWEKRFTGARRIETQFPMKADDLRQRVRATIGNDADNANN
>NZ_CP044058.1|WP_035488288.1|2424974_2425901_+|patatin-like-phospholipase-family-protein
MSSPRLSRRQFTIACASASLAACTSFGGKSRSDSASSATQPHDKPVKIGIALGGGAARGFSHIGVLKALEARGIAIDLVAGTSAGSVVGALYASGMNGLQINKIALDMDQASISDWALPFRSRGLLQGVALQNFLNKALNNRPIEKMPKPLGIVATDLQSGQPILFQQGNTGLAVRASCSVPSVFEPVKIGNREYVDGGLVSPVPASFARRMGANFVIAVDISARPDGAATNNPIEMLLQTFTIMGQTIKTYELDKYADVVIRPNLAAMGGSDFNQRNAAILAGEEAVARIMPELQRKLAAARGVPVA
>NZ_CP044058.1|WP_053297119.1|2423286_2424696_-|glutamate--tRNA-ligase
MTRPVRTRFAPSPTGFIHLGNIRSALYPWAFARKMKGTFVLRIEDTDVERSSKEAVDAILEGMEWLGLDFDEGPIYQMQRMDRYREVLAQMLEKGLAYPCYMSAEELDALRERQRAAGLKPRYDGTWRPEPGKVLPEPPPGVKPVLRFRNPLTGTVVWDDAVKGRVEISNEELDDLVIARPDGTPIYNFCVVVDDMDMGITHVIRGDDHVNNTPRQINILRALGGEPPVYAHLPTVLNEQGEKMSKRHGAMSVMAYRDAGYLPEAVVNYLARLGWSHGDAEIFSREQFVEWFDLEHLGKSPAQYDHNKLNWLNAHYIKEADNARLAALAKPFLAALAIDDAALAAGPALEAVIALMKDRATTVKEIAEGAAMFYRVPAPDADALAQHVTDAVRPALADLAAALKAANWTKDAISAALKATLAAHKLKMPQLAMPVRLLVAGTTHTPSIDAVLALFDRDVVVSRIEAALA
>NZ_CP044058.1|WP_035488286.1|2421271_2421736_-|GNAT-family-N-acetyltransferase
MLDPTDLRLLYQLRPAEPGDFPFAEALTHGNMGGYYKRHGLVWRSDLFYASWRESENFILEADGQRIGVLRVTEEGDSLHIRDVQIAAGHRGRGAGTYLLDMSHRWARARGLHELQLRVFVDNPAARLYRRMGYHVTGPRLAQLGSIRHMVRPV
>NZ_CP044058.1|WP_053297120.1|2420384_2421263_+|helix-turn-helix-transcriptional-regulator
MHPIVPADASNPYDVIDIPPEFAPTRAHPMRVRARHVDAGSRIPLHTHAWAQLAYASRGVLRVATTGTTWMVPPSRAIWVPPHVTHEVAIVEEAYLRTLYIDESIVPDGLAACRVVEVTGLLRELIVALDARDLSDGRERLLCGLVLDELSRAEPLPLAVPMPDEKRLRTLCESVLAQPANAESLEHWASEVGASTRTISRLFKQELGVSFSQWRQQALLARAIPLLNQGRPLSHIARELGYQSQSAFSAMFRRAFGESPRAFMLRGYEHRGTERVAPSDDMRDDDAHDTVR
>NZ_CP044058.1|WP_006402610.1|2419719_2420214_-|RraA-family-protein
MTFATTDLCDAHEDKLAAGTLRVLQPALRPYGGAARFAGPAATLKVFEDNTLVRAALEQDGGGRVLVVDGGASLRCALVGGNLGALAEKNGWAGIVVHGCVRDAAELRECKVGVLALATHPRKSDKRGAGERDVPVTVLGTRIAPGEWIYADDDGVLVSATSLT
>NZ_CP044058.1|WP_006402937.1|2433354_2433687_-|cytochrome-o-ubiquinol-oxidase-subunit-IV
MAHSHSSQLEEGHGSVGSYVAGFILSVLLTAASFGLVMGGVLSPHASLVALAVLAFVQIVVHLVYFLHMNGSSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMSR
>NZ_CP044058.1|WP_006402938.1|2433687_2434296_-|cytochrome-o-ubiquinol-oxidase-subunit-III
MLQKTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIPGVAIETAALLLSSITYGFAMLAAYKQRRGALLGWLAVTFVLGAAFLAMELREFSHLIAEGAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVARGGDLTDRDLRRLTCLSLFWHFLDIVWICVFTFVYLASVI
>NZ_CP044058.1|WP_006408218.1|2434295_2436302_-|cytochrome-o-ubiquinol-oxidase-subunit-I
MFGKLTLSAIPFDQPIIMGAGAFMGLVVLGILAALTITGRWKWLWTEWLTTVDHKKLGVMYIIVALIMLLRGFADAIMMRMQLALAYNAPGYLPPHHYDQIFTAHGVIMIFFMAMVFMVGLMNLIVPLQIGARDVAFPFINSLSFWMTAVSAILINISLVIGEFAQTGWLAYPPLSELQFSPGVGVDYYLWALQISGVGTLLTGVNFFVTIIKMRAPGMTLMKMPVFTWTALCTNVLIMASFPILTATLALLGLDRYLGMHFFTNEAGGNAMLYLNLIWAWGHPEVYILILPAFGIFSEVIATFSKKPLFGYKTMVYATCAIMVLSFLVWLHHFFTMGSGANVNAFFGIMTMIIAIPTGVKVFNWLFTMYRGRIRFTTPVLWTIGFMVTFTLGGMTGVMMAIPGADFVLHNSLFLIAHFHNVIIGGVLFGYLAGFNYWFPKAFGFKLNETLGKAAFWFWQVGFYVAFVPLYVLGFMGMTRRLNHYDNPAWHPWLLVAAFGAVLIAIGIACQLLQLVVSIRNRNLPAYRDTTGDPWGGRTLEWATTSPPAEYNFAVIPQVRTLDAYADMKARGDTRANPAAIRDIHMPSNTCAGLVIGVFSLVLGFALVWHIWWLAIAGLVGIVATLVIYSSRDNDGYYIPASTVRKTEDKQSSKRAIARVDDVELEAN
>NZ_CP044058.1|WP_035488290.1|2436305_2437193_-|ubiquinol-oxidase-subunit-II
MKRRASRGWATLMSIGAVLSLSGCNLDVLNPKGSVGAAEKSLIATSTWAMLIVVVPVILLTLWFAWRYRASNRNATYAPDWSHSTAIEVVIWTVPTLIILFLGVLTWKTTHELDPYKPLESSVKPIDVEVVALDWKWLFIYPELGIASVNQLAIPVGTPVNFRITSDSVMNSFFIPQLGGQVYAMAGMQTRLHLIADEPGNYAGTSANFSGRGFSDMKFRTLAEPREQFDAWVQKVKASPDRLDATVYGQVAQPSEKAPVRYFSSVDPRLFHNIIAKYNDGHVLDLKDAACGTKG
>NZ_CP044058.1|WP_053297114.1|2437458_2438988_-|NADH-quinone-oxidoreductase-subunit-M
MHDFPFLSLAIWAPILFGACLLRAGSDQHLQRTRLIALIGAIAGLAAVAPIVAGFDPHSAAMQFVENRNGLSAFGAGWRTGVDGASLWLVVLTAFTTLVVVVATWQAVTVRVAQYYASFLILSGLMIGVFVAQDGLLFFIFFEATLIPLYLLIGTWGREHRVYAAVKFFFISFAGSLLLLMAMLYLYAKSHTFDMAAWRTLQLGFAPQLLVFLGFFAAFAVKVPMWPVHTWLRDVYTDGPTGAALMLAMLKLGGYGFLRFALPITPDASHFFAPAVIALSLFAIVYASLLALAQTDFGKLLAYSTVAHMGIVTLGLFLFNRIGVEGAIVQLVSYGFVAGAMLLCASVLVDRTKQREMTAYGGVASAMPRFAMFAVLFAMANVGLPGTSGFVGEFMVIMGAIRVNFWIGAAAALTLIFSASYTLWMLKRVVWGRAPSASIAKLVDLSGREIAMFASLALIVLAVGIYPKPFTDAIDPTVGRLLADASRSKLPAGDDTAPAQPAYMAAAHD
>NZ_CP044058.1|WP_006397282.1|2439578_2440799_-|ISL3-family-transposase
MLDRKALEALGCWTGYRLERVEWPEGEGRTLSLYLKPVGKIMYCEQCGARCQRIHETTVRRVRDLPLFEYRVVLHVPRRRVWCERCGGPRLEKLAWLGRYQRVTERFAKACEKLLQAASVQAVAAFYDLGWHTVKSIDKMRLRARVSEPDWSTIRYLAMDEFALHKGHRYATVVVDPISRQVLWIGPGRSRETARAFFEQLPEGAAKRIEAVAIDMTTAYELEIREQCPQAEIVFDLYHVVAKYGREVIDRVRVDQANQLRHDKPARKVLKSSRWLLLRNRHNLKPDQAVHLKELLAANQALLCVYVLRDELKRLWFYRKPAWAQKAWEQWFEQAQQSGIAALQKFAERLQGYWHGIVTRCRHPLNTSIVEGINNTIKVIKRRAYGYRDDEYFFLKIRAAFPGNPR
>NZ_CP044058.1|WP_006408212.1|2441138_2442389_-|aspartate-kinase
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQPSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDSAFTKARIHSIDDERVKADLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALGAEECLIYTDVDGVYTTDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIALDEEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDVDMIIQNQSVQGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVQGDPKVSKVSVVGVGMRSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELEQA
>NZ_CP044058.1|WP_053297109.1|2442731_2444138_-|tRNA-lysidine(34)-synthetase-TilS
MIPPNQYSADRVVLDAVGVALSGVPGGARIAIAYSGGLDSSVLLDAAVRVAGASRCVALHVHHGLSANADAWAAHAREQAARLGVAFEAMHVDVPRDSGVGIEASARERRYAALDAMCARHGAAALWLAQHADDQAETVLLQLLRGAGIAGLAAMAPRYRPDDASVERVRPLLRLLRAQLERYAAEHALSWIDDESNADTRYARNALRIDVLPALAVHFPGFRDALGRAAQHAAAAQRLLDDLAELDFVAAARDDGRALSRDALIAFDDVRGANLLRYWMRRLGLPGASAARLADMMRQLRDAHDAHALRVDHAGQCLRLYRDTVYWEAGDSAAPRDDGTGTPHADASLAWDGQEIWHLPGWRGTFVFARADAGSDDALPETLLRSAPLIARARAGGERMRMWPDGPSRTLKNLFQERGVPAWQRDVPLLFAGDRLIYVPRLGVNRDGVPQGGHAWRRIEWRPDLLIA
>NZ_CP044058.1|WP_006408210.1|2444184_2445156_-|acetyl-CoA-carboxylase-carboxyltransferase-subunit-alpha
MKTTFLDFEQPIAELEAKIEELRFVQDDSAVDISEEIERLSKKSQQLTKDLYANLTPWQVSQIARHPQRPYTLDYVAELFTDFHELHGDRAFADDLSIVGGLARFGGHPCMVIGHQKGRDTKERAARNFGMPRPEGYRKAERLMRLAEKFGLPIFTFVDTPGAYPGIGAEERGQSEAIGRNLYVMAELKTPIITTVIGEGGSGGALAIAVADTVMMLQFSTYSVISPEGCASILWKSAAKAPEAAEALGLTAHRLKALGLIDKIVNEPLGGAHRDPKGMAALLRRALADSLRQFQGMSIDALRERRFERLMAYGKFKETTPGA
>NZ_CP044058.1|WP_006401893.1|2445258_2446140_-|DNA-3-methyladenine-glycosylase-2-family-protein
MATARKAPVRRATPVAARPAARRAPAAKTDAARAVPNGALNGHVQPAAKHARAKGAEPAQPDHAMQAVDATRKARAADAAGDGEDDVVVRPAYWDKACADLVKRDRILKKLIPKFGPAHLVKRGDPFVTLARSVVGQQISVPSAQSLWARIQAACPKLAPQPVIRLGADKLIACGLSKRKTEYILDLAQHFVSGALHVDKWTSMEDEAVIAELTQIRGISRWTAEMFLIFNLSRPDVLPLDDPGLIRAISVNYFSGEPVTRSEAREVAANWEPWRTVATWYMWRSLDALDAGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 13996

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035946349.1\|580_1753_-	flagellar basal body P-ring protein FlgI	NA	NA	NA	NA
WP_006402762.1\|1758_2448_-	flagellar basal body L-ring protein FlgH	NA	NA	NA	NA
WP_150331627.1\|2466_3255_-	flagellar basal-body rod protein FlgG	NA	NA	NA	NA
WP_006409606.1\|3292_4051_-	flagellar basal-body rod protein FlgF	NA	NA	NA	NA
WP_006409603.1\|4071_5313_-	flagellar hook protein FlgE	NA	NA	NA	NA
WP_006402758.1\|5340_6084_-	flagellar hook assembly protein FlgD	NA	NA	NA	NA
WP_006402757.1\|6139_6565_-	flagellar basal body rod protein FlgC	NA	NA	NA	NA
WP_006402756.1\|6605_7094_-	flagellar basal body rod protein FlgB	NA	NA	NA	NA
WP_053297780.1\|7295_8462_+	flagellar basal body P-ring formation protein FlgA	NA	NA	NA	NA
WP_006402754.1\|8562_8901_+	flagellar biosynthesis anti-sigma factor FlgM	NA	NA	NA	NA
WP_006402753.1\|8946_9387_+	flagellar protein FlgN	NA	NA	NA	NA
WP_053297781.1\|9454_11305_-	M24 family metallopeptidase	NA	NA	NA	NA
WP_053297782.1\|11788_12637_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_006402749.1\|12754_13996_-	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	1.8e-78	41.8

DBSCAN-SWA_2

25969 : 27981

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006408052.1\|25969_26986_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-18	31.1
WP_006402733.1\|26982_27981_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-17	30.7

DBSCAN-SWA_3

31996 : 33304

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297791.1\|31996_33304_-	MFS transporter	Q6JIH2	Burkholderia_virus	5.1e-95	46.2

DBSCAN-SWA_4

55677 : 57318

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297801.1\|55677_57318_-	GMC family oxidoreductase	A0A2I2L3D3	Orpheovirus	5.7e-35	28.6

DBSCAN-SWA_5

66070 : 71535

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407179.1\|66070_67258_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	2.9e-121	60.7
WP_006407180.1\|67523_68408_+	lauroyl acyltransferase	A0A1W6JP29	Morganella_phage	1.2e-28	29.5
WP_081000627.1\|68444_68609_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_069220655.1\|68725_68905_+	hypothetical protein	NA	NA	NA	NA
WP_053297805.1\|68963_69833_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_012214346.1\|69872_70601_+	DUF484 family protein	NA	NA	NA	NA
WP_006402990.1\|70614_71535_+	tyrosine recombinase XerC	G1JX48	Mycobacterium_phage	8.2e-15	29.2

DBSCAN-SWA_6

75307 : 170884

102

Burkholderia_phage(77.59%)

tRNA,terminase,holin,tail,plate,head,capsid,integrase,portal,protease

attL 132705:132752|attR 171003:171050

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402996.1\|75307_75844_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_006402997.1\|75854_77198_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	1.8e-42	29.2
WP_006402999.1\|77291_77834_-	response regulator transcription factor	NA	NA	NA	NA
WP_006407189.1\|77848_79252_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_006407190.1\|79351_79576_-	hypothetical protein	NA	NA	NA	NA
WP_006410841.1\|79735_79912_+	hypothetical protein	NA	NA	NA	NA
WP_006401887.1\|79869_80769_+	acetylglutamate kinase	NA	NA	NA	NA
WP_053297808.1\|80765_81557_+	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_053297809.1\|81523_82189_+	nucleoid occlusion factor SlmA	NA	NA	NA	NA
WP_006407196.1\|82647_83211_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_053297810.1\|83304_84069_+	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_006407198.1\|84139_86863_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_053297811.1\|86859_87903_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_006407200.1\|88135_88675_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_053297832.1\|89225_92234_+	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_006401873.1\|92523_93669_+	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_006401872.1\|93665_94274_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
WP_006407205.1\|94415_95837_+	AmpG family muropeptide MFS transporter	NA	NA	NA	NA
WP_053297812.1\|95826_96885_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_006407207.1\|96898_97849_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_006412226.1\|98078_99131_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	5.6e-84	47.0
WP_006407209.1\|99233_100004_-	exodeoxyribonuclease III	R4TWA8	Phaeocystis_globosa_virus	6.0e-27	31.6
WP_053297813.1\|100042_100882_-	polyphosphate kinase 2 family protein	NA	NA	NA	NA
WP_006407211.1\|100997_102470_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_053297814.1\|102474_103965_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_006407213.1\|104035_104335_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_004189550.1\|104699_105743_+	rod shape-determining protein	NA	NA	NA	NA
WP_053297815.1\|105868_106954_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_053297816.1\|106950_107463_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_053297817.1\|107565_109893_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_006401857.1\|109904_111053_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_006407216.1\|111095_111869_-	sel1 repeat family protein	NA	NA	NA	NA
WP_006401855.1\|111865_112651_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
WP_006401854.1\|112876_113329_-	6-carboxytetrahydropterin synthase QueD	A0A088FAL2	Vibrio_phage	2.0e-14	31.4
WP_006407217.1\|113348_113981_-	7-carboxy-7-deazaguanine synthase	R4TAH8	Halovirus	1.9e-07	33.6
WP_006401852.1\|114055_114790_-	7-cyano-7-deazaguanine synthase QueC	A0A1B0Z0B4	Vibrio_phage	2.1e-50	43.5
WP_006401851.1\|115253_115955_-	response regulator	NA	NA	NA	NA
WP_053297819.1\|115955_118409_-	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_006401849.1\|118398_118989_-	DUF4390 domain-containing protein	NA	NA	NA	NA
WP_006407219.1\|118985_120389_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_053297820.1\|120572_121430_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_006407221.1\|121527_122169_-	LysE family translocator	NA	NA	NA	NA
WP_053297821.1\|122290_123274_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.6e-08	37.2
WP_006410713.1\|123308_123812_-	peptide deformylase	A0A067XQZ3	Caulobacter_phage	1.1e-13	32.1
WP_053297833.1\|124043_125336_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	5.7e-22	35.6
WP_006407224.1\|125373_125754_+	thioredoxin family protein	NA	NA	NA	NA
WP_006401840.1\|125958_128556_+	DNA topoisomerase III	A0A2P1ELA0	Moumouvirus	3.4e-18	24.7
WP_006401839.1\|128700_129750_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_053297822.1\|130173_131187_+	D-2-hydroxyacid dehydrogenase family protein	M1HBE3	Paramecium_bursaria_Chlorella_virus	8.7e-10	23.2
WP_006407226.1\|131206_132073_-	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_053297823.1\|132081_132486_-	PaaI family thioesterase	NA	NA	NA	NA
132705:132752	attL	NA	NA	NA	NA
WP_150331630.1\|132935_133478_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	9.5e-64	69.9
WP_150331631.1\|134264_135371_+	DUF3396 domain-containing protein	E5E3X7	Burkholderia_phage	2.2e-115	55.6
WP_150331632.1\|135495_135702_+	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_150331633.1\|135701_136859_+	DNA (cytosine-5-)-methyltransferase	I6NLI4	Burkholderia_phage	1.7e-147	66.2
WP_105768782.1\|136855_137713_+	hypothetical protein	I6NTM1	Burkholderia_phage	8.4e-115	66.2
WP_105768781.1\|137663_138131_+	very short patch repair endonuclease	I6NSG0	Burkholderia_phage	4.1e-31	50.4
WP_053298901.1\|138577_139630_-\|portal	phage portal protein	E5E3S7	Burkholderia_phage	6.6e-202	97.7
WP_088925282.1\|139629_141396_-\|terminase	terminase ATPase subunit family protein	E5E3S6	Burkholderia_phage	0.0e+00	99.1
WP_048805735.1\|141545_142367_+\|capsid	GPO family capsid scaffolding protein	E5E3S5	Burkholderia_phage	8.9e-146	99.6
WP_150331634.1\|142403_143429_+\|capsid	phage major capsid protein, P2 family	E5E3S4	Burkholderia_phage	1.6e-192	99.7
WP_065495427.1\|143425_144112_+\|terminase	terminase endonuclease subunit	E5E3S3	Burkholderia_phage	5.2e-123	97.8
WP_048805732.1\|144215_144692_+\|head	head completion/stabilization protein	E5E3S2	Burkholderia_phage	3.4e-81	97.5
WP_065495429.1\|144691_144934_+	hypothetical protein	E5E3S1	Burkholderia_phage	3.3e-32	93.8
WP_048805730.1\|144933_145146_+\|tail	tail protein	E5E3S0	Burkholderia_phage	5.2e-34	98.6
WP_048805729.1\|145148_145523_+	membrane protein	E5E3R9	Burkholderia_phage	6.0e-57	98.4
WP_048805728.1\|145522_145843_+\|holin	phage holin family protein	E5E3R8	Burkholderia_phage	2.3e-49	99.1
WP_150331635.1\|145835_146636_+	DUF3380 domain-containing protein	E5E3R7	Burkholderia_phage	8.4e-133	91.0
WP_150331636.1\|146632_147124_+	hypothetical protein	E5E3R5	Burkholderia_phage	7.3e-63	93.9
WP_043206379.1\|147120_147531_+\|tail	phage tail protein	E5E3R4	Burkholderia_phage	1.2e-71	96.3
WP_043206378.1\|147530_147980_+	phage virion morphogenesis protein	E5E3R3	Burkholderia_phage	2.1e-64	89.9
WP_105766424.1\|148397_149030_+\|plate	phage baseplate assembly protein V	E5E3R1	Burkholderia_phage	2.3e-117	99.0
WP_043206376.1\|149026_149404_+	hypothetical protein	E5E3R0	Burkholderia_phage	2.3e-64	98.4
WP_043206375.1\|149400_150306_+\|plate	baseplate assembly protein	A0A1S5NR72	Burkholderia_phage	3.4e-154	93.4
WP_088923692.1\|150298_150853_+\|tail	phage tail protein I	E5E3Q8	Burkholderia_phage	3.4e-93	92.4
WP_088923693.1\|150855_152466_+\|tail	phage tail protein	E5E3Q7	Burkholderia_phage	2.8e-252	95.0
WP_088923694.1\|152475_153312_+\|tail	phage tail protein	E5E3Q6	Burkholderia_phage	4.5e-145	89.3
WP_081000536.1\|153355_153541_-	hypothetical protein	NA	NA	NA	NA
WP_081000537.1\|153912_154095_+	Com family DNA-binding transcriptional regulator	E5E3Q5	Burkholderia_phage	3.2e-24	91.7
WP_105752289.1\|154072_154822_+	site-specific DNA-methyltransferase	E5E3Q4	Burkholderia_phage	9.6e-139	96.0
WP_105848056.1\|154933_156106_+\|tail	phage tail sheath protein	E5E3Q3	Burkholderia_phage	1.4e-224	98.7
WP_150331637.1\|156135_156645_+\|tail	phage major tail tube protein	E5E3Q2	Burkholderia_phage	2.7e-92	98.8
WP_150331638.1\|156677_156989_+\|tail	phage tail assembly protein	E5E3Q1	Burkholderia_phage	1.5e-45	97.1
WP_150331639.1\|156985_157108_+\|tail	GpE family phage tail protein	E5E3Q0	Burkholderia_phage	3.8e-13	90.0
WP_150331640.1\|157104_160356_+	hypothetical protein	A0A1S5NRM8	Burkholderia_phage	0.0e+00	80.6
WP_150331641.1\|160369_160798_+\|tail	phage tail protein	E5E3P8	Burkholderia_phage	6.1e-74	98.6
WP_105848052.1\|160794_161940_+	phage late control D family protein	E5E3P7	Burkholderia_phage	3.4e-196	98.9
WP_150331642.1\|162025_162478_-	hypothetical protein	NA	NA	NA	NA
WP_150331643.1\|162530_163277_-	alpha/beta hydrolase	E5E3P5	Burkholderia_phage	1.1e-73	60.1
WP_150331644.1\|163332_163794_-	helix-turn-helix domain-containing protein	K4NXA8	Burkholderia_phage	6.0e-59	80.4
WP_088925274.1\|163919_164114_+	hypothetical protein	E5E3P3	Burkholderia_phage	8.2e-26	95.3
WP_006416695.1\|164117_164396_+	hypothetical protein	E5E3P2	Burkholderia_phage	2.4e-47	100.0
WP_006401793.1\|164405_164654_+	ogr/Delta-like zinc finger family protein	E5E3P1	Burkholderia_phage	1.0e-36	89.0
WP_105752298.1\|164744_164939_+	hypothetical protein	E5E3P0	Burkholderia_phage	1.3e-26	92.2
WP_053296751.1\|164943_165147_+	hypothetical protein	E5E3N9	Burkholderia_phage	7.0e-28	98.5
WP_053296750.1\|165190_165385_+	hypothetical protein	K4NXL1	Burkholderia_phage	1.8e-20	79.4
WP_053296749.1\|165389_165749_+	hypothetical protein	E5E3N7	Burkholderia_phage	1.3e-40	73.9
WP_150331645.1\|165745_166009_+	hypothetical protein	E5E3N6	Burkholderia_phage	1.3e-34	91.7
WP_150331646.1\|166011_168804_+	hypothetical protein	E5E3N5	Burkholderia_phage	0.0e+00	95.8
WP_150331871.1\|168818_169367_+\|plate	Baseplate J family protein	A0A1S5NNJ0	Burkholderia_phage	6.1e-58	70.3
WP_150331872.1\|169537_169804_+	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_150331647.1\|169804_170884_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J8E5	uncultured_Caudovirales_phage	3.1e-29	30.7
171003:171050	attR	NA	NA	NA	NA

DBSCAN-SWA_7

180317 : 181409

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407233.1\|180317_181409_+	putative 2-aminoethylphosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.0e-27	34.3

DBSCAN-SWA_8

192016 : 193114

Powai_lake_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297844.1\|192016_193114_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A167R6J9	Powai_lake_megavirus	5.5e-18	42.7

DBSCAN-SWA_9

201041 : 207930

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035489464.1\|201041_201308_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	3.3e-17	55.1
WP_006412868.1\|201384_201792_-	ribonuclease P protein component	NA	NA	NA	NA
WP_004198824.1\|201861_201996_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_006407257.1\|202135_202411_-	hypothetical protein	NA	NA	NA	NA
WP_006407258.1\|202414_203989_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_006401750.1\|204157_205264_+	DNA polymerase III subunit beta	R9TRR6	Rhizobium_phage	3.7e-46	32.0
WP_006401749.1\|205455_207930_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	3.4e-116	34.7

DBSCAN-SWA_10

224870 : 227174

Acidithiobacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404121.1\|224870_225638_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	6.7e-71	53.8
WP_006404120.1\|225650_227174_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.2e-150	53.4

DBSCAN-SWA_11

231784 : 232825

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296641.1\|231784_232825_-	restriction endonuclease	A0A1B1IUE7	uncultured_Mediterranean_phage	7.9e-99	48.7

DBSCAN-SWA_12

242986 : 245761

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331653.1\|242986_245761_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	5.2e-57	27.7

DBSCAN-SWA_13

252521 : 257563

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296649.1\|252521_255545_-	DEAD/DEAH box helicase family protein	A0A2K5B256	Erysipelothrix_phage	1.1e-172	37.7
WP_006401726.1\|255544_257563_-	site-specific DNA-methyltransferase	A0A2K5B255	Erysipelothrix_phage	4.2e-80	32.3

DBSCAN-SWA_14

262757 : 263555

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407286.1\|262757_263555_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.4e-31	35.8

DBSCAN-SWA_15

288410 : 290716

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401507.1\|288410_288857_+	lytic transglycosylase domain-containing protein	A0A0K2QQJ4	Ralstonia_phage	3.0e-15	38.3
WP_012212456.1\|289020_290322_+	GTP-binding protein	NA	NA	NA	NA
WP_006401505.1\|290437_290716_-	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	1.1e-20	61.8

DBSCAN-SWA_16

306693 : 309643

Catovirus(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296662.1\|306693_308430_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	4.7e-56	30.1
WP_006401484.1\|308863_309643_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.2e-12	24.0

DBSCAN-SWA_17

317177 : 319717

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296666.1\|317177_318962_+	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A2R8FG22	Brazilian_cedratvirus	6.0e-14	28.4
WP_053296667.1\|318961_319717_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	7.2e-09	25.3

DBSCAN-SWA_18

322761 : 324465

Natrialba_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401472.1\|322761_323541_+	ParA family protein	Q8JL10	Natrialba_phage	4.6e-19	33.3
WP_006401471.1\|323571_324465_+	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	2.2e-17	38.7

DBSCAN-SWA_19

334124 : 335852

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006408100.1\|334124_335852_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	9.6e-33	31.7

DBSCAN-SWA_20

354238 : 356857

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331659.1\|354238_356857_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.8e-131	45.5

DBSCAN-SWA_21

376787 : 379715

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006408288.1\|376787_379715_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	3.9e-260	51.6

DBSCAN-SWA_22

383942 : 386030

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012467743.1\|383942_386030_+	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	7.6e-101	35.1

DBSCAN-SWA_23

392048 : 393191

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006411258.1\|392048_393191_-	DegT/DnrJ/EryC1/StrS family aminotransferase	C7U074	Ostreococcus_tauri_virus	6.2e-12	25.8

DBSCAN-SWA_24

405424 : 405721

EBPR_podovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401402.1\|405424_405721_+	H-NS histone family protein	F8TUP5	EBPR_podovirus	2.2e-06	42.6

DBSCAN-SWA_25

414165 : 419483

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331661.1\|414165_416145_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	9.0e-11	44.9
WP_059938193.1\|416148_417135_+	chemotaxis protein CheR	NA	NA	NA	NA
WP_053296702.1\|417131_417932_+	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
WP_012212515.1\|417928_419020_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_006401389.1\|419087_419483_+	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	9.2e-08	32.8

DBSCAN-SWA_26

429571 : 430993

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080512292.1\|429571_430993_+	adenosylhomocysteinase	S4VPF6	Pandoravirus	1.5e-44	30.6

DBSCAN-SWA_27

442346 : 445871

Agrobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401366.1\|442346_443006_-	hypothetical protein	A0A2L0UZL4	Agrobacterium_phage	1.2e-31	38.1
WP_006401365.1\|443002_443647_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_006401363.1\|444145_444337_-	hypothetical protein	NA	NA	NA	NA
WP_006401362.1\|444302_444911_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	6.6e-21	58.8
WP_006401361.1\|444992_445871_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.7e-41	43.7

DBSCAN-SWA_28

454564 : 455263

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296713.1\|454564_455263_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-35	40.0

DBSCAN-SWA_29

468210 : 468897

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401311.1\|468210_468897_-	orotate phosphoribosyltransferase	S4VS55	Pandoravirus	7.2e-16	28.6

DBSCAN-SWA_30

493058 : 494249

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400660.1\|493058_494249_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	2.0e-13	27.9

DBSCAN-SWA_31

498257 : 513414

Cafeteria_roenbergensis_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400665.1\|498257_502364_+	DNA-directed RNA polymerase subunit beta	E3T4Z4	Cafeteria_roenbergensis_virus	9.3e-26	21.3
WP_006400664.1\|502385_506627_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	6.1e-73	28.0
WP_053296727.1\|506721_508704_+	DNA helicase RecQ	A0A2K9L3P7	Tupanvirus	1.2e-71	34.2
WP_080512315.1\|508751_508949_-	hypothetical protein	NA	NA	NA	NA
WP_006400662.1\|508931_509312_+	30S ribosomal protein S12	NA	NA	NA	NA
WP_004198359.1\|509484_509955_+	30S ribosomal protein S7	NA	NA	NA	NA
WP_006400661.1\|510078_512181_+	elongation factor G	E4ZFJ7	Streptococcus_phage	8.9e-57	27.0
WP_006400660.1\|512223_513414_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	2.0e-13	27.9

DBSCAN-SWA_32

552693 : 554575

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045593833.1\|552693_553779_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	3.7e-22	35.1
WP_053296734.1\|553798_554575_+	glycerophosphodiester phosphodiesterase	M1HTS7	Paramecium_bursaria_Chlorella_virus	7.1e-12	24.4

DBSCAN-SWA_33

574600 : 575422

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400595.1\|574600_575422_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-21	29.9

DBSCAN-SWA_34

578969 : 579896

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406984.1\|578969_579896_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.1e-22	30.2

DBSCAN-SWA_35

591900 : 594062

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400571.1\|591900_592683_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	3.0e-26	29.6
WP_006400570.1\|592853_594062_-	Do family serine endopeptidase	A0A1B1IRD3	uncultured_Mediterranean_phage	1.5e-11	34.3

DBSCAN-SWA_36

598606 : 630988

uncultured_Caudovirales_phage(27.27%)

plate,transposase,protease,integrase

attL 599179:599198|attR 608320:608339

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406974.1\|598606_599128_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	7.4e-21	53.0
599179:599198	attL	NA	NA	NA	NA
WP_150331876.1\|599299_599503_-\|integrase	integrase	E5E3T0	Burkholderia_phage	2.4e-28	92.5
WP_150331666.1\|599606_600044_-	ester cyclase	NA	NA	NA	NA
WP_150331667.1\|600213_601215_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_150331668.1\|601120_602032_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_150331669.1\|602134_603034_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_150331670.1\|603269_604589_-	DUF3883 domain-containing protein	NA	NA	NA	NA
WP_150331671.1\|604585_605779_-	DNA (cytosine-5-)-methyltransferase	M1PSQ0	Streptococcus_phage	1.2e-31	32.6
WP_150331672.1\|605791_607411_-	Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase	NA	NA	NA	NA
WP_059649961.1\|607464_607761_-	hypothetical protein	NA	NA	NA	NA
WP_150331673.1\|607965_608172_+	AlpA family phage regulatory protein	E5E3Y1	Burkholderia_phage	8.7e-26	88.1
WP_105840522.1\|608396_609656_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
608320:608339	attR	NA	NA	NA	NA
WP_006400562.1\|610422_610626_+	hypothetical protein	NA	NA	NA	NA
WP_150331674.1\|610738_611539_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_081000538.1\|611567_611762_+	hypothetical protein	NA	NA	NA	NA
WP_150331675.1\|611870_615050_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	3.9e-56	27.1
WP_053296771.1\|615106_619750_+	RHS repeat protein	A0A2H4JFP5	uncultured_Caudovirales_phage	6.5e-44	46.8
WP_150331618.1\|620769_622004_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	3.7e-103	65.5
WP_035489409.1\|622306_622732_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_081000539.1\|622724_622889_+	RHS repeat-associated core domain-containing protein	A0A2H4JFP5	uncultured_Caudovirales_phage	1.4e-15	72.7
WP_006404120.1\|623792_625316_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.2e-150	53.4
WP_006404121.1\|625328_626096_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	6.7e-71	53.8
WP_081336710.1\|626805_627147_+	hypothetical protein	NA	NA	NA	NA
WP_150331676.1\|627349_627829_+	hypothetical protein	NA	NA	NA	NA
WP_035489411.1\|628459_628777_+	hypothetical protein	NA	NA	NA	NA
WP_006406963.1\|628862_629645_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_006409507.1\|629641_630988_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_37

638912 : 645372

Agrobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297739.1\|638912_641582_+	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	2.2e-89	31.7
WP_006409504.1\|641620_642742_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_053297738.1\|642810_645372_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.8e-57	26.9

DBSCAN-SWA_38

660212 : 662384

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406942.1\|660212_662384_-	peptidase M1	A0A0P0IY26	Acinetobacter_phage	1.1e-49	26.4

DBSCAN-SWA_39

670812 : 671016

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400508.1\|670812_671016_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.4e-20	71.6

DBSCAN-SWA_40

676062 : 684542

Pseudomonas_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400499.1\|676062_677145_-	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	8.7e-08	44.8
WP_006406930.1\|677227_678526_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_006406929.1\|678552_679314_-	response regulator transcription factor	NA	NA	NA	NA
WP_006406928.1\|679482_679737_+	hypothetical protein	NA	NA	NA	NA
WP_053297717.1\|679755_681570_+	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	1.9e-172	50.3
WP_006412104.1\|681628_682180_+	isochorismatase family protein	NA	NA	NA	NA
WP_053297716.1\|682176_682800_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_006400488.1\|682874_684542_-	energy-dependent translational throttle protein EttA	A0A2K9L0W2	Tupanvirus	4.4e-43	28.1

DBSCAN-SWA_41

697230 : 702719

Acinetobacter_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297707.1\|697230_698127_-	uracil-DNA glycosylase	E2IUG8	Saimiriine_herpesvirus	1.5e-50	51.4
WP_053297706.1\|698140_698767_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_006406909.1\|698766_699552_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	3.8e-53	46.7
WP_006406908.1\|699580_700612_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	6.2e-80	46.4
WP_053297705.1\|700624_701212_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	2.6e-67	60.0
WP_053297676.1\|701225_702719_-	anthranilate synthase component I	A0A0B5J984	Pandoravirus	5.5e-37	31.2

DBSCAN-SWA_42

719262 : 723149

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297670.1\|719262_721338_+	molybdopterin oxidoreductase family protein	A0A077SK27	Escherichia_phage	3.9e-49	26.1
WP_053297669.1\|721475_723149_+	long-chain fatty acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	2.9e-34	27.3

DBSCAN-SWA_43

743419 : 743926

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407636.1\|743419_743926_+	peroxiredoxin	M1I839	Pelagibacter_phage	1.3e-27	44.7

DBSCAN-SWA_44

750968 : 751430

Rhizoctonia_fumigata_mycovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407631.1\|750968_751430_+	NUDIX domain-containing protein	A0A0B5CYJ3	Rhizoctonia_fumigata_mycovirus	1.7e-05	42.1

DBSCAN-SWA_45

761716 : 762835

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400417.1\|761716_762835_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.6e-63	43.0

DBSCAN-SWA_46

771247 : 775810

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407618.1\|771247_774235_+	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	4.5e-171	44.4
WP_006407617.1\|774352_774535_+	hypothetical protein	NA	NA	NA	NA
WP_035489625.1\|774598_775810_+	ribonucleotide-diphosphate reductase subunit beta	A0A2P0VNY9	Tetraselmis_virus	1.5e-40	31.5

DBSCAN-SWA_47

796889 : 800360

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297661.1\|796889_797669_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.8e-10	39.8
WP_006407596.1\|797776_798772_+	arabinose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006407595.1\|798848_800360_+	L-arabinose ABC transporter ATP-binding protein AraG	A0A2H4PQG7	Staphylococcus_phage	1.0e-14	29.0

DBSCAN-SWA_48

805550 : 806051

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400369.1\|805550_806051_-	CinA family protein	B5TK85	Pseudomonas_phage	6.4e-30	48.4

DBSCAN-SWA_49

812351 : 812768

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006411974.1\|812351_812768_-	VOC family protein	A0A2K9L1J4	Tupanvirus	9.4e-11	30.6

DBSCAN-SWA_50

819291 : 820191

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407576.1\|819291_820191_+	transcriptional regulator CynR	A0A2P0ZL89	Lactobacillus_phage	4.4e-13	26.4

DBSCAN-SWA_51

827935 : 833658

Staphylococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297641.1\|827935_830530_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.4e-176	40.5
WP_006400343.1\|830568_831120_+	hypothetical protein	NA	NA	NA	NA
WP_006407568.1\|831138_832233_+	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_080512296.1\|832248_832434_-	hypothetical protein	NA	NA	NA	NA
WP_053297640.1\|832386_833658_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	6.7e-84	47.2

DBSCAN-SWA_52

842636 : 844025

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407558.1\|842636_844025_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	1.3e-109	47.1

DBSCAN-SWA_53

849387 : 850113

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401697.1\|849387_850113_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.8e-31	39.4

DBSCAN-SWA_54

862107 : 862479

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401687.1\|862107_862479_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	1.6e-30	58.3

DBSCAN-SWA_55

867532 : 871802

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401680.1\|867532_868600_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.4e-10	27.4
WP_006401679.1\|868696_869278_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_053297629.1\|869476_870019_-	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_053297628.1\|870236_871802_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	8.3e-68	47.1

DBSCAN-SWA_56

894991 : 901347

uncultured_Mediterranean_phage(75.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006410366.1\|894991_896269_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.4e-84	44.6
WP_006401649.1\|896493_897444_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.1e-41	34.6
WP_053297617.1\|897462_899484_-	protein translocase subunit SecD	NA	NA	NA	NA
WP_006401647.1\|899589_899913_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.0e-12	42.2
WP_006408350.1\|900147_901347_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	9.8e-85	45.5

DBSCAN-SWA_57

905263 : 906223

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401641.1\|905263_906223_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.0e-08	25.2

DBSCAN-SWA_58

909413 : 909908

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297614.1\|909413_909908_+	DNA starvation/stationary phase protection protein	A0A2H4N7L5	Lake_Baikal_phage	1.8e-21	36.9

DBSCAN-SWA_59

917251 : 925469

Pandoravirus(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297612.1\|917251_918661_-	FAD-binding protein	S4VXI2	Pandoravirus	3.9e-08	29.2
WP_006401622.1\|918915_919467_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_053297611.1\|919562_920771_+	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_053297610.1\|920849_921239_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_039224543.1\|921235_921505_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_053297609.1\|921620_922694_-	3-deoxy-7-phosphoheptulonate synthase AroG	A0A2I6UFP9	Klebsiella_phage	5.0e-80	48.2
WP_006408370.1\|923089_924556_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_006408371.1\|924641_925469_-	carbon-nitrogen hydrolase family protein	M1HHT1	Paramecium_bursaria_Chlorella_virus	5.8e-12	26.9

DBSCAN-SWA_60

939914 : 960577

Enterobacteria_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401601.1\|939914_941861_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.7e-148	51.2
WP_053297605.1\|942125_943256_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	2.8e-25	39.0
WP_053297604.1\|943259_945122_+	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	1.2e-60	38.5
WP_053297603.1\|945225_946041_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	9.7e-36	32.9
WP_006401597.1\|946087_946774_-	deoxynucleoside kinase	S5MMC6	Bacillus_phage	3.3e-13	28.9
WP_006401596.1\|946770_947310_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_035949390.1\|947345_948884_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	6.1e-23	30.7
WP_006401594.1\|948889_949567_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_080559109.1\|949578_950526_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
WP_006401591.1\|950551_951607_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SEW4	Cyanophage	6.4e-72	45.0
WP_053297602.1\|951707_952103_+	SgcJ/EcaC family oxidoreductase	NA	NA	NA	NA
WP_053297601.1\|952196_953174_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_053297600.1\|953170_955156_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.0e-78	33.4
WP_006401587.1\|955328_956012_+	DedA family protein	NA	NA	NA	NA
WP_006401586.1\|956207_957020_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_053297598.1\|957154_958066_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	7.5e-29	35.0
WP_053297597.1\|958074_958626_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	3.2e-51	55.2
WP_150331683.1\|958610_959504_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.3e-97	58.4
WP_035489225.1\|959515_960577_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.1e-87	48.3

DBSCAN-SWA_61

971935 : 973183

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401565.1\|971935_973183_+	serine hydroxymethyltransferase	A0A219YCZ0	Aeromonas_phage	8.3e-95	51.7

DBSCAN-SWA_62

992732 : 1004959

Acinetobacter_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406378.1\|992732_993731_-	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	7.9e-64	44.3
WP_053297583.1\|993765_994749_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006411571.1\|995486_996698_+	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
WP_006401532.1\|996716_997652_-	helix-turn-helix transcriptional regulator	A0A291LAM3	Bordetella_phage	8.3e-15	34.0
WP_053297582.1\|997781_998672_+	EamA family transporter	NA	NA	NA	NA
WP_006401530.1\|998787_1000002_-	MFS transporter	NA	NA	NA	NA
WP_053297581.1\|1000353_1001949_+	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	1.1e-126	48.5
WP_053297580.1\|1001967_1004322_+	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	3.7e-237	55.2
WP_053297579.1\|1004323_1004959_+	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	1.9e-23	41.2

DBSCAN-SWA_63

1028318 : 1030298

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400974.1\|1028318_1028612_+	co-chaperone GroES	A0A221S4A8	uncultured_virus	1.6e-17	42.6
WP_006400973.1\|1028657_1030298_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	7.1e-171	62.6

DBSCAN-SWA_64

1034929 : 1035961

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400966.1\|1034929_1035961_+	aspartate carbamoyltransferase catalytic subunit	A0A1J0F9B8	Only_Syngen_Nebraska_virus	2.5e-28	33.7

DBSCAN-SWA_65

1039402 : 1042819

Enterobacteria_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400962.1\|1039402_1040464_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	3.7e-88	48.6
WP_150331685.1\|1040475_1041369_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	1.8e-96	60.9
WP_053297558.1\|1041353_1041905_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	7.0e-46	52.0
WP_053297557.1\|1041901_1042819_+	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	3.9e-25	31.6

DBSCAN-SWA_66

1046619 : 1052567

Anomala_cuprea_entomopoxvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297554.1\|1046619_1047336_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.7e-12	26.5
WP_053297553.1\|1047383_1049237_+	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_053297552.1\|1049548_1050703_+	NAD(P)-binding protein	E4ZFQ1	Streptococcus_phage	1.6e-76	42.7
WP_053297551.1\|1050699_1051560_+	glycosyltransferase	NA	NA	NA	NA
WP_150331687.1\|1051622_1052567_+	NAD-dependent epimerase/dehydratase family protein	M4QPK0	Synechococcus_phage	1.1e-27	29.3

DBSCAN-SWA_67

1056576 : 1060019

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081000600.1\|1056576_1057680_-	sulfotransferase family 2 domain-containing protein	B2ZYD5	Ralstonia_phage	1.2e-44	40.8
WP_053297546.1\|1057859_1058969_-	glycosyl transferase	NA	NA	NA	NA
WP_006406324.1\|1058996_1060019_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	1.2e-86	48.2

DBSCAN-SWA_68

1063537 : 1064932

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400938.1\|1063537_1064932_+	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	7.7e-57	32.1

DBSCAN-SWA_69

1074053 : 1075608

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400919.1\|1074053_1074746_-	urea ABC transporter ATP-binding subunit UrtE	G9BWD6	Planktothrix_phage	1.2e-13	26.8
WP_006406305.1\|1074750_1075608_-	urea ABC transporter ATP-binding protein UrtD	A0A2R8FG22	Brazilian_cedratvirus	1.5e-10	25.2

DBSCAN-SWA_70

1091886 : 1093288

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406291.1\|1091886_1092756_+	NAD-dependent protein deacetylase	S5M4R0	Bacillus_phage	1.6e-07	23.4
WP_006400837.1\|1092901_1093288_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	1.7e-22	53.5

DBSCAN-SWA_71

1102034 : 1103747

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400826.1\|1102034_1102553_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.4e-19	38.7
WP_048994405.1\|1102604_1103747_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.4e-48	36.2

DBSCAN-SWA_72

1108859 : 1118234

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297559.1\|1108859_1109489_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	6.1e-30	40.6
WP_006400822.1\|1109503_1110625_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2I2L4R9	Orpheovirus	2.2e-46	34.5
WP_006406286.1\|1110637_1111921_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_035489288.1\|1112094_1112550_-	hypothetical protein	NA	NA	NA	NA
WP_053297529.1\|1112587_1112743_-	hypothetical protein	NA	NA	NA	NA
WP_006400819.1\|1112781_1113999_+	Bcr/CflA family multidrug efflux MFS transporter	S4TR35	Salmonella_phage	1.3e-28	27.1
WP_006400818.1\|1114091_1116020_-	bifunctional transcriptional regulator/glucokinase	NA	NA	NA	NA
WP_012213937.1\|1115997_1116678_-	6-phosphogluconolactonase	NA	NA	NA	NA
WP_006400816.1\|1116764_1118234_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	3.9e-75	35.0

DBSCAN-SWA_73

1121988 : 1132363

Bacillus_virus(40.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048996697.1\|1121988_1123107_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	6.9e-24	34.8
WP_006400811.1\|1123226_1123850_-	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_035489261.1\|1123836_1124613_-	DNA mismatch repair protein MutS	NA	NA	NA	NA
WP_006400809.1\|1124745_1125708_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	1.3e-60	42.6
WP_053297528.1\|1126029_1128339_+	DNA translocase FtsK	G1FGP1	Mycobacterium_phage	1.1e-84	50.0
WP_006406277.1\|1128386_1129076_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_150331690.1\|1129224_1130535_+	AAA family ATPase	G3MBE0	Bacillus_virus	1.4e-81	40.0
WP_006400805.1\|1130547_1130814_-	DUF2164 domain-containing protein	NA	NA	NA	NA
WP_006400804.1\|1131061_1132363_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	6.0e-96	45.4

DBSCAN-SWA_74

1147824 : 1151200

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400784.1\|1147824_1148508_+	guanylate kinase	A0A218KC48	Bacillus_phage	6.7e-14	32.9
WP_006400783.1\|1148566_1148770_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_006400782.1\|1148833_1151200_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A291L9W9	Bordetella_phage	6.8e-13	33.5

DBSCAN-SWA_75

1154765 : 1156215

Lake_Baikal_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400778.1\|1154765_1154969_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	3.5e-19	72.7
WP_053297518.1\|1155087_1156215_+	DNA polymerase III subunit epsilon	I6R9X8	Croceibacter_phage	2.5e-13	42.9

DBSCAN-SWA_76

1164855 : 1165869

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400763.1\|1164855_1165869_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	4.6e-51	35.8

DBSCAN-SWA_77

1173365 : 1174376

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048995318.1\|1173365_1174376_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	5.8e-38	35.3

DBSCAN-SWA_78

1179546 : 1180842

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006410412.1\|1179546_1180842_+	MFS transporter	Q6JIH2	Burkholderia_virus	6.7e-63	36.5

DBSCAN-SWA_79

1195647 : 1204785

Escherichia_phage(33.33%)

integrase

attL 1185376:1185392|attR 1215074:1215090

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1185376:1185392	attL	NA	NA	NA	NA
WP_150331696.1\|1195647_1198443_-	DUF927 domain-containing protein	D5LH15	Escherichia_phage	2.0e-35	34.2
WP_150331697.1\|1198439_1198799_-	hypothetical protein	NA	NA	NA	NA
WP_105814217.1\|1198791_1199070_-	hypothetical protein	NA	NA	NA	NA
WP_150331698.1\|1199062_1199263_-	hypothetical protein	NA	NA	NA	NA
WP_105814219.1\|1199255_1199456_-	hypothetical protein	NA	NA	NA	NA
WP_150331699.1\|1199749_1200040_-	hypothetical protein	NA	NA	NA	NA
WP_150331700.1\|1200036_1200750_-	KilA-N domain-containing protein	Q9XJS9	Pseudomonas_phage	5.9e-29	55.7
WP_150331701.1\|1200753_1201011_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_150331702.1\|1201214_1202189_-	hypothetical protein	NA	NA	NA	NA
WP_006486852.1\|1202172_1202475_-	hypothetical protein	NA	NA	NA	NA
WP_150331703.1\|1202743_1203442_+	hypothetical protein	NA	NA	NA	NA
WP_105814223.1\|1203540_1204785_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	2.7e-122	56.0
1215074:1215090	attR	NA	NA	NA	NA

DBSCAN-SWA_80

1208110 : 1212674

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012213844.1\|1208110_1210714_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	2.1e-100	32.7
WP_006400733.1\|1210817_1211417_+	DUF2059 domain-containing protein	NA	NA	NA	NA
WP_006400732.1\|1211591_1212674_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	1.0e-85	46.7

DBSCAN-SWA_81

1218795 : 1230453

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400726.1\|1218795_1219119_+	integration host factor subunit beta	A7KV42	Bacillus_phage	4.7e-10	38.9
WP_006400723.1\|1219331_1219625_+	LapA family protein	NA	NA	NA	NA
WP_053297510.1\|1219679_1220852_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
WP_006400721.1\|1220942_1222343_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	2.3e-77	37.7
WP_050804584.1\|1222335_1223301_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.2e-16	27.5
WP_006400719.1\|1223349_1224342_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	6.9e-28	30.9
WP_006400718.1\|1224417_1224774_+	competence protein ComE	NA	NA	NA	NA
WP_006400717.1\|1224982_1225885_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	1.8e-51	39.2
WP_081000594.1\|1225966_1227310_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_006400715.1\|1227353_1228277_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	2.3e-41	34.0
WP_006400714.1\|1228292_1229201_-	alpha/beta hydrolase	Q6TUZ7	Yaba_monkey_tumor_virus	6.2e-15	26.8
WP_006414351.1\|1229418_1230453_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-34	39.5

DBSCAN-SWA_82

1246030 : 1253399

Diachasmimorpha_longicaudata_entomopoxvirus(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406227.1\|1246030_1246666_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	9.9e-28	41.0
WP_006406226.1\|1246682_1247300_-	molybdopterin adenylyltransferase	NA	NA	NA	NA
WP_006406225.1\|1247283_1247895_-	ribosome-associated protein	NA	NA	NA	NA
WP_006406224.1\|1248014_1249385_+\|protease	metalloprotease PmbA	NA	NA	NA	NA
WP_006400688.1\|1249476_1249977_-	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	1.2e-25	39.6
WP_006406223.1\|1250203_1250524_-	hypothetical protein	NA	NA	NA	NA
WP_053297501.1\|1250997_1252386_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_053297500.1\|1252427_1253399_+	thymidylate synthase	Q5QC60	Escherichia_phage	2.0e-48	37.9

DBSCAN-SWA_83

1266663 : 1271157

Agrobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401294.1\|1266663_1267863_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	2.5e-56	35.7
WP_006411655.1\|1267952_1268615_+	lactate utilization protein C	NA	NA	NA	NA
WP_006408128.1\|1268655_1270086_+	sodium:proton antiporter	NA	NA	NA	NA
WP_006401291.1\|1270167_1271157_+	D-glycerate dehydrogenase	M1HST2	Paramecium_bursaria_Chlorella_virus	1.0e-15	24.8

DBSCAN-SWA_84

1289608 : 1301085

Trichoplusia_ni_ascovirus(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401271.1\|1289608_1290358_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	3.8e-18	34.4
WP_004197638.1\|1290502_1290742_+	acyl carrier protein	B2ZXV3	Ralstonia_phage	1.6e-10	47.1
WP_006401270.1\|1290903_1292136_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_006401269.1\|1292148_1292613_+	hypothetical protein	NA	NA	NA	NA
WP_006401268.1\|1292717_1293317_+	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	3.8e-05	27.7
WP_053297490.1\|1293407_1294025_+	sigma-E factor negative regulatory protein	NA	NA	NA	NA
WP_035489319.1\|1294030_1295083_+	sugar dehydratase	NA	NA	NA	NA
WP_053297489.1\|1295099_1296572_+\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	5.5e-21	29.3
WP_006401264.1\|1296578_1296815_+	glutaredoxin family protein	NA	NA	NA	NA
WP_006401262.1\|1297019_1298813_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	3.5e-22	23.9
WP_006401261.1\|1298829_1299723_+	signal peptidase I	NA	NA	NA	NA
WP_053297488.1\|1299876_1301085_+	ribonuclease III	G8DDA3	Micromonas_pusilla_virus	9.4e-19	30.7

DBSCAN-SWA_85

1322846 : 1324676

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401234.1\|1322846_1324676_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.5e-39	29.4

DBSCAN-SWA_86

1345468 : 1349652

Paramecium_bursaria_Chlorella_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297476.1\|1345468_1346269_+	ABC transporter ATP-binding protein	M1H3A1	Paramecium_bursaria_Chlorella_virus	1.6e-06	24.3
WP_006408165.1\|1346289_1347330_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_043279696.1\|1347545_1347884_-	hypothetical protein	NA	NA	NA	NA
WP_011881602.1\|1348392_1349652_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0

DBSCAN-SWA_87

1363628 : 1365095

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297472.1\|1363628_1365095_+	NYN domain-containing protein	A0A2P0VNQ4	Tetraselmis_virus	2.2e-06	33.9

DBSCAN-SWA_88

1381967 : 1382741

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401178.1\|1381967_1382741_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.6e-24	34.7

DBSCAN-SWA_89

1393584 : 1399592

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331707.1\|1393584_1397295_+	exodeoxyribonuclease V subunit beta	S5M596	Bacillus_phage	9.3e-09	27.2
WP_053297463.1\|1397291_1399592_+	AAA family ATPase	A0A1P8DII4	Virus_Rctr197k	3.6e-03	40.0

DBSCAN-SWA_90

1410292 : 1411324

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297458.1\|1410292_1411324_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.0e-21	30.7

DBSCAN-SWA_91

1416013 : 1417030

Acinetobacter_phage(100.0%)

integrase

attL 1409711:1409725|attR 1424901:1424915

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1409711:1409725	attL	NA	NA	NA	NA
WP_053297430.1\|1416013_1417030_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P9F9	Acinetobacter_phage	1.8e-31	32.5
WP_053297430.1\|1416013_1417030_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P9F9	Acinetobacter_phage	1.8e-31	32.5
1424901:1424915	attR	NA	NA	NA	NA

DBSCAN-SWA_92

1423975 : 1427637

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407452.1\|1423975_1425286_+	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	6.8e-39	31.2
WP_053297426.1\|1425317_1426589_+	Zn-dependent hydrolase	NA	NA	NA	NA
WP_053297425.1\|1426614_1427637_+	histone deacetylase family protein	A0A0N9QAS6	Chrysochromulina_ericina_virus	1.1e-17	26.9

DBSCAN-SWA_93

1431738 : 1432506

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407446.1\|1431738_1432506_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	5.7e-38	40.1

DBSCAN-SWA_94

1447268 : 1457096

Burkholderia_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088923467.1\|1447268_1448762_-	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	8.8e-59	32.3
WP_006401062.1\|1449279_1449612_+	YnfA family protein	A0A218MNG8	uncultured_virus	4.8e-26	54.6
WP_006401060.1\|1449645_1450380_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	5.5e-38	40.3
WP_006401058.1\|1450418_1450862_-	ribonuclease HI	J9Q745	Salmonella_phage	3.1e-44	55.9
WP_006401057.1\|1450858_1451671_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_053297409.1\|1451689_1452496_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_006401055.1\|1452648_1454235_+	transglycosylase SLT domain-containing protein	U5PVY0	Bacillus_phage	1.1e-06	35.5
WP_006401054.1\|1454374_1455607_+	MFS transporter	NA	NA	NA	NA
WP_006401053.1\|1455558_1455870_+	hypothetical protein	NA	NA	NA	NA
WP_006401052.1\|1455950_1457096_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	7.7e-47	34.6

DBSCAN-SWA_95

1463764 : 1475210

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401045.1\|1463764_1465660_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	C7U047	Ostreococcus_tauri_virus	5.6e-111	40.8
WP_053297408.1\|1465736_1466630_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	3.2e-24	33.5
WP_053297407.1\|1466659_1468015_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_080512302.1\|1468409_1468613_-	hypothetical protein	NA	NA	NA	NA
WP_006401042.1\|1468512_1469544_+	phosphate ABC transporter substrate-binding protein PstS	A0A1D7SRJ6	Cyanophage	2.5e-44	36.2
WP_006401041.1\|1469638_1470625_+	phosphate ABC transporter permease PstC	NA	NA	NA	NA
WP_006405087.1\|1470621_1471515_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_006401039.1\|1471530_1472379_+	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	4.7e-17	33.2
WP_006401038.1\|1472397_1473102_+	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_012213681.1\|1473132_1473834_+	phosphate regulon transcriptional regulatory protein PhoB	W8CYM9	Bacillus_phage	1.7e-33	37.3
WP_006401036.1\|1473890_1475210_+	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	8.6e-34	35.5

DBSCAN-SWA_96

1489201 : 1530923

Ralstonia_phage(22.22%)

capsid,transposase,plate,integrase

attL 1486140:1486155|attR 1518269:1518284

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1486140:1486155	attL	NA	NA	NA	NA
WP_006397282.1\|1489201_1490422_+\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	5.6e-229	93.3
WP_053297405.1\|1490629_1492033_+	OFA family MFS transporter	NA	NA	NA	NA
WP_006401017.1\|1492051_1492183_+	hypothetical protein	NA	NA	NA	NA
WP_006401015.1\|1492355_1492577_-	hypothetical protein	NA	NA	NA	NA
WP_080560188.1\|1492542_1492779_+	hypothetical protein	NA	NA	NA	NA
WP_150331878.1\|1492698_1492938_-	hypothetical protein	NA	NA	NA	NA
WP_006405076.1\|1493004_1493460_-	hemerythrin domain-containing protein	NA	NA	NA	NA
WP_150331714.1\|1493518_1495624_-	catalase	A0A2K9L0T1	Tupanvirus	1.0e-137	48.1
WP_039225007.1\|1496322_1496454_+	entericidin A/B family lipoprotein	NA	NA	NA	NA
WP_053297404.1\|1496782_1497031_+	CsbD family protein	NA	NA	NA	NA
WP_053297403.1\|1497452_1497764_+	hypothetical protein	NA	NA	NA	NA
WP_150331715.1\|1498026_1499436_+\|integrase	integrase arm-type DNA-binding domain-containing protein	NA	NA	NA	NA
WP_150331716.1\|1499432_1500203_+	hypothetical protein	NA	NA	NA	NA
WP_150331717.1\|1500288_1502064_+	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_081060058.1\|1503143_1503335_-	hypothetical protein	NA	NA	NA	NA
WP_150331718.1\|1503804_1504617_-	hypothetical protein	NA	NA	NA	NA
WP_150331719.1\|1504705_1505014_-	hypothetical protein	NA	NA	NA	NA
WP_150331720.1\|1505262_1505877_+	hypothetical protein	NA	NA	NA	NA
WP_150331721.1\|1505878_1506619_-	hypothetical protein	NA	NA	NA	NA
WP_150331722.1\|1506726_1507017_-	H-NS histone family protein	NA	NA	NA	NA
WP_150331723.1\|1507214_1508375_-	hypothetical protein	NA	NA	NA	NA
WP_150331724.1\|1508530_1510300_-	hypothetical protein	A0A1L7N0M1	Ralstonia_phage	4.1e-63	36.4
WP_150331725.1\|1510675_1512685_-	acyltransferase family protein	C6ZR20	Salmonella_phage	3.2e-80	40.8
WP_105752121.1\|1512871_1513213_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_105811221.1\|1513403_1513901_+	response regulator	NA	NA	NA	NA
WP_150331726.1\|1513957_1514404_-	hypothetical protein	NA	NA	NA	NA
WP_089339361.1\|1514503_1515684_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.6e-55	40.8
WP_150331727.1\|1515752_1516388_-	hypothetical protein	NA	NA	NA	NA
WP_150331728.1\|1516389_1516689_-	hypothetical protein	NA	NA	NA	NA
WP_150331729.1\|1516794_1517601_-	DUF4942 domain-containing protein	NA	NA	NA	NA
WP_011881602.1\|1517996_1519256_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
1518269:1518284	attR	NA	NA	NA	NA
WP_150331730.1\|1520119_1521034_-\|capsid	phage capsid protein	NA	NA	NA	NA
WP_150331731.1\|1521084_1521300_-	hypothetical protein	NA	NA	NA	NA
WP_105775163.1\|1521311_1522307_-	YqaJ viral recombinase family protein	A6XMH8	Bacillus_virus	3.0e-55	39.8
WP_105775162.1\|1522377_1522578_-	hypothetical protein	NA	NA	NA	NA
WP_105775161.1\|1522574_1523543_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	9.7e-59	42.9
WP_077181108.1\|1523660_1523918_-	hypothetical protein	NA	NA	NA	NA
WP_150331732.1\|1524670_1525774_+	hypothetical protein	NA	NA	NA	NA
WP_053299177.1\|1525812_1526193_+	DUF3592 domain-containing protein	NA	NA	NA	NA
WP_012492775.1\|1526214_1526787_+	hypothetical protein	NA	NA	NA	NA
WP_150331733.1\|1526793_1528677_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_150331734.1\|1528814_1530923_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	2.9e-63	30.0

DBSCAN-SWA_97

1537596 : 1539900

Acidithiobacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404121.1\|1537596_1538364_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	6.7e-71	53.8
WP_006404120.1\|1538376_1539900_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.2e-150	53.4

DBSCAN-SWA_98

1548517 : 1559341

uncultured_Mediterranean_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331744.1\|1548517_1551307_-	DEAD/DEAH box helicase family protein	A0A1B1IUI1	uncultured_Mediterranean_phage	2.6e-40	28.1
WP_150331745.1\|1551313_1556587_-	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	4.3e-60	22.5
WP_150331746.1\|1556596_1557697_-	Fic family protein	NA	NA	NA	NA
WP_150331747.1\|1558081_1559341_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0

DBSCAN-SWA_99

1564983 : 1567662

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297401.1\|1564983_1566603_-	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	4.7e-66	34.5
WP_006400996.1\|1566969_1567662_-	peptidoglycan DD-metalloendopeptidase family protein	A0A1W6JQH9	Corynebacterium_phage	2.3e-06	37.2

DBSCAN-SWA_100

1576254 : 1593949

Ralstonia_phage(50.0%)

integrase

attL 1570224:1570278|attR 1582486:1582540

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1570224:1570278	attL	NA	NA	NA	NA
WP_053297395.1\|1576254_1578540_+	hypothetical protein	A0A1L7DQB4	Ralstonia_phage	8.6e-90	32.5
WP_053297394.1\|1580098_1581262_-\|integrase	site-specific integrase	A0A1L7DQ84	Ralstonia_phage	6.6e-70	44.0
WP_053297393.1\|1581371_1582391_-\|integrase	site-specific integrase	A0A0A1I5U0	Burkholderia_phage	3.9e-50	38.0
WP_081000588.1\|1582924_1583128_-	hypothetical protein	NA	NA	NA	NA
1582486:1582540	attR	NA	NA	NA	NA
WP_053297392.1\|1583677_1593949_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	5.0e-28	31.7

DBSCAN-SWA_101

1626453 : 1628697

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006403003.1\|1626453_1628697_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	3.9e-34	28.3

DBSCAN-SWA_102

1637983 : 1644179

Moumouvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297373.1\|1637983_1642093_+	cytochrome P450	H2EDX0	Moumouvirus	1.5e-23	23.5
WP_053297372.1\|1642089_1643466_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_039224820.1\|1643462_1644179_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-33	36.8

DBSCAN-SWA_103

1654839 : 1655568

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402190.1\|1654839_1655568_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.1e-14	28.4

DBSCAN-SWA_104

1688206 : 1695828

Serratia_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402155.1\|1688206_1688677_+	NUDIX hydrolase	A0A023W5N2	Serratia_phage	9.9e-25	47.4
WP_006413358.1\|1688763_1690473_-\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	2.0e-187	57.6
WP_006402153.1\|1690724_1690934_+	ornithine acetyltransferase	NA	NA	NA	NA
WP_053297346.1\|1691089_1691644_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_006402150.1\|1691746_1692967_-	CoA transferase	NA	NA	NA	NA
WP_081000585.1\|1692949_1693207_+	hypothetical protein	NA	NA	NA	NA
WP_006402148.1\|1693203_1695828_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	6.4e-81	38.7

DBSCAN-SWA_105

1701573 : 1703027

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297349.1\|1701573_1702326_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.2e-11	27.0
WP_006402140.1\|1702322_1703027_+	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	1.4e-06	27.8

DBSCAN-SWA_106

1711558 : 1713133

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402132.1\|1711558_1713133_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.1e-14	24.3

DBSCAN-SWA_107

1728735 : 1739335

Bacillus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402116.1\|1728735_1729620_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.0e-70	48.6
WP_105806785.1\|1729706_1732574_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	2.0e-144	39.0
WP_006402113.1\|1732776_1735137_+	UvrD-helicase domain-containing protein	G3MA40	Bacillus_virus	4.4e-73	31.9
WP_088928580.1\|1735133_1735931_+	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_006402111.1\|1735995_1737237_-	MFS transporter	NA	NA	NA	NA
WP_043279872.1\|1737646_1739335_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.0e-10	40.0

DBSCAN-SWA_108

1745788 : 1746619

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331758.1\|1745788_1746619_-	metallophosphoesterase	K4K650	Caulobacter_phage	5.1e-40	39.7

DBSCAN-SWA_109

1753761 : 1754862

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402094.1\|1753761_1754862_+	chorismate synthase	A0A291AU41	Pandoravirus	6.6e-80	43.6

DBSCAN-SWA_110

1764622 : 1772111

Tupanvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331763.1\|1764622_1766530_+\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	2.4e-125	36.9
WP_080512257.1\|1766579_1767104_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	3.1e-11	29.3
WP_004191477.1\|1767292_1767490_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_004192938.1\|1767520_1767880_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_006402082.1\|1767848_1768079_-	hypothetical protein	NA	NA	NA	NA
WP_088923834.1\|1768100_1769123_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	3.9e-26	38.6
WP_150331764.1\|1769207_1771637_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_035488220.1\|1771709_1772111_+	integration host factor subunit alpha	A0A1P8CWT5	Bacillus_phage	6.3e-12	41.1

DBSCAN-SWA_111

1783539 : 1784595

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404953.1\|1783539_1784595_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.9e-24	36.3

DBSCAN-SWA_112

1788736 : 1791646

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402062.1\|1788736_1791646_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	1.2e-22	25.3

DBSCAN-SWA_113

1804982 : 1806413

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404942.1\|1804982_1806413_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	8.4e-43	27.8

DBSCAN-SWA_114

1829569 : 1831330

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297308.1\|1829569_1831330_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	5.0e-37	25.7

DBSCAN-SWA_115

1840297 : 1845878

Staphylococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297303.1\|1840297_1841851_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.8e-14	28.0
WP_053297302.1\|1841837_1843088_-	ROK family protein	NA	NA	NA	NA
WP_053297301.1\|1843970_1844540_+	flavodoxin family protein	NA	NA	NA	NA
WP_105775252.1\|1844655_1845878_-\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	8.0e-18	37.7

DBSCAN-SWA_116

1858698 : 1859529

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400261.1\|1858698_1859529_-	alpha/beta hydrolase	A0A1B1SFC9	Mycobacterium_phage	2.9e-11	29.0

DBSCAN-SWA_117

1875203 : 1879540

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400209.1\|1875203_1877660_+	ribonuclease R	Q0GXV6	Lactococcus_phage	4.5e-68	32.6
WP_006400207.1\|1877802_1878546_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_045594347.1\|1878664_1879540_+	N-acetylmuramoyl-L-alanine amidase	A0A223VZK2	Agrobacterium_phage	9.2e-08	30.9

DBSCAN-SWA_118

1892898 : 1895183

Bacillus_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297287.1\|1892898_1893861_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	7.2e-30	37.6
WP_105775252.1\|1893961_1895183_+\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	8.0e-18	37.7

DBSCAN-SWA_119

1900972 : 1906679

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297283.1\|1900972_1901446_+	VOC family protein	A0A2K9L4N3	Tupanvirus	2.1e-19	39.1
WP_081000583.1\|1901677_1901929_-	hypothetical protein	NA	NA	NA	NA
WP_080512263.1\|1901988_1902678_-	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	6.5e-17	35.0
WP_053297281.1\|1903069_1903552_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_006400164.1\|1903717_1904155_+	PaaI family thioesterase	NA	NA	NA	NA
WP_006400163.1\|1904263_1905316_+	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
WP_006404876.1\|1905392_1906679_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.5e-86	43.1

DBSCAN-SWA_120

1912935 : 1916477

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088923324.1\|1912935_1914057_-	nodulation factor ABC transporter ATP-binding protein NodI	W6JKT0	Anomala_cuprea_entomopoxvirus	2.3e-27	27.6
WP_125902759.1\|1913995_1914181_-	hypothetical protein	NA	NA	NA	NA
WP_006400153.1\|1914179_1914677_+	universal stress protein	NA	NA	NA	NA
WP_006404871.1\|1914748_1915438_-	DUF2939 domain-containing protein	NA	NA	NA	NA
WP_053297277.1\|1915467_1915803_-	hypothetical protein	NA	NA	NA	NA
WP_006400150.1\|1915829_1916477_-	transcriptional repressor LexA	F1C5A6	Cronobacter_phage	4.3e-10	39.0

DBSCAN-SWA_121

1919752 : 1946569

Bacillus_virus(12.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404868.1\|1919752_1920814_+	sulfate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-28	33.7
WP_006404867.1\|1920888_1921815_+	CysB family HTH-type transcriptional regulator	NA	NA	NA	NA
WP_006400143.1\|1922128_1923079_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_053297276.1\|1923224_1924829_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-08	27.6
WP_006400141.1\|1924825_1925845_+	ABC transporter permease	NA	NA	NA	NA
WP_006400140.1\|1925879_1926911_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	6.7e-34	30.6
WP_150331767.1\|1926907_1927840_+	ribokinase	NA	NA	NA	NA
WP_053297274.1\|1928121_1929930_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-10	28.3
WP_006404861.1\|1930277_1930457_+	hypothetical protein	NA	NA	NA	NA
WP_006400134.1\|1930496_1932419_+	PrkA family serine protein kinase	NA	NA	NA	NA
WP_006400132.1\|1932544_1933813_+	YeaH/YhbH family protein	A0A219UQP6	Bacillus_phage	2.4e-09	37.2
WP_053297273.1\|1933809_1935483_+	SpoVR family protein	NA	NA	NA	NA
WP_006400128.1\|1935715_1937020_+	MFS transporter	Q6JIH2	Burkholderia_virus	3.1e-44	30.9
WP_006404860.1\|1937016_1937211_+	hypothetical protein	NA	NA	NA	NA
WP_035488234.1\|1937460_1938276_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006400124.1\|1938388_1939111_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_053297272.1\|1939113_1939866_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_053297271.1\|1939850_1941089_-	M23 family metallopeptidase	V5R8R0	Arthrobacter_phage	8.1e-18	47.7
WP_006400121.1\|1941406_1942072_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_053297270.1\|1942222_1943416_+	MexX/AxyX family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_006404854.1\|1943431_1946569_+	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.2e-51	21.8

DBSCAN-SWA_122

1956558 : 1957401

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297265.1\|1956558_1957401_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.2e-10	23.2

DBSCAN-SWA_123

1961400 : 1978085

Tupanvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297263.1\|1961400_1963146_-	cyclic peptide export ABC transporter	G9BWD6	Planktothrix_phage	3.1e-15	26.2
WP_006400102.1\|1963142_1963463_-	hypothetical protein	NA	NA	NA	NA
WP_053297262.1\|1963433_1973099_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	1.6e-84	22.5
WP_053297261.1\|1973108_1978085_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	2.5e-49	22.8

DBSCAN-SWA_124

2019177 : 2020257

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404802.1\|2019177_2020257_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-23	36.8

DBSCAN-SWA_125

2025159 : 2026137

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297235.1\|2025159_2026137_+	hydroxymethylglutaryl-CoA lyase	E5EQ69	Micromonas_sp._RCC1109_virus	4.8e-05	31.7

DBSCAN-SWA_126

2047184 : 2049489

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006412037.1\|2047184_2048228_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.1e-11	25.0
WP_053297225.1\|2048523_2049489_-	D-glycerate dehydrogenase	M1I1Q8	Acanthocystis_turfacea_Chlorella_virus	2.0e-19	28.1

DBSCAN-SWA_127

2058744 : 2061897

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297220.1\|2058744_2061897_+	efflux RND transporter permease subunit	S5VL66	Leptospira_phage	3.5e-09	18.2

DBSCAN-SWA_128

2070694 : 2072793

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006399994.1\|2070694_2071624_-	ABC transporter permease subunit	Q6GZ02	Mycoplasma_phage	1.7e-07	22.8
WP_006409517.1\|2071620_2072793_-	polyamine ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	6.1e-23	33.2

DBSCAN-SWA_129

2080070 : 2088213

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404738.1\|2080070_2081663_-	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	6.9e-54	26.8
WP_150331769.1\|2081795_2084084_-	AsmA family protein	NA	NA	NA	NA
WP_006404736.1\|2084228_2084930_+	ATP-binding cassette domain-containing protein	A0A1V0SE00	Indivirus	9.0e-06	24.7
WP_006399960.1\|2084926_2085730_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_053297212.1\|2085745_2086222_-	hypothetical protein	NA	NA	NA	NA
WP_035488340.1\|2086480_2087032_-	hypothetical protein	NA	NA	NA	NA
WP_053297250.1\|2087196_2088213_-	zinc-binding alcohol dehydrogenase family protein	K7Z7U2	Megavirus	5.0e-05	27.0

DBSCAN-SWA_130

2103248 : 2105501

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297207.1\|2103248_2105501_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	3.8e-74	29.2

DBSCAN-SWA_131

2109203 : 2113373

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006399937.1\|2109203_2111120_-	potassium transporter Kup	A7J6G4	Paramecium_bursaria_Chlorella_virus	2.2e-78	32.4
WP_006399936.1\|2111066_2111273_+	hypothetical protein	NA	NA	NA	NA
WP_088923828.1\|2111422_2111983_-	phosphoribosyltransferase	NA	NA	NA	NA
WP_006417401.1\|2112026_2113373_-	adenylosuccinate synthase	A0A160ER07	Powai_lake_megavirus	2.6e-70	36.1

DBSCAN-SWA_132

2127488 : 2141656

uncultured_Mediterranean_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006399902.1\|2127488_2127914_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	1.1e-19	42.1
WP_006399901.1\|2128162_2128861_+	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_081000576.1\|2128933_2130331_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	1.5e-28	26.1
WP_065494749.1\|2130418_2131276_+	endonuclease	NA	NA	NA	NA
WP_053297199.1\|2131292_2132069_-	3'-5' exonuclease	NA	NA	NA	NA
WP_006399897.1\|2132072_2133158_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	3.9e-32	35.4
WP_053297198.1\|2133168_2134047_-	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_006404702.1\|2134052_2134982_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.5e-36	50.3
WP_006412019.1\|2134978_2135740_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.2e-64	51.2
WP_006404700.1\|2135844_2137050_-	CoA transferase	NA	NA	NA	NA
WP_006404699.1\|2137099_2137696_-	recombination protein RecR	NA	NA	NA	NA
WP_006399891.1\|2137727_2138054_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_150331773.1\|2138148_2140614_-	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	8.5e-43	41.3
WP_081000574.1\|2140610_2140823_-	hypothetical protein	NA	NA	NA	NA
WP_006402348.1\|2141329_2141656_+	thioredoxin TrxA	A0A1J0GW78	Streptomyces_phage	1.8e-17	44.1

DBSCAN-SWA_133

2150888 : 2152004

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006409111.1\|2150888_2152004_-	acetoin dehydrogenase dihydrolipoyllysine-residue acetyltransferase subunit	G1DB77	Mycobacterium_phage	4.0e-08	28.4

DBSCAN-SWA_134

2160956 : 2163554

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402324.1\|2160956_2163554_-	ATP-dependent chaperone ClpB	A0A223W0B1	Agrobacterium_phage	1.1e-122	36.2

DBSCAN-SWA_135

2175681 : 2176707

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402309.1\|2175681_2176707_+	glycosyltransferase	F1C5B0	Cronobacter_phage	2.2e-32	29.1

DBSCAN-SWA_136

2180484 : 2187047

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407793.1\|2180484_2182284_+	PhoH family protein	A0A2I7SAD7	Vibrio_phage	9.5e-76	39.2
WP_053297185.1\|2182523_2183612_+	C40 family peptidase	A0A1S5SEZ8	Streptococcus_phage	1.5e-12	34.8
WP_006402301.1\|2183879_2184890_-	inorganic phosphate transporter	NA	NA	NA	NA
WP_006402300.1\|2184900_2185527_-	DUF47 domain-containing protein	NA	NA	NA	NA
WP_006402298.1\|2185664_2187047_-	replicative DNA helicase	C7BGG1	Burkholderia_phage	4.2e-140	59.4

DBSCAN-SWA_137

2191834 : 2193610

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402290.1\|2191834_2193610_+	glyoxylate carboligase	E4WLQ6	Ostreococcus_tauri_virus	3.6e-43	27.6

DBSCAN-SWA_138

2200974 : 2202153

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407779.1\|2200974_2202153_-	AAA family ATPase	A0A077SLJ9	Escherichia_phage	1.3e-65	38.5

DBSCAN-SWA_139

2206580 : 2207201

Bacteriophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297176.1\|2206580_2207201_-	dTMP kinase	A0A1L2BX49	Bacteriophage	1.1e-28	39.1

DBSCAN-SWA_140

2210745 : 2211705

Powai_lake_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297173.1\|2210745_2211705_-	alpha/beta hydrolase	A0A167RJ59	Powai_lake_megavirus	3.6e-29	33.8

DBSCAN-SWA_141

2216702 : 2232916

Bacillus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297170.1\|2216702_2218103_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	5.4e-18	32.0
WP_150331774.1\|2218354_2219533_-	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_006402259.1\|2219585_2220218_-	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L2K0	Tupanvirus	4.0e-21	37.1
WP_053297169.1\|2220259_2222344_-	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_006407744.1\|2222583_2224227_-	fatty-acid--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	9.1e-25	24.7
WP_053297168.1\|2224380_2225949_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	1.2e-55	31.5
WP_006407742.1\|2225987_2226419_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_006402253.1\|2226541_2227072_+	septation protein A	NA	NA	NA	NA
WP_006402252.1\|2227073_2227388_+	BolA family transcriptional regulator	NA	NA	NA	NA
WP_006407741.1\|2227397_2228180_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_053297167.1\|2228289_2228847_-	N-acetyltransferase	NA	NA	NA	NA
WP_053297166.1\|2228851_2232916_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	1.3e-221	91.6

DBSCAN-SWA_142

2237893 : 2238595

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006408398.1\|2237893_2238595_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.6e-32	40.5

DBSCAN-SWA_143

2245326 : 2250041

Moraxella_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402240.1\|2245326_2247753_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.7e-225	53.1
WP_006402239.1\|2247951_2249223_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.0e-132	58.0
WP_006408392.1\|2249387_2250041_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	6.3e-54	55.4

DBSCAN-SWA_144

2258549 : 2259686

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331775.1\|2258549_2259686_+	class II histone deacetylase	A0A2K9KZC4	Tupanvirus	1.7e-41	32.1

DBSCAN-SWA_145

2264716 : 2265442

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199523.1\|2264716_2265442_+	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	8.1e-34	36.7

DBSCAN-SWA_146

2306464 : 2307253

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407682.1\|2306464_2307253_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.7e-33	37.4

DBSCAN-SWA_147

2320169 : 2329419

Bordetella_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331777.1\|2320169_2320820_-	hypothetical protein	A0A291L9U8	Bordetella_phage	3.2e-50	47.0
WP_150331778.1\|2320731_2321682_-	hypothetical protein	A0A291L9U8	Bordetella_phage	2.5e-75	49.7
WP_150331779.1\|2321681_2324438_-	hypothetical protein	A0A291LAJ1	Bordetella_phage	4.7e-82	33.6
WP_150331780.1\|2324434_2324815_-	hypothetical protein	NA	NA	NA	NA
WP_150331781.1\|2324811_2325186_-	hypothetical protein	NA	NA	NA	NA
WP_150331782.1\|2325319_2325613_-	hypothetical protein	NA	NA	NA	NA
WP_150331783.1\|2325627_2326410_-	hypothetical protein	NA	NA	NA	NA
WP_150331784.1\|2326634_2327222_+	recombinase family protein	A0A0F7LA37	Escherichia_phage	6.6e-26	45.0
WP_150331785.1\|2327218_2327659_+	hypothetical protein	NA	NA	NA	NA
WP_150331786.1\|2327829_2328216_+	hypothetical protein	NA	NA	NA	NA
WP_150331787.1\|2328239_2328800_+	hypothetical protein	NA	NA	NA	NA
WP_150331882.1\|2328979_2329183_+	helix-turn-helix domain-containing protein	A0A291LAT3	Bordetella_phage	2.7e-19	68.3
WP_150331883.1\|2329209_2329419_-	helix-turn-helix domain-containing protein	A0A291LAT3	Bordetella_phage	3.8e-13	46.9

DBSCAN-SWA_148

2337579 : 2342660

Acidithiobacillus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404121.1\|2337579_2338347_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	6.7e-71	53.8
WP_006404120.1\|2338359_2339883_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.2e-150	53.4
WP_150331795.1\|2340029_2342660_-	hypothetical protein	A0A291LAR9	Bordetella_phage	1.0e-81	45.2

DBSCAN-SWA_149

2346028 : 2351393

Salmonella_phage(33.33%)

integrase

attL 2335211:2335226|attR 2354329:2354344

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2335211:2335226	attL	NA	NA	NA	NA
WP_150331884.1\|2346028_2347372_-\|integrase	tyrosine-type recombinase/integrase	T1S9J3	Salmonella_phage	2.6e-94	46.4
WP_053297139.1\|2347584_2349204_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.6e-13	28.0
WP_006407690.1\|2349320_2349926_-	hypothetical protein	NA	NA	NA	NA
WP_006402674.1\|2349932_2351393_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	2.0e-95	39.8
2354329:2354344	attR	NA	NA	NA	NA

DBSCAN-SWA_150

2357317 : 2364486

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402666.1\|2357317_2357764_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	4.5e-27	42.8
WP_150331801.1\|2357847_2358795_-	paraslipin	NA	NA	NA	NA
WP_053297137.1\|2358833_2359268_-	NfeD family protein	NA	NA	NA	NA
WP_053297136.1\|2359391_2361791_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	4.1e-167	35.6
WP_006402662.1\|2362164_2362980_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_053297135.1\|2363074_2363857_-	RNA methyltransferase	NA	NA	NA	NA
WP_006402660.1\|2363853_2364486_-	ribonuclease HII	D2TEQ2	Emiliania_huxleyi_virus	1.4e-29	42.6

DBSCAN-SWA_151

2374537 : 2375320

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006410014.1\|2374537_2375320_-	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	2.1e-19	37.6

DBSCAN-SWA_152

2384635 : 2387241

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297130.1\|2384635_2385169_-	peptide deformylase	A0A1D8KUY1	Synechococcus_phage	1.0e-09	32.4
WP_053297129.1\|2385165_2387241_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	8.0e-151	45.3

DBSCAN-SWA_153

2399742 : 2405187

Canarypox_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402630.1\|2399742_2400222_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	5.0e-24	37.3
WP_006407721.1\|2400357_2402289_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	5.4e-61	29.7
WP_006407722.1\|2402327_2402594_-	DUF2866 domain-containing protein	NA	NA	NA	NA
WP_006407723.1\|2402729_2404106_-	DNA repair protein RadA	NA	NA	NA	NA
WP_006402626.1\|2404116_2405187_-	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	2.3e-24	28.9

DBSCAN-SWA_154

2411669 : 2413190

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407730.1\|2411669_2413190_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.0e-46	30.0

DBSCAN-SWA_155

2424974 : 2428422

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035488288.1\|2424974_2425901_+	patatin-like phospholipase family protein	A0A1V0SKV5	Klosneuvirus	2.2e-07	27.2
WP_006409815.1\|2425997_2426672_-	C40 family peptidase	A0A0A8WF62	Clostridium_phage	7.3e-21	38.7
WP_053297117.1\|2426799_2428422_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.7e-20	32.2

DBSCAN-SWA_156

2439578 : 2440799

Burkholderia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006397282.1\|2439578_2440799_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	5.6e-229	93.3

DBSCAN-SWA_157

2446183 : 2449733

Moumouvirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297108.1\|2446183_2447581_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.0e-40	30.1
WP_006408915.1\|2447870_2448536_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_053297107.1\|2448577_2449153_+	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	1.4e-12	39.3
WP_006401897.1\|2449241_2449733_+	peptidyl-prolyl cis-trans isomerase	A0A2H4UTF4	Bodo_saltans_virus	9.7e-07	29.6

DBSCAN-SWA_158

2455311 : 2462398

Ralstonia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297104.1\|2455311_2455719_+	PAAR domain-containing protein	Q8W6S2	Burkholderia_virus	4.7e-15	50.6
WP_053297103.1\|2455723_2456227_+	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	4.2e-21	44.4
WP_081000566.1\|2456574_2457177_+	hypothetical protein	NA	NA	NA	NA
WP_053297100.1\|2457183_2457906_+	LysR family transcriptional regulator	A4PE26	Ralstonia_virus	1.3e-31	43.9
WP_150331805.1\|2459450_2459747_+	hypothetical protein	NA	NA	NA	NA
WP_150331806.1\|2459743_2462398_+	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	2.7e-26	23.7

DBSCAN-SWA_159

2466041 : 2466818

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297063.1\|2466041_2466818_-	MBL fold metallo-hydrolase	U5PVD0	Bacillus_phage	1.2e-11	27.5

DBSCAN-SWA_160

2477814 : 2481717

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401935.1\|2477814_2479098_-	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	2.4e-150	62.1
WP_006412164.1\|2479204_2480059_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.2e-47	40.2
WP_053297058.1\|2480055_2481717_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	3.2e-150	52.2

DBSCAN-SWA_161

2486151 : 2499172

Lake_Baikal_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401941.1\|2486151_2486847_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	6.6e-33	40.6
WP_006408181.1\|2486902_2488156_-	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_105792352.1\|2488320_2489385_+	regulator	NA	NA	NA	NA
WP_053297054.1\|2489402_2491100_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.9e-57	30.3
WP_100085614.1\|2491235_2492339_+	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	2.2e-06	37.1
WP_053297053.1\|2492412_2493939_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	2.1e-84	36.0
WP_006412884.1\|2494299_2495022_+	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_006408177.1\|2495125_2495335_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_006401949.1\|2495402_2495744_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_053297052.1\|2495833_2497702_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	9.5e-103	41.6
WP_012213077.1\|2497756_2498284_-	Fe-S protein assembly co-chaperone HscB	NA	NA	NA	NA
WP_012213076.1\|2498378_2498702_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	6.8e-25	51.4
WP_006401953.1\|2498764_2499172_-	Fe-S cluster assembly scaffold IscU	A0A2H4N7M4	Lake_Baikal_phage	2.4e-51	78.7

DBSCAN-SWA_162

2507905 : 2509681

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045594180.1\|2507905_2509681_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	5.6e-36	23.8

DBSCAN-SWA_163

2518044 : 2521236

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035488310.1\|2518044_2518902_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	8.4e-38	41.5
WP_053297046.1\|2519148_2521236_+	M3 family metallopeptidase	A0A1V0SD92	Indivirus	2.4e-38	21.8

DBSCAN-SWA_164

2535828 : 2539965

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297043.1\|2535828_2539965_-	ATP-dependent RNA helicase HrpA	A0A1V0SBU4	Catovirus	6.6e-48	29.2

DBSCAN-SWA_165

2559391 : 2560912

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039220934.1\|2559391_2560912_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	3.9e-78	36.6

DBSCAN-SWA_166

2576663 : 2580519

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035951454.1\|2576663_2578646_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.8e-80	44.1
WP_081000558.1\|2578619_2578901_+	cell division protein FtsQ	NA	NA	NA	NA
WP_053297024.1\|2578926_2579826_+	DMT family transporter	NA	NA	NA	NA
WP_006407941.1\|2579934_2580519_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	2.2e-21	33.0

DBSCAN-SWA_167

2608491 : 2609713

Enterobacteria_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105775252.1\|2608491_2609713_+\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	8.0e-18	37.7

DBSCAN-SWA_168

2622807 : 2623398

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006405558.1\|2622807_2623398_-	NUDIX hydrolase	A0A2K9VCP4	Lactobacillus_phage	7.1e-12	38.9

DBSCAN-SWA_169

2649029 : 2666519

Micromonas_sp._RCC1109_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006405574.1\|2649029_2650574_-	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	9.5e-08	24.9
WP_006398784.1\|2650887_2651760_-	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_006398783.1\|2651775_2652420_-	phosphatidylserine decarboxylase	A0A1V0SDU9	Indivirus	2.4e-13	30.3
WP_006398782.1\|2652547_2653564_-	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_006398781.1\|2653670_2654162_-	acetolactate synthase small subunit	NA	NA	NA	NA
WP_035488715.1\|2654273_2656037_-	acetolactate synthase 3 catalytic subunit	E5EQ70	Micromonas_sp._RCC1109_virus	1.7e-53	29.2
WP_012213003.1\|2656391_2656955_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_006398778.1\|2656951_2657377_+	DUF3619 family protein	NA	NA	NA	NA
WP_006405577.1\|2657403_2658171_+	DUF3106 domain-containing protein	NA	NA	NA	NA
WP_053297005.1\|2658177_2658684_+	RDD family protein	NA	NA	NA	NA
WP_006411031.1\|2658905_2659844_+	UDP-2,3-diacylglucosamine diphosphatase	A0A218MKA7	uncultured_virus	4.7e-66	48.1
WP_006405580.1\|2659873_2660908_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_006398773.1\|2660904_2661441_+	diacylglycerol kinase	NA	NA	NA	NA
WP_006411041.1\|2661631_2662366_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_006405583.1\|2662362_2662944_+	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	6.7e-15	34.9
WP_006405584.1\|2662969_2663731_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_053297004.1\|2663974_2665879_+	glycosyl transferase	NA	NA	NA	NA
WP_053297003.1\|2665901_2666519_-	DUF924 domain-containing protein	E3T4R4	Cafeteria_roenbergensis_virus	1.3e-11	30.5

DBSCAN-SWA_170

2676391 : 2678476

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035488706.1\|2676391_2678476_-	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	2.6e-24	26.3

DBSCAN-SWA_171

2695502 : 2698231

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006409049.1\|2695502_2697284_-	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	2.3e-45	26.0
WP_035488749.1\|2697478_2698231_+	glycosyltransferase family 2 protein	S5WBE2	Pseudomonas_phage	2.2e-05	33.3

DBSCAN-SWA_172

2702028 : 2709241

Streptomyces_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006405613.1\|2702028_2705568_-	DNA polymerase III subunit alpha	A0A0K1Y906	Streptomyces_phage	2.2e-185	36.4
WP_006398724.1\|2705796_2706654_+	sulfurtransferase	NA	NA	NA	NA
WP_053296995.1\|2706676_2707573_+\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_006405615.1\|2707777_2709241_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.9e-54	35.2

DBSCAN-SWA_173

2712447 : 2717601

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331813.1\|2712447_2717601_+	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	7.2e-84	49.1

DBSCAN-SWA_174

2731493 : 2732447

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398700.1\|2731493_2732447_+	transaldolase	A0A0E3F5V4	Synechococcus_phage	1.8e-12	31.5

DBSCAN-SWA_175

2738973 : 2740872

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006409758.1\|2738973_2740872_-	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.6e-118	38.1

DBSCAN-SWA_176

2747283 : 2749620

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006405645.1\|2747283_2749620_+	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	2.7e-14	34.2

DBSCAN-SWA_177

2753279 : 2794351

Bacillus_virus(16.67%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006413496.1\|2753279_2755601_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	2.5e-84	35.9
WP_006405650.1\|2755668_2757651_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.8e-91	34.6
WP_053296982.1\|2757917_2759867_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	9.1e-48	28.9
WP_081000553.1\|2759837_2760020_+	peptide chain release factor 1	NA	NA	NA	NA
WP_006405653.1\|2760006_2760411_-	DUF4399 domain-containing protein	NA	NA	NA	NA
WP_006405654.1\|2760423_2760612_-	hypothetical protein	NA	NA	NA	NA
WP_006398668.1\|2760610_2760793_+	rubredoxin	NA	NA	NA	NA
WP_150331815.1\|2761353_2761599_+	hypothetical protein	NA	NA	NA	NA
WP_006405708.1\|2761621_2762392_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_053296980.1\|2762551_2764579_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	5.8e-21	40.1
WP_006405710.1\|2764704_2765445_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_053296979.1\|2765560_2766208_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_006405712.1\|2766237_2766735_-\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA
WP_006398661.1\|2766878_2767223_+	hypothetical protein	NA	NA	NA	NA
WP_053296978.1\|2767355_2767718_-	hypothetical protein	NA	NA	NA	NA
WP_006398659.1\|2767873_2768254_+	DUF5594 family protein	NA	NA	NA	NA
WP_006398658.1\|2768429_2769797_+	MFS transporter	NA	NA	NA	NA
WP_053296977.1\|2769821_2770418_-	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	3.9e-26	62.8
WP_006398656.1\|2770410_2771832_-	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_006398655.1\|2771959_2772157_-	hypothetical protein	NA	NA	NA	NA
WP_105761854.1\|2772239_2772440_+	hypothetical protein	NA	NA	NA	NA
WP_053296976.1\|2772513_2773065_+	hypothetical protein	NA	NA	NA	NA
WP_006405718.1\|2773061_2773556_+	hypothetical protein	NA	NA	NA	NA
WP_006405738.1\|2776487_2777870_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.5e-09	58.3
WP_006405739.1\|2777870_2778263_+	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_006405740.1\|2778276_2778558_+	hypothetical protein	NA	NA	NA	NA
WP_080559080.1\|2779027_2779474_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_035488666.1\|2779623_2780478_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_006405742.1\|2780719_2781124_+	hypothetical protein	NA	NA	NA	NA
WP_006404121.1\|2782464_2783232_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	6.7e-71	53.8
WP_006404120.1\|2783244_2784768_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.2e-150	53.4
WP_036047966.1\|2785806_2786148_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	9.0e-36	66.7
WP_081052463.1\|2786144_2786561_-\|transposase	transposase	NA	NA	NA	NA
WP_150331816.1\|2787552_2788443_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011881602.1\|2788526_2789786_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
WP_150331817.1\|2791045_2791591_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_150331818.1\|2791587_2791794_+	hypothetical protein	NA	NA	NA	NA
WP_089339361.1\|2791803_2792984_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.6e-55	40.8
WP_150331618.1\|2793117_2794351_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	3.7e-103	65.5

DBSCAN-SWA_178

2801327 : 2848407

uncultured_virus(16.67%)

plate,transposase,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331618.1\|2801327_2802561_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	3.7e-103	65.5
WP_150331824.1\|2803148_2803724_-	hypothetical protein	A0A2H4J2R8	uncultured_Caudovirales_phage	1.1e-49	59.1
WP_150331825.1\|2804424_2804910_-	hypothetical protein	NA	NA	NA	NA
WP_150331826.1\|2804913_2806671_-	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_065494660.1\|2806663_2808007_-	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_150331827.1\|2808017_2810126_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	9.8e-64	30.0
WP_150331828.1\|2810263_2812147_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_150331829.1\|2812154_2812727_-	hypothetical protein	NA	NA	NA	NA
WP_150331830.1\|2812748_2813129_-	DUF3592 domain-containing protein	NA	NA	NA	NA
WP_150331831.1\|2813167_2814271_-	hypothetical protein	NA	NA	NA	NA
WP_077181108.1\|2815023_2815281_+	hypothetical protein	NA	NA	NA	NA
WP_150331832.1\|2815398_2816367_+	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	2.6e-59	43.6
WP_150331833.1\|2816363_2816564_+	hypothetical protein	NA	NA	NA	NA
WP_150331834.1\|2816634_2817630_+	endonuclease	A6XMH8	Bacillus_virus	1.3e-55	39.8
WP_150331888.1\|2817908_2818823_+\|capsid	phage capsid protein	NA	NA	NA	NA
WP_150331835.1\|2818819_2819911_+	hypothetical protein	NA	NA	NA	NA
WP_150331836.1\|2819977_2820784_+	DUF4942 domain-containing protein	NA	NA	NA	NA
WP_150331837.1\|2820859_2821186_+	hypothetical protein	NA	NA	NA	NA
WP_150331838.1\|2821187_2821538_+	hypothetical protein	NA	NA	NA	NA
WP_150331839.1\|2821534_2821903_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_150331840.1\|2823011_2824334_+	hypothetical protein	NA	NA	NA	NA
WP_011881602.1\|2824472_2825732_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
WP_150331841.1\|2825755_2827018_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	4.4e-43	45.5
WP_150331842.1\|2830241_2830694_-	MaoC family dehydratase	NA	NA	NA	NA
WP_150331843.1\|2830706_2831891_-	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_150331844.1\|2831877_2832438_-	hotdog fold thioesterase	NA	NA	NA	NA
WP_150331845.1\|2832497_2833001_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_150331846.1\|2833003_2833321_+	hypothetical protein	NA	NA	NA	NA
WP_150331889.1\|2833389_2834595_+	Bcr/CflA family efflux MFS transporter	NA	NA	NA	NA
WP_150331847.1\|2835996_2836560_-	hypothetical protein	NA	NA	NA	NA
WP_150331848.1\|2836636_2837862_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.7e-124	76.5
WP_150331849.1\|2838664_2839422_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_150331850.1\|2839565_2840075_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_150331851.1\|2840164_2841439_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_080559084.1\|2841904_2842939_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_150331852.1\|2843633_2844089_+	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_150331853.1\|2844164_2845181_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.5e-70	41.9
WP_150331854.1\|2845177_2845966_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	3.4e-78	58.8
WP_006404121.1\|2846103_2846871_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	6.7e-71	53.8
WP_006404120.1\|2846883_2848407_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.2e-150	53.4

DBSCAN-SWA_179

2866158 : 2869134

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006405762.1\|2866158_2869134_-	sensor histidine kinase	A0A1V0SGX0	Hokovirus	2.8e-40	28.7

DBSCAN-SWA_180

2872246 : 2881121

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006405767.1\|2872246_2877856_+	AAA family ATPase	M1I1I7	Paramecium_bursaria_Chlorella_virus	3.2e-05	21.7
WP_006405768.1\|2878032_2879193_+	NAD-dependent formate dehydrogenase	M1I4S0	Paramecium_bursaria_Chlorella_virus	1.3e-17	27.8
WP_006405769.1\|2879228_2879906_-	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	1.9e-32	34.7
WP_006405771.1\|2880065_2881121_-	alpha/beta hydrolase	M1PGN2	Moumouvirus	5.1e-61	39.6

DBSCAN-SWA_181

2885367 : 2889173

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006405778.1\|2885367_2886189_-	alpha/beta hydrolase	A0A2P1JTI7	Mycobacterium_phage	3.2e-18	28.5
WP_006405779.1\|2886191_2886488_-	hypothetical protein	NA	NA	NA	NA
WP_006405780.1\|2886540_2887860_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_006405781.1\|2887856_2889173_+	MFS transporter	Q6JIH2	Burkholderia_virus	5.2e-39	31.8

DBSCAN-SWA_182

2897081 : 2898734

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006405788.1\|2897081_2898734_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.3e-20	35.1

DBSCAN-SWA_183

2902683 : 2903863

Acinetobacter_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089339361.1\|2902683_2903863_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.6e-55	40.8

DBSCAN-SWA_184

2909646 : 2912512

Erwinia_phage(50.0%)

integrase

attL 2897676:2897691|attR 2915944:2915959

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2897676:2897691	attL	NA	NA	NA	NA
WP_150331855.1\|2909646_2911020_-\|integrase	tyrosine-type recombinase/integrase	E5AGD0	Erwinia_phage	2.7e-06	20.1
WP_150331856.1\|2911174_2912512_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.8e-31	38.5
2915944:2915959	attR	NA	NA	NA	NA

DBSCAN-SWA_185

2916364 : 2917090

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398647.1\|2916364_2917090_-	response regulator	W8CYM9	Bacillus_phage	8.4e-31	35.8

DBSCAN-SWA_186

2921421 : 2922201

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398641.1\|2921421_2922201_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.2e-16	28.8

DBSCAN-SWA_187

2926007 : 2930576

Agrobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296969.1\|2926007_2927732_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	7.7e-91	36.8
WP_053296968.1\|2927832_2929011_+	N-acetyltransferase	NA	NA	NA	NA
WP_006405807.1\|2929007_2929244_-	hypothetical protein	NA	NA	NA	NA
WP_053296967.1\|2929288_2929993_+	GIY-YIG nuclease family protein	W8W2G4	Invertebrate_iridovirus	1.1e-08	44.4
WP_006398629.1\|2930048_2930576_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	2.0e-50	53.8

DBSCAN-SWA_188

2945678 : 2946359

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398618.1\|2945678_2946359_+	HAD family phosphatase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	4.6e-07	34.0

DBSCAN-SWA_189

2949637 : 2950207

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398615.1\|2949637_2950207_-	dCTP deaminase	S5VM63	Pseudomonas_phage	1.0e-71	70.6

DBSCAN-SWA_190

2953444 : 2955628

Indivirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296962.1\|2953444_2955628_+\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	4.3e-54	28.8

DBSCAN-SWA_191

2964489 : 2965149

Vibrio_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398604.1\|2964489_2965149_-	ParA family protein	A2I303	Vibrio_virus	2.9e-14	36.0

DBSCAN-SWA_192

2973744 : 2974560

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006409917.1\|2973744_2974560_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.9e-11	33.9

DBSCAN-SWA_193

2984641 : 2986153

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398581.1\|2984641_2986153_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.6e-52	40.0

DBSCAN-SWA_194

2989855 : 2991172

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006405849.1\|2989855_2991172_-	sulfate adenylyltransferase subunit 1	A0A1V0SGC3	Hokovirus	2.7e-35	29.8

DBSCAN-SWA_195

3008157 : 3012236

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296941.1\|3008157_3009342_+	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	3.6e-23	26.2
WP_006405869.1\|3009355_3009811_+	GNAT family acetyltransferase	NA	NA	NA	NA
WP_053296940.1\|3009833_3010505_-	YukJ family protein	NA	NA	NA	NA
WP_006405871.1\|3010534_3010735_-	hypothetical protein	NA	NA	NA	NA
WP_012212865.1\|3010743_3011460_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.3e-15	26.9
WP_006398552.1\|3011459_3012236_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-16	26.0

DBSCAN-SWA_196

3026744 : 3039539

Prochlorococcus_phage(14.29%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006405881.1\|3026744_3027407_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	2.5e-26	40.6
WP_006405882.1\|3027528_3028521_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_053296927.1\|3028623_3031461_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	5.9e-80	25.9
WP_006398534.1\|3031463_3031964_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_006398533.1\|3032032_3033244_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	2.9e-44	32.9
WP_006398532.1\|3033297_3033744_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	9.3e-49	64.4
WP_006405886.1\|3033814_3034585_-	membrane protein	NA	NA	NA	NA
WP_006410967.1\|3034699_3036079_-	amino acid permease	NA	NA	NA	NA
WP_006398530.1\|3036181_3038482_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-168	41.5
WP_006398529.1\|3038478_3038793_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	4.4e-13	44.6
WP_004196460.1\|3039335_3039539_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8

DBSCAN-SWA_197

3047126 : 3052711

Phage_21(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398522.1\|3047126_3048383_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.5e-11	63.0
WP_088928015.1\|3048546_3049233_+	pseudouridine synthase	NA	NA	NA	NA
WP_006398520.1\|3049511_3049724_+	hypothetical protein	NA	NA	NA	NA
WP_006405897.1\|3049882_3050383_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	3.2e-13	41.2
WP_006398518.1\|3050605_3052711_+	elongation factor G	E4ZFJ7	Streptococcus_phage	1.5e-56	26.8

DBSCAN-SWA_198

3065217 : 3067411

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398503.1\|3065217_3065796_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	1.5e-43	44.2
WP_053296911.1\|3066028_3067411_-	exodeoxyribonuclease VII large subunit	A0A1B3AYB4	Gordonia_phage	3.0e-29	25.6

DBSCAN-SWA_199

3074763 : 3075693

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012212838.1\|3074763_3075693_+	ornithine carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.7e-23	27.7

DBSCAN-SWA_200

3079100 : 3091698

Catovirus(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296910.1\|3079100_3080660_+	AMP-binding protein	A0A1V0SBX8	Catovirus	8.7e-17	26.9
WP_053296909.1\|3080921_3081872_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	3.4e-24	30.6
WP_006406429.1\|3081868_3082339_-	methylated-DNA--[protein]-cysteine S-methyltransferase	NA	NA	NA	NA
WP_045594237.1\|3082442_3083657_-\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_053296908.1\|3083674_3084229_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_053296907.1\|3084210_3085707_+	N-acetylmuramoyl-L-alanine amidase	Q5YA51	Bacillus_phage	7.3e-13	28.5
WP_053296906.1\|3085750_3086632_-	EamA family transporter	NA	NA	NA	NA
WP_053296905.1\|3086806_3087688_+	pirin family protein	NA	NA	NA	NA
WP_006406435.1\|3087740_3088589_+	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	1.9e-13	36.6
WP_006406436.1\|3088731_3089589_-\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	1.4e-13	32.0
WP_053296904.1\|3089715_3090360_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_006410800.1\|3090477_3091698_+	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	9.1e-46	33.1

DBSCAN-SWA_201

3104511 : 3109039

Ostreococcus_lucimarinus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296901.1\|3104511_3106122_-	benzoylformate decarboxylase	G9E4W7	Ostreococcus_lucimarinus_virus	1.3e-07	33.9
WP_006406453.1\|3106220_3107132_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_053296900.1\|3107644_3109039_+	mannitol dehydrogenase family protein	H8ZJP8	Ostreococcus_tauri_virus	1.0e-45	30.6

DBSCAN-SWA_202

3112921 : 3117022

Mycobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296897.1\|3112921_3114112_-	serine hydrolase	A0A0B5A4V6	Mycobacterium_phage	3.2e-11	32.6
WP_053296896.1\|3114230_3115115_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_053296895.1\|3115128_3116238_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	5.2e-24	34.7
WP_053296894.1\|3116293_3117022_-	HAD family phosphatase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	1.4e-06	45.6

DBSCAN-SWA_203

3125252 : 3132470

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398438.1\|3125252_3126140_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-10	23.8
WP_150331861.1\|3126132_3126915_+	metal ABC transporter permease	NA	NA	NA	NA
WP_053296887.1\|3127053_3127902_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_006406473.1\|3127918_3129025_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	2.7e-33	29.3
WP_150331862.1\|3129234_3130671_-	carbohydrate kinase	NA	NA	NA	NA
WP_088927950.1\|3131042_3132470_+	purine permease	Q9KX94	Enterobacteria_phage	1.1e-23	28.3

DBSCAN-SWA_204

3142943 : 3145873

uncultured_Mediterranean_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406483.1\|3142943_3144428_-\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	8.8e-27	30.6
WP_006406484.1\|3144526_3145873_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	8.8e-18	29.5

DBSCAN-SWA_205

3150698 : 3154449

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406488.1\|3150698_3151727_-	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	2.2e-40	38.2
WP_053296877.1\|3151738_3152935_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_053296884.1\|3153020_3153542_-	5-(carboxyamino)imidazole ribonucleotide mutase	NA	NA	NA	NA
WP_006398410.1\|3153558_3154449_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	5.4e-56	39.7

DBSCAN-SWA_206

3171325 : 3172030

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398392.1\|3171325_3172030_-	TerC family protein	A0A0S4KZH7	Pseudomonas_phage	5.3e-38	46.1

DBSCAN-SWA_207

3175970 : 3177044

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398386.1\|3175970_3177044_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	3.3e-116	65.5

DBSCAN-SWA_208

3181854 : 3184261

Burkholderia_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296871.1\|3181854_3182376_+	hypothetical protein	A4JWV5	Burkholderia_virus	7.3e-61	64.4
WP_053296870.1\|3182372_3183140_+	nuclease	A4JWV4	Burkholderia_virus	1.1e-49	50.4
WP_053296869.1\|3183145_3184261_+	DUF3396 domain-containing protein	E5E3X7	Burkholderia_phage	4.4e-132	60.8

DBSCAN-SWA_209

3194625 : 3195774

Oenococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006411652.1\|3194625_3195774_+	galactonate dehydratase	Q6A202	Oenococcus_phage	1.6e-55	33.8

DBSCAN-SWA_210

3199425 : 3200868

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012212764.1\|3199425_3200868_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.1e-53	34.4

DBSCAN-SWA_211

3204396 : 3205176

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406529.1\|3204396_3205176_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	4.0e-23	29.4

DBSCAN-SWA_212

3209509 : 3210226

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398355.1\|3209509_3210226_+	aquaporin family protein	M1HJ77	Paramecium_bursaria_Chlorella_virus	1.7e-23	32.5

DBSCAN-SWA_213

3218223 : 3218934

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406542.1\|3218223_3218934_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.8e-41	44.7

DBSCAN-SWA_214

3224198 : 3225245

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398340.1\|3224198_3225245_+	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	2.4e-47	45.1

DBSCAN-SWA_215

3230963 : 3232598

uncultured_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296850.1\|3230963_3232598_-	hypothetical protein	D6PFH9	uncultured_phage	1.3e-07	25.8

DBSCAN-SWA_216

3247960 : 3249832

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406560.1\|3247960_3249832_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	8.5e-43	27.9

DBSCAN-SWA_217

3261182 : 3266404

Tupanvirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398307.1\|3261182_3262985_-\|tRNA	aspartate--tRNA ligase	A0A2K9L0E9	Tupanvirus	1.4e-18	29.9
WP_006408632.1\|3263052_3263700_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	1.8e-13	28.5
WP_006406567.1\|3263764_3264088_-	FmdB family transcriptional regulator	NA	NA	NA	NA
WP_053296838.1\|3264183_3264810_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_006398303.1\|3264826_3266404_-	ubiquinone biosynthesis regulatory protein kinase UbiB	A0A2P0VMP1	Tetraselmis_virus	5.9e-29	26.5

DBSCAN-SWA_218

3276149 : 3276974

Vibriophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406576.1\|3276149_3276974_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	I6XGV6	Vibriophage	1.2e-33	35.8

DBSCAN-SWA_219

3298703 : 3313960

Burkholderia_virus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296826.1\|3298703_3299249_-	single-stranded DNA-binding protein	C5IHK5	Burkholderia_virus	6.0e-50	88.1
WP_006398269.1\|3299351_3300539_-	MFS transporter	NA	NA	NA	NA
WP_006411685.1\|3300809_3303695_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	6.2e-303	54.4
WP_088923799.1\|3304006_3305041_+	hypothetical protein	NA	NA	NA	NA
WP_006398265.1\|3305131_3306016_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	6.6e-14	35.7
WP_006406617.1\|3306082_3306940_-	DUF4743 domain-containing protein	NA	NA	NA	NA
WP_006398263.1\|3306945_3307560_-	LysE family translocator	NA	NA	NA	NA
WP_053296825.1\|3307586_3308153_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.7e-26	41.1
WP_006398261.1\|3308230_3310237_-	potassium transporter	NA	NA	NA	NA
WP_006406620.1\|3310363_3311347_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	2.4e-44	37.9
WP_006398259.1\|3311346_3311883_+	HAD family hydrolase	E3T535	Cafeteria_roenbergensis_virus	1.1e-11	28.0
WP_006398258.1\|3311886_3312501_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_006398257.1\|3312521_3313187_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_006398256.1\|3313183_3313960_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.1e-23	28.8

DBSCAN-SWA_220

3318018 : 3318927

Corynebacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006409809.1\|3318018_3318927_+	RNase adapter RapZ	A0A1P8D5W0	Corynebacterium_phage	8.9e-06	30.8

DBSCAN-SWA_221

3325198 : 3329946

uncultured_Mediterranean_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398244.1\|3325198_3326155_+	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	3.1e-41	36.2
WP_012212698.1\|3326316_3326922_+	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_006406630.1\|3327030_3327630_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_006406631.1\|3327741_3328809_+	histidinol-phosphate transaminase	NA	NA	NA	NA
WP_006406632.1\|3328877_3329141_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	7.7e-19	57.0
WP_006398238.1\|3329448_3329946_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	9.8e-31	45.3

DBSCAN-SWA_222

3336489 : 3338352

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406639.1\|3336489_3337059_-	acyloxyacyl hydrolase	A0A2H4J0I5	uncultured_Caudovirales_phage	2.3e-12	29.9
WP_006406641.1\|3337416_3338352_+	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	1.4e-38	37.5

DBSCAN-SWA_223

3343847 : 3356022

Hokovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296813.1\|3343847_3346430_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	1.3e-09	28.8
WP_053296812.1\|3346445_3347453_-	SIS domain-containing protein	F2Y1G4	Organic_Lake_phycodnavirus	6.0e-11	25.1
WP_053296830.1\|3347445_3348549_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_053296811.1\|3348632_3349367_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_053296810.1\|3349686_3352902_-	error-prone DNA polymerase	A0A291AVS4	Streptomyces_phage	2.9e-99	28.5
WP_035488848.1\|3352908_3354396_-	DNA polymerase Y family protein	NA	NA	NA	NA
WP_035488950.1\|3354328_3355036_-	translesion DNA synthesis-associated protein ImuA	NA	NA	NA	NA
WP_053296809.1\|3355227_3356022_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.0e-05	26.2

DBSCAN-SWA_224

3359891 : 3361541

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296807.1\|3359891_3361541_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.9e-10	46.6

DBSCAN-SWA_225

3368809 : 3370417

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398198.1\|3368809_3370417_-	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	1.2e-08	37.7

DBSCAN-SWA_226

3375260 : 3377749

Turbot_reddish_body_iridovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398191.1\|3375260_3375785_-	O-acetyl-ADP-ribose deacetylase	E2CTW8	Turbot_reddish_body_iridovirus	8.7e-38	52.2
WP_006398190.1\|3375879_3376878_-	NAD(P)-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_006398189.1\|3376904_3377387_-	protein-export chaperone SecB	NA	NA	NA	NA
WP_006398188.1\|3377488_3377749_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	4.5e-11	46.2

DBSCAN-SWA_227

3381780 : 3383553

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407042.1\|3381780_3383553_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	7.3e-12	27.9

DBSCAN-SWA_228

3407554 : 3411213

Diachasmimorpha_longicaudata_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296794.1\|3407554_3409426_+	gamma-glutamyltransferase	Q5GF27	Diachasmimorpha_longicaudata_entomopoxvirus	8.5e-11	27.5
WP_053296793.1\|3409447_3410416_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_006407062.1\|3410415_3411213_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.2e-30	41.5

DBSCAN-SWA_229

3414762 : 3418393

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407067.1\|3414762_3415809_+	transcriptional regulator GcvA	Q6JIH3	Burkholderia_virus	4.2e-31	33.1
WP_006398148.1\|3415792_3416101_-	YbeD family protein	NA	NA	NA	NA
WP_006407068.1\|3416100_3417027_-	D-amino acid aminotransferase	NA	NA	NA	NA
WP_006407069.1\|3417076_3418393_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	4.5e-67	38.9

DBSCAN-SWA_230

3422958 : 3423837

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006408950.1\|3422958_3423837_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-21	34.1

DBSCAN-SWA_231

3428724 : 3429342

Burkholderia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035488941.1\|3428724_3429342_-	hypothetical protein	R4JJZ3	Burkholderia_phage	1.2e-75	63.1

DBSCAN-SWA_232

3432485 : 3432968

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006409907.1\|3432485_3432968_-	D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase	A0A1B1IUK5	uncultured_Mediterranean_phage	7.3e-15	34.6

DBSCAN-SWA_233

3441899 : 3442970

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398117.1\|3441899_3442970_+	5-methyltetrahydrofolate--homocysteine methyltransferase	A0A140XBC7	Dickeya_phage	1.9e-10	48.4

DBSCAN-SWA_234

3446366 : 3448163

Orpheovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407094.1\|3446366_3448163_+\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	7.9e-14	20.7

DBSCAN-SWA_235

3456884 : 3457562

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296779.1\|3456884_3457562_+	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	1.0e-06	29.3

DBSCAN-SWA_236

3461274 : 3462459

Emiliania_huxleyi_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053296775.1\|3461274_3462459_+	8-amino-7-oxononanoate synthase	V5LQ39	Emiliania_huxleyi_virus	9.2e-19	26.4

DBSCAN-SWA_237

3502654 : 3503587

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297760.1\|3502654_3503587_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	1.1e-40	35.8

DBSCAN-SWA_238

3521507 : 3525872

Escherichia_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297767.1\|3521507_3522503_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	8.3e-106	69.0
WP_035952612.1\|3522639_3524001_+	UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	A0A2K9L821	Tupanvirus	1.9e-31	35.0
WP_012214280.1\|3524054_3525872_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	2.4e-143	47.6

DBSCAN-SWA_239

3537337 : 3538492

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331870.1\|3537337_3538492_+	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.1e-24	32.7

DBSCAN-SWA_240

3551831 : 3554638

Enterobacteria_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297777.1\|3551831_3553139_-	uracil transporter	Q9KX94	Enterobacteria_phage	5.2e-164	71.5
WP_006408022.1\|3553175_3553367_+	hypothetical protein	NA	NA	NA	NA
WP_006397282.1\|3553417_3554638_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	5.6e-229	93.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP044056

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP044058

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection