CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP042593	Bacillus sp. FJAT-25496 chromosome, complete genome	2 crisprs	WYL,csa3,RT,casR,DinG,cas3,DEDDh,cas6,csx1,csm4gr5,csm3gr7,csm2gr11,cas10	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP042593_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP042593_1

1670266-1670343

Orphan

Consensus_repeat	Method
AAAACAGGCAAAAGATGGTCAGAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP042593_1

>merge|NZ_CP042593|1|1670266-1670343|CRISPRCasFinder
AAAACAGGCAAAAGATGGTCAGAAAACTATTCAAATAGACCACTGGATATGGAAAAACAGCAAAAGATGGTCAGAAAA

>NZ_CP042593|1|1|1670266-1670343|CRISPRCasFinder
AAAACAGGCAAAAGATGGTCAGAAAA	CTATTCAAATAGACCACTGGATATGG
AAAAACAGCAAAAGATGGTCAGAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP042593.1\|WP_057774376.1\|1668927_1669926_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
NZ_CP042593.1\|WP_057774386.1\|1666586_1667360_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213186
NZ_CP042593.1\|WP_057774358.1\|1675853_1679369_+\|helicase-exonuclease-AddAB-subunit-AddB	unknown	unknown	gnl\|CDD\|213736
NZ_CP042593.1\|WP_082625324.1\|1659117_1660053_+\|LCP-family-protein	unknown	unknown	gnl\|CDD\|224235
NZ_CP042593.1\|WP_057774374.1\|1671375_1672272_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP042593.1\|WP_057774368.1\|1673249_1674761_+\|long-chain-fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|341286
NZ_CP042593.1\|WP_057774349.1\|1683435_1683828_-\|spore-germination-protein-GerPE	unknown	unknown	gnl\|CDD\|287884
NZ_CP042593.1\|WP_057774848.1\|1670359_1671379_+\|3-oxoacyl-ACP-synthase	unknown	unknown	gnl\|CDD\|235872
NZ_CP042593.1\|WP_057774394.1\|1660825_1661392_+\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|274044
NZ_CP042593.1\|WP_057774379.1\|1668062_1668923_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_CP042593.1\|WP_057774371.1\|1672285_1673026_+\|3-oxoacyl-ACP-reductase-FabG	unknown	unknown	gnl\|CDD\|187594
NZ_CP042593.1\|WP_057774365.1\|1674789_1674981_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042593.1\|WP_057774355.1\|1679346_1683105_+\|helicase-exonuclease-AddAB-subunit-AddA	unknown	unknown	gnl\|CDD\|274299
NZ_CP042593.1\|WP_057774850.1\|1661553_1664793_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225461
NZ_CP042593.1\|WP_057774382.1\|1667337_1668045_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213191
NZ_CP042593.1\|WP_057774401.1\|1656823_1658815_+\|S9-family-peptidase	unknown	unknown	gnl\|CDD\|224423
NZ_CP042593.1\|WP_057774352.1\|1683141_1683360_-\|spore-germination-protein	unknown	unknown	gnl\|CDD\|371190
NZ_CP042593.1\|WP_057774391.1\|1665248_1666487_+\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380551
NZ_CP042593.1\|WP_057774362.1\|1675030_1675462_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NZ_CP042593.1\|WP_057774397.1\|1660170_1660791_+\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475

Protein	Function_ID	Function_description	E-value
NZ_CP042593.1\|WP_057774376.1\|1668927_1669926_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	4.77782e-77
NZ_CP042593.1\|WP_057774386.1\|1666586_1667360_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	4.94499e-114
NZ_CP042593.1\|WP_057774358.1\|1675853_1679369_+\|helicase-exonuclease-AddAB-subunit-AddB	gnl\|CDD\|213736	TIGR02773, ATP-dependent_helicase/deoxyribonuclease_subunit_B, helicase-exonuclease AddAB, AddB subunit. DNA repair is accomplished by several different systems in prokaryotes. Recombinational repair of double-stranded DNA breaks involves the RecBCD pathway in some lineages, and AddAB (also called RexAB) in other. The AddA protein is conserved between the firmicutes and the alphaproteobacteria, while the partner protein is not. Nevertheless, the partner is designated AddB in both systems. This model describes the AddB protein as found Bacillus subtilis and related species. Although the RexB protein of Streptococcus and Lactococcus is considered to be orthologous, functionally equivalent, and merely named differently, all members of this protein family have a P-loop nucleotide binding motif GxxGxGK[ST] at the N-terminus, unlike RexB proteins, and a CxxCxxxxxC motif at the C-terminus, both of which may be relevant to function. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP042593.1\|WP_082625324.1\|1659117_1660053_+\|LCP-family-protein	gnl\|CDD\|224235	COG1316, LytR, Transcriptional regulator [Transcription].	1.26067e-69
NZ_CP042593.1\|WP_057774374.1\|1671375_1672272_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	7.34573e-39
NZ_CP042593.1\|WP_057774368.1\|1673249_1674761_+\|long-chain-fatty-acid--CoA-ligase	gnl\|CDD\|341286	cd17631, FACL_FadD13-like, fatty acyl-CoA synthetase, including FadD13. This family contains fatty acyl-CoA synthetases, including Mycobacterium tuberculosis acid-induced operon MymA encoding the fatty acyl-CoA synthetase FadD13 which is essential for virulence and intracellular growth of the pathogen. The fatty acyl-CoA synthetase activates lipids before entering into the metabolic pathways and is also involved in transmembrane lipid transport. However, unlike soluble fatty acyl-CoA synthetases, but like the mammalian integral-membrane very-long-chain acyl-CoA synthetases, FadD13 accepts lipid substrates up to the maximum length of C26, and this is facilitated by an extensive hydrophobic tunnel from the active site to a positively charged patch. Also included is feruloyl-CoA synthetase (Fcs) in Rhodococcus strains where it is involved in biotechnological vanillin production from eugenol and ferulic acid via a non-beta-oxidative pathway.	0
NZ_CP042593.1\|WP_057774349.1\|1683435_1683828_-\|spore-germination-protein-GerPE	gnl\|CDD\|287884	pfam10970, GerPE, Spore germination protein GerPE. GerPE is required for the formation of functionally normal spores. It could be involved in the establishment of a normal spore coat structure and (or) permeability, which allows the access of germinants to their receptor.	4.106e-37
NZ_CP042593.1\|WP_057774848.1\|1670359_1671379_+\|3-oxoacyl-ACP-synthase	gnl\|CDD\|235872	PRK06840, PRK06840, 3-oxoacyl-ACP synthase.	0
NZ_CP042593.1\|WP_057774394.1\|1660825_1661392_+\|signal-peptidase-I	gnl\|CDD\|274044	TIGR02227, Inactive_signal_peptidase_IA., signal peptidase I, bacterial type. This model represents signal peptidase I from most bacteria. Eukaryotic sequences are likely organellar. Several bacteria have multiple paralogs, but these represent isozymes of signal peptidase I. Virtually all known bacteria may be presumed to A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes. [Protein fate, Protein and peptide secretion and trafficking].	2.92077e-53
NZ_CP042593.1\|WP_057774379.1\|1668062_1668923_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	3.02182e-65
NZ_CP042593.1\|WP_057774371.1\|1672285_1673026_+\|3-oxoacyl-ACP-reductase-FabG	gnl\|CDD\|187594	cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs. This subgroup includes the Escherichai coli K12 BKR, FabG. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet) NAD(P)(H) binding region and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H) binding pattern: TGxxxGxG in classical SDRs. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P) binding motif and an altered active site motif (YXXXN). Fungal type type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P) binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr-151 and Lys-155, and well as Asn-111 (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	1.15197e-115
NZ_CP042593.1\|WP_057774355.1\|1679346_1683105_+\|helicase-exonuclease-AddAB-subunit-AddA	gnl\|CDD\|274299	TIGR02785, ATP-dependent_helicase/nuclease_subunit_A, helicase-exonuclease AddAB, AddA subunit, Firmicutes type. AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the Firmicutes (as modeled here) and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP042593.1\|WP_057774850.1\|1661553_1664793_+\|transcriptional-regulator	gnl\|CDD\|225461	COG2909, MalT, ATP-dependent transcriptional regulator [Transcription].	1.67166e-58
NZ_CP042593.1\|WP_057774382.1\|1667337_1668045_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213191	cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter. LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.	6.21505e-103
NZ_CP042593.1\|WP_057774401.1\|1656823_1658815_+\|S9-family-peptidase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	7.25988e-146
NZ_CP042593.1\|WP_057774352.1\|1683141_1683360_-\|spore-germination-protein	gnl\|CDD\|371190	pfam10676, gerPA, Spore germination protein gerPA/gerPF. This is a bacterial family of proteins that are required for the formation of functionally normal spores. Proteins in this family may be involved in establishing normal coat structure and/or permeability which could control the access of germinants to their receptor.	4.50417e-17
NZ_CP042593.1\|WP_057774391.1\|1665248_1666487_+\|substrate-binding-domain-containing-protein	gnl\|CDD\|380551	cd06328, PBP1_SBP-like, periplasmic substrate-binding domain of active transport proteins (substrate binding proteins or SBPs). Periplasmic substrate-binding domain of active transport proteins found in gram-negative and gram-positive bacteria. Members of this group are initial receptors in the process of active transport across cellular membrane, but their substrate specificities are not known in detail. However, they closely resemble the group of AmiC and active transport systems for short-chain amides and urea (FmdDEF), and thus are likely to exhibit a ligand-binding mode similar to that of the amide sensor protein AmiC from Pseudomonas aeruginosa. Moreover, this binding domain has high sequence identity to the family of hydrophobic amino acid transporters (HAAT), and thus it may also be involved in transport of amino acids.	2.76907e-167
NZ_CP042593.1\|WP_057774362.1\|1675030_1675462_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.22443e-13
NZ_CP042593.1\|WP_057774397.1\|1660170_1660791_+\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	1.42811e-40

>NZ_CP042593.1|WP_057774376.1|1668927_1669926_+|branched-chain-amino-acid-ABC-transporter-permease
MRISMNNRMNILYVITAVFLLVLPFIYESRTLLILLTQVFIFAIFAMSYDILLGYTGIVSFGHAMFFGIGAYTIGVFMKRFDPTIPYFLLAVLVTIVLSAVVSFALGLLTLRLKSHFYAMLTLAFSGLFLVLAEKWRTVTYGNDGFTFRIPDLFKDRTDFYLICLVTMIVVFAILRRFTSSPLGRVLQAIRENEQRTESLGYSILHYKVVASVISGVMAGIAGILYSMSLRFVNTSVFTMDITLDALLMTIIGGVGTLVGAIIGAGLIEFAHHWLTELAKVHWIFERWIIFFGIIYILAVMFFPMGIVGTLKKLKLNRSKKEEQKAEEKIAS
>NZ_CP042593.1|WP_057774379.1|1668062_1668923_+|branched-chain-amino-acid-ABC-transporter-permease
MDVLINLSLNGLATGMLIFLLAAGLTLIFGLMDVLNFAHGGLFAWGAYSGTWIYATTGSFLIAIAGAILTGLILGLLTERWIIKPVYGNHVQQILITLGLMLVLSELLKVVWGPNQISASPPSYLAGSWELGNVIIIKYRVFIIAVGILVFGIVQYILKNTKIGLIVRAGVMDKEMVQALGINIQKVFMLVFMIGAGMAALGGAMLGPYSGVIYAEMGLEFAILAFIVVVIGGMGSFPGSILAAILVGVSGSFMAYYVPSLSLAVNMLLMAVVLIFRPQGLFGLKG
>NZ_CP042593.1|WP_057774382.1|1667337_1668045_+|ABC-transporter-ATP-binding-protein
MSTQLKLSEVETYIGQYHILQGVSFEVREGDVTVLLGRNGAGKTTTLRTIMGLNPPSKGEVIYKGEAIQGLPTYTVAQKGIGYVPEDQGIFSGLTVEENMKVAMKNNDDATKERLDWILELFPDLKKFWKKQGGLLSGGQKQMLSIARAYINENDLLLIDEPSKGLAPIVVEKVMETILQMKEKTTIVLVEQNFMMASTIGDKFYIIDDGKTVSEGSMNLLKEDEEMRRKYLGIA
>NZ_CP042593.1|WP_057774386.1|1666586_1667360_+|ABC-transporter-ATP-binding-protein
MEPIIETKGLSITFGGHTAVDGVNISVPKNHFKSIIGPNGAGKTTFFNLLSGQLLPTKGQIFFRNKEITKMSPTERTRLGLGRSFQITNVFPNLTVLENVRLAVQSQAGTRFQMLAHYKKYRIYEEKAAEWLELVFLDNKKEIVARNLAHGEKRKLEIAMLLALNTEVLLLDEPTAGMSVEEVPAILDVIRKIKRGNDRTILLIEHKMDMIMDLSDSVMVLFNGKLLADGTPNEIMKNETVQSAYLGGLYDVNSVKA
>NZ_CP042593.1|WP_057774391.1|1665248_1666487_+|substrate-binding-domain-containing-protein
MRALSRKMGFICFLILVMVFTSACNSDKAGNEENNSKEPVETKNSEPIKIGVLASQTGGLEAYGKQTLQGFELGLDYATNGTREVAGRKIEVFIEDTETKPEVAVQKATKLLEENEVDFLVGSSSSGDTLAVLPLAEEYEKIMVVEPAVADSITGSEFNKYIFRTARNSSQDAVAGAAAIADKGVKIATLAPDYSFGRDGVQAFKEAAIKLGAEIVHEEYADPAATDFTSNIQKIIDTKPDYLFVIWAGANSPWNQIADMKVQEKGIKISTGAPDIAALATMEPLIGMEGFTVYYHDLPSNDVNKWLVEEHKKRFNGEVPDLFTPGGMSAAIAIVEALKKTEGDAKADTLIKAMEGMSFETPKGKMTFRPEDHQALQTLYAIKLEKKDGVPYPVPVLMRELSPEETEPPIRN
>NZ_CP042593.1|WP_057774850.1|1661553_1664793_+|transcriptional-regulator
MPIIKTKLLVPNVKEESIRRAALSKKMKTISQYPLTIIHSSAGYGKSTALALFVKDEKKTCCWYSITAADDDILPFLSYLIYTIQASFPEFGRDLTLIMKDMDRYIREEEISMLASLFINELFTIEDELYLILDDFHQIEQSYTVNRWMELLLEHIPANIHLIISSRSRPAWKRLTKMKVCNQLLEITKDDLIMTMEEAELLLSDYYDVKVREEELEQIYLLTEGWVIAIGMIAQQFPEHEDLSGLCAHPSQSLQDLFQYLALEVFAKQPPLLQQFLEQTSIFDELNEEICDSVLGLNGSLAILMQLVEKNLFIYRIGDKQFKYHALFKEFLESQLKEKYPESNRALHELTARYFERRKRWEEALLHYEKINLKDAVASVLNEVGPMMLENGKLENLYDRLMSISDNDKNKFYSLWFLQGEVLRYRSMYNEAEECYGKAAKIAADKNNLLEISRALEGQARIYLDTTQPNKAERILYQAIKIRENNEIESEGETGKLYQLLAENLLNSGQYLKAEKWIKRAQLLNNPQFNGNLEARLYLRTGRFEKAKKILVHDKKETVTAEKSVLPQSHRETELLLSLIEAFCGNGIQAKSYAQEGIQNGISTKSLYVEACGWIRMGHAIQIVNDYDKNLAKQCYDTALEIMNRLRIERGKAEPLMGLCILYGNKGEYERAIASGEEALVETEKVKDIWLSALIQLSMGIASVYSGHFTNGLAYIDKSTKIFNQCGDQYGYMLCLFWKTYTYYCQNDSSSFLEYLPLLLKEVHTGEYEYIFNKRTFLGPRDLQIFAPMLIEAEKKNIMTRYVAKLLQEMNLSKLDSHPGYTLRVHTLGKFQVWLGEREVEEKDWQRGKAKELLQLFITNHDKLIPKDEIYQLLWIDQDEKSAARDFKVALNALNNVLEPNRKARGTPFFIIREGTAYGLNPYAVLELDSHSFEHWITSGLQENEQEKAKDYLEKGLKLYKGDYLPERRFEDWCINEKERLAVYFIRAAEKLAQLYVRNEEYDKAIHWCGKILEKDRTWEEAYRLMMYCYYRKNNRPFALKWYQKCCETLEEELGVSPLDPTRHMYEMIIEAGNTLNSF
>NZ_CP042593.1|WP_057774394.1|1660825_1661392_+|signal-peptidase-I
MKESIKKEGIEWIKAFAIGMIIFIFIRTFFFSNYVVEGVSMEPTLETGNKLIVNKMGNQIGELQRFDVIVFHHNEEEDFVKRIIGLPGDKIEYRNDELYINGKKVNEPYLDKYRKNYQEEAFGSMLTADFTLMEATGEETVPEGKLFVLGDNRPKSWDSRHYGFISIDQVVGKVNLRYWPINEMDISF
>NZ_CP042593.1|WP_057774397.1|1660170_1660791_+|TVP38/TMEM64-family-protein
MDFEVLKDWLTLDHIMELIEKYRSFGPLPGILLPFLEAFLPFLPLFLFVMANANAFGLWLGFLLSWIGAILGALLVFFIVRKFGQKRMLRVLKKHQKVQKLMAWVEKHGFGPLFILLCFPFTPSAVVNIVAGLSKISIAQYMLAVLTGKMVMIFTISFVGYDIKSLITQPTRSAIVGIIIFILWYVGKRIEIKMNIKMERERKFQK
>NZ_CP042593.1|WP_082625324.1|1659117_1660053_+|LCP-family-protein
MRSERYKDKKPRKKKWKIFVLILFLLFFATIGYSYFQYKQGVLQSKDKTGVANQEFEFHGNKGKNGETNILLLGIDKRGERTSRSDTIMIAQYHPDKDSYKLVSIMRDTYVDIPGHGKNKINAAFAFGGPELVRQTIKENFGIDLQYYSIVDFEGFVHLIDEAFPKGVEIDVEKAMSENIGVTLQPGLQRLDGEHLLGYVRFRHDAVGDFGRVERQQKVITEVASQFKSIQTIAKLPKLVGVMTPFVNTNMDATDILYIGKDFISQNNVNIDTLRIPIDGSYSNQRVNGAGSVLAIDLEKNKQAIHEFLAN
>NZ_CP042593.1|WP_057774401.1|1656823_1658815_+|S9-family-peptidase
MKEKRTIRAEDLYQLKSVADPQLAANGKDCVYVVTTMLEKENKYCSNLYYINVDEKNNPVQWTFGENRNSSPRWSVDGKRLAFVSDRSGKGQIYVIDVAGGEARQLTTCPNGASNPVWSPDGTKIAFNMAIKNGESFSLTDEKDKKEDKKPVPLEVDKMKYKSDAHGFWDGKYNQVAIVDVQKGEVELLTSGEHDYQLQSWSPDGKYIAITADLSEDKDASFISDVFVIHTDTKELKKLTEGTGYFGNVTWSPNGKYIGIVGHEREFENATLSKIWIYDMDTEKIQCLTRDSDLLIGDYAIGDFQQGAVTPGILWGEDNHSFYFLATDHGNTVVYYGSLAGVMYPALLDRQHVYGLSTGGKVDRAVVAISKPSYPGDLFLLNVSTGELEQLTNVNGEFLAEIVLADSEPIRFKTSDEWDMHGWIMKPVHFEEGKKYPLVLEIHGGPHAMYANSYFHEFQCLAALGYAVLFINPRGSHGYGQAFVDAVRGDYGGKDYEDIMAAADYALANYDFIDKDRLGVTGGSYGGFMTNWIVGHTNRFKAAVTQRSISNWISFYGVSDIGYYFTDWQIKSGLHDIETLWKHSPLAYVDQMETPLLILHSEKDFRCPIEQAEQLFIALKHRKKETKLIRFPDANHELSRSGKPNLRICRLNFITGWFNDYLK
>NZ_CP042593.1|WP_057774848.1|1670359_1671379_+|3-oxoacyl-ACP-synthase
MDIGILSTGIYLPDQYITGEEIAIKAGIPKEIVEGKMGIKRKTVPGIEDHTCEMGIRAAKKAIKKANIDPLNIDVVIYIGEEHKEYPLWTAGIKLQEELGAHNAWAFDTALRCGTTVMALKVAKNLMIADPEINTVLLAGGYRNGDFIDYKNPRTRFMYNLGAGGGAIILQKGLKKNCLLETEIMTDGSFSEDVVVVAGGTKYPLTSTALEEGRYQLDVLDPAGMKARLEQKSMSNFLNVIRKSVHKSGYSEKDISYVGMLHMKKSAHEYVLKELGLSEDASIYLEDYGHIGQIDQILSLELAEKSGKLNNGDVAVLVSAGIGYAWGASTIKWGEEIVE
>NZ_CP042593.1|WP_057774374.1|1671375_1672272_+|alpha/beta-hydrolase
MNEIMIKEVELPNGETISYRERLGGSQNILLVHGNMNSSMHWDVVLEKMDPKYKLYALDQRGFGLSSYHKPFHSIKELAEDLKYFIEAIGLKDFTIVGWSLGGAVCMQYVADNPDVCDKMILLASGSTRGYPLFESNENGFPDLTKRVQSYDQTKREKTKVVTTEHAYATRNREFLRMVYDAVIYTKNKPDPERYEEYIDDMLTQRNYAEILHALNTFNISKEFNGLTEGTGEAEKIKIPTLVLYGDRDLVITKEMNEEIVDDIGENAFFVELKDCGHSPLIDDLEQLLQAMSEFLDK
>NZ_CP042593.1|WP_057774371.1|1672285_1673026_+|3-oxoacyl-ACP-reductase-FabG
MRLKDKVAIITGAANGIGFAAAETFAREGASVALADYDAELGKARAGELQDKGFSVEFFQVNVAERESIDQMVTAVKDSFGKIDILVNNAGITRDGMLSKLSSEDFQSVLDVNLTGVFHCTQAVLPAMLEQGKGKIINTSSVSGVYGNIGQTNYAATKAGVVGMTKTWAKELGRKGINVNAVAPGFIYTGMTAKVPEKVIGQMQMMIPLGRLGNPEDIANAYLFLASNESDYVNGTVLHVDGGIMM
>NZ_CP042593.1|WP_057774368.1|1673249_1674761_+|long-chain-fatty-acid--CoA-ligase
MGWELDWLENRARLTPDSIALIEAEKNQMLTYKEINNRANGLAGWLADQGIGKGDRVALLSPNHISYFDLLFACGKLGAIFVPVNWRLSSEEIKYILQDCTPKIIGCHSNFSNIVMKVTNKHSKMIQTNSDRYEQIVKNKIEGMEKTAFLETDPLIIIYTGGTTGKPKGVVLSHQSIIWNAINTIISWGLNEKDVTLTYLPLFHTGGLNALSIPLLMSGGKVVIADQFDPVQAMDYLNSYKCTIVLFVPTMYHMISEKPEFSYASFPFTKTFLSGGAPCPLEIYAKFKNKGLQFKEGYGLTEAGPNNFFIGLEDADRKRGSVGKPMIINEVKIVKEDGTEARENETGELLIKGKHTFSHYWNNEEATKDAKKNDWLHTGDLARKDSEGYYYIVGRKKEIIITGGENVYPLEIEQWLSAHPDINEAAVIGLPDEKWGERVSAFISLKVDGALTVEEVQMYCRSKLGSYKIPRTIVILDELPKTHVGKVDKKELKRIGIQFQIEK
>NZ_CP042593.1|WP_057774365.1|1674789_1674981_-|hypothetical-protein
MNRTLIGYCVSCVGLGILFSAIVYPLGYLESTAVFYTMTTVGAGLVVIGSFIRPTRNKEKHEE
>NZ_CP042593.1|WP_057774362.1|1675030_1675462_-|GNAT-family-N-acetyltransferase
MEIRKACSSDWSELWYLLFSMGKTDSEHNTKQRFLNMLDNPQHYIPVAIIEKRIVGYGWLQDYGFHLRMGKKTSRMNDLFVLPEYRKIGIASNIFKAIQEWAIENETSWLQWNSSPNAVQFYQKLGLSPLIEEDDYPFFEIEF
>NZ_CP042593.1|WP_057774358.1|1675853_1679369_+|helicase-exonuclease-AddAB-subunit-AddB
MSVRLLIGRSGSGKTEYCLNEIRDELKRKPDGSTPIIYLVPEQMTFLSEYKLITTPDLGGMIRCQVYSFTRLAWRILQETGGMNRYHINSVGISMLIRKIIDEKKEELKLFQRAADKNGFIQQIEQIITEFKRYCVKPEELAERHDQLSTEEQSNNALQDKLHDLELIYKTFEESIINKYLDSEDYFRLLSEKALESAYLKNAEVYIDGFYSFTPQEYMIVEQLMKLCKKVTITLTLDRPFKQNSPDELHLFRMSGENCQTIYEIATANGLQMEEILLSDQKRWEKPSLQHLEANFDTRPAIGYKGETAVHIGQAVNRRAEIEGIARKINQLVRIEGMRYRNIAILLRNGQDYHDLIETVFQDYQIPVFIDQKRTMLNHPLVELIRSTLEVINGNWRYEPIFRAVKTELIFPVKLNNTLIREQMDRLENYVLAKGIQGDKWTNKKRWIYRRIMGLEFDSFVQTDVEKEIEQELNDLRDMITGPILRLSRRLNKAKFGRQFCEAVYLYLEELDVPAKIEQWKNSEEEKGNLVKSREHGQVWNAIMELLDQYVEMLGEDEVSQKQFASILDAGMETLRFSLVPPSLDQVVAADMVNSRLSDIRAAFIIGMNEGILPSKFSEDGVFADDDREKLLSNGMKIAPSGRTRLLDEDFIAYKAFVTPSEWLFISYPLANEEGKALMPSSYIKRLQDLLPECKQHYYLADLAELPEVEQLEYVSSLNTTLAYLTSQLQLKKRNYPIYDFWWDIYNFYLKNESWKRNVQKVLSSLNYENQTRKLNEHISQDLYGDTIHASVSRMELFHGCPFSHFVQHGLKLRERQIFRLEAPDIGELFHAALKYIAETVMNKRMSWTELTRQQCEILAQEAIEMLAPKLQNEILLSSNRHYYIKRKLEQIISRASFILSEHAKASGFSPVGLELGFGPGPKADLPPLSFPLKNGTKMELVGRIDRIDKAQEGNDVFLRVIDYKSSSKDLNINEVYYGLALQMLTYLDIVISHSKSLIGTEANPAGVLYFHVQNPIINTSKMLTLEEIEQEIFKKFKMNGLLLGEENVVKLMDQTLVTGDSSIISAGIKKDGSLSKRSKIASKEEFDHLRKYVRGMYTKTGNQIIGGNVDISPYKLKEKTPCTFCSFKSVCQFDESLDGNDYRLLVPQPKDEVLECMRREVEENANTNTI
>NZ_CP042593.1|WP_057774355.1|1679346_1683105_+|helicase-exonuclease-AddAB-subunit-AddA
MQTRIPSKPANATWTDDQWKAIMAKGQDVLVAAAAGSGKTAVLVERIINKIISEEDPINVDELLVVTFTNASAAEMRHRIGEALEKAINENPKSIHLRKQLSLLNKASISTLHSFCLEMIRKYYYMIDIDPGFRIADETEAQLLRDEVLEELFEEEYGKEGNEDFFALVDTFTNDRSDIALQEMIRNLYDFARANPSPDQYLDSIIEMYNVEKQTEIEQLPFVQSLLHDIDLQLNGAKQLLEYGLELTKLPGGPAPRAENFIDDLQIVNTLIQAKNDSWATLYQALQSWSFGRAKNCKGEEYDNELIEKAKKLRDKAKKIIQDIQDELFSRKPESFIRDMSEMKRHIESLVSSVKSFSHRFEQVKAEKGIVDFADLEHYCLTILSTIQEDGALLPSAAAFACKRQFKEVLVDEYQDTNMVQETILKLVTNDSELMGNLFMVGDVKQSIYRFRLAEPNLFLGKYNRFTKGGEEAGLRIDLAKNFRSRKEVLHGTNYLFKQLMDVSVGEIEYDEAAELINGAPYPVDETYPIELTVIDLEGKEEEEPQEAEEEVFDSADLAQSQLEARYMASKIKEIIAERKEVYNPKTKTGRPAMYRDIVILLRSMTWAPQIMEEFKQQGIPVYANLSSGYFEATEVAIMMSLLKIIDNPYQDIPLASVLRSPIVGLTEEELAQIRIHHKKGVFYEAISAFCLEKPSIQTEELYEKLLPFFEDLKEWRVMARKGSLSELIWHLYRETKFYDFVGGMPGGKQRQANLRALYDRARQYEATSFRGLFRFLRFIERMRDRGDDLGAARALGEQEDVVRLMTIHSSKGLEFPIVFIAGLGRNFNTMDLKKNYMLDKEYGFAAKYVNAEKRISYPSLPQLAFKRKKKMEMLAEELRVLYVALTRAKEKLYLVASVKSAEKKLSQWGKFAEAQDWLLNEFDRASANTYLDWIGPSLVRHKDCEPLRGKGSGINPLISEEIITHPSCWNVQILNGNEAASITEEMDIQREDLLDRVLSGEAIPVESPFKDLVEAQLSWKYKNLKASNHRSKQSVSEVKRQKEIFSHEDAGIEYIQKLKKPLLNRPQFMQEKSLSPAEKGTAMHTVMQHIDFSKEPTELSIAVKMEEMVQKELLTADQFEAIDPDLIVQFFHTDLGKRMIQAKGIKREIPFSVSFPTSDIYHEWEGEDEHVLIQGIIDCLFEDEHGLVLLDYKTDGITNRFKGGFTEARKVLEERYRVQIEMYSKALEQILKREISERYLFFFDGAHIIKL
>NZ_CP042593.1|WP_057774352.1|1683141_1683360_-|spore-germination-protein
MPAIIGPVQIIHVSGGVVQFGDTVIISPKTASKSTSGQGAINTGGFIVTNNGLSASNVLDTNLIDQPIVGNN
>NZ_CP042593.1|WP_057774349.1|1683435_1683828_-|spore-germination-protein-GerPE
MFRRTSIVDEIKIDTFFYSSIFQIGDSSIIQGFSRALAVQREQEIFYGNEGNFNVYPVFTKPIPFQPVEISIPMYTENLNPIIKVHHLDIVGVSVSSIIHIGSSNHVSMETRIKHIRQLLPKNKTQSESR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP042593_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP042593_2

3842110-3842188

Orphan

Consensus_repeat	Method
CCATTTTCTTCATGAAACGGGCATCAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP042593_2

>merge|NZ_CP042593|2|3842110-3842188|CRISPRCasFinder
CCATTTTCTTCATGAAACGGGCATCAATGATCGCTTTTGATTACCGCCTACCCCATTTTCTTCATGAGACGGGCATCAA

>NZ_CP042593|2|2|3842110-3842188|CRISPRCasFinder
CCATTTTCTTCATGAAACGGGCATCAA	TGATCGCTTTTGATTACCGCCTACC
CCATTTTCTTCATGAGACGGGCATCAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP042593.1\|WP_057772322.1\|3850744_3850942_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042593.1\|WP_146846518.1\|3830905_3832396_-\|o-succinylbenzoate--CoA-ligase	unknown	unknown	gnl\|CDD\|235146
NZ_CP042593.1\|WP_057772302.1\|3833735_3834584_-\|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase	unknown	unknown	gnl\|CDD\|274729
NZ_CP042593.1\|WP_057772312.1\|3841232_3841985_+\|molecular-chaperone-DnaK	unknown	unknown	gnl\|CDD\|274340
NZ_CP042593.1\|WP_057772316.1\|3844651_3846103_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NZ_CP042593.1\|WP_082625252.1\|3830620_3830773_+\|DUF1540-domain-containing-protein	unknown	unknown	gnl\|CDD\|377869
NZ_CP042593.1\|WP_057772318.1\|3846099_3847128_-\|glycogen-biosynthesis-protein-glgD	unknown	unknown	gnl\|CDD\|273966
NZ_CP042593.1\|WP_057772314.1\|3842268_3844662_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|340853
NZ_CP042593.1\|WP_057772320.1\|3848563_3850534_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|235445
NZ_CP042593.1\|WP_057776959.1\|3859709_3860636_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP042593.1\|WP_082625463.1\|3858912_3859092_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042593.1\|WP_057772310.1\|3839514_3839886_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|366361
NZ_CP042593.1\|WP_057772308.1\|3838428_3839358_+\|1,4-dihydroxy-2-naphthoate-polyprenyltransferase	unknown	unknown	gnl\|CDD\|235695
NZ_CP042593.1\|WP_146846520.1\|3847500_3848646_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NZ_CP042593.1\|WP_057772304.1\|3834583_3836335_-\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	unknown	unknown	gnl\|CDD\|236020
NZ_CP042593.1\|WP_057776960.1\|3859126_3859684_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP042593.1\|WP_057772298.1\|3829527_3830475_+\|zinc-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238499
NZ_CP042593.1\|WP_057772306.1\|3836331_3837738_-\|isochorismate-synthase	unknown	unknown	gnl\|CDD\|224091
NZ_CP042593.1\|WP_057776958.1\|3860883_3861576_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP042593.1\|WP_057772300.1\|3832845_3833667_-\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	unknown	unknown	gnl\|CDD\|180958

Protein	Function_ID	Function_description	E-value
NZ_CP042593.1\|WP_146846518.1\|3830905_3832396_-\|o-succinylbenzoate--CoA-ligase	gnl\|CDD\|235146	PRK03640, PRK03640, o-succinylbenzoate--CoA ligase.	0
NZ_CP042593.1\|WP_057772302.1\|3833735_3834584_-\|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase	gnl\|CDD\|274729	TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].	4.47919e-109
NZ_CP042593.1\|WP_057772312.1\|3841232_3841985_+\|molecular-chaperone-DnaK	gnl\|CDD\|274340	TIGR02890, conserved_hypothetical_protein, regulatory protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to Pfam family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. Smaller proteins from the proteobacteria with just the N-terminal domain, including DksA and DksA2 are RNA polymerase-binding regulatory proteins even if the Zn-binding site is not conserved. [Unknown function, General].	8.37773e-54
NZ_CP042593.1\|WP_057772316.1\|3844651_3846103_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NZ_CP042593.1\|WP_082625252.1\|3830620_3830773_+\|DUF1540-domain-containing-protein	gnl\|CDD\|377869	pfam07561, DUF1540, Domain of Unknown Function (DUF1540). This family has four conserved cysteines, which is suggestive of a metal binding function.	4.21345e-10
NZ_CP042593.1\|WP_057772318.1\|3846099_3847128_-\|glycogen-biosynthesis-protein-glgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	1.21818e-128
NZ_CP042593.1\|WP_057772314.1\|3842268_3844662_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|340853	cd04300, GT35_Glycogen_Phosphorylase, glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	0
NZ_CP042593.1\|WP_057772320.1\|3848563_3850534_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|235445	PRK05402, PRK05402, 1,4-alpha-glucan branching protein GlgB.	0
NZ_CP042593.1\|WP_057776959.1\|3859709_3860636_-\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	2.85845e-16
NZ_CP042593.1\|WP_057772310.1\|3839514_3839886_-\|VOC-family-protein	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	2.75355e-13
NZ_CP042593.1\|WP_057772308.1\|3838428_3839358_+\|1,4-dihydroxy-2-naphthoate-polyprenyltransferase	gnl\|CDD\|235695	PRK06080, PRK06080, 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated.	2.15238e-130
NZ_CP042593.1\|WP_146846520.1\|3847500_3848646_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NZ_CP042593.1\|WP_057772304.1\|3834583_3836335_-\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	gnl\|CDD\|236020	PRK07449, PRK07449, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated.	0
NZ_CP042593.1\|WP_057776960.1\|3859126_3859684_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	4.6766e-42
NZ_CP042593.1\|WP_057772298.1\|3829527_3830475_+\|zinc-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238499	cd01017, AdcA, Metal binding protein AdcA. These proteins have been shown to function in the ABC uptake of Zn2+ and Mn2+ and in competence for genetic transformation and adhesion. The AdcA proteins belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. They are comprised of two globular subdomains connected by a long alpha helix and they bind their ligand in the cleft between these domains. In addition, many of these proteins have a low complexity region containing metal binding histidine-rich motif (repetitive HDH sequence).	1.71888e-115
NZ_CP042593.1\|WP_057772306.1\|3836331_3837738_-\|isochorismate-synthase	gnl\|CDD\|224091	COG1169, MenF, Isochorismate synthase [Coenzyme metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	1.86765e-125
NZ_CP042593.1\|WP_057776958.1\|3860883_3861576_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	5.06344e-54
NZ_CP042593.1\|WP_057772300.1\|3832845_3833667_-\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	gnl\|CDD\|180958	PRK07396, PRK07396, dihydroxynaphthoic acid synthetase; Validated.	0

>NZ_CP042593.1|WP_057772312.1|3841232_3841985_+|molecular-chaperone-DnaK
MLTIEQLSQLKQQLNEEKASLESQLHGNKEGSLQGVNARETVGELSIYDNHPADMGSELYDRTKDFALEEHHDSELNKVNAALQAMEDRSYGKCKVCGNDIPFERLEALPYTLYCKEHSQEQRVPGDRPVEEDVLEPAHGNAFQHHQFREVIDNEDSFQEVARYGTSETPSDLRGDYEDYNSLYNEGHDDEGFTEDYETFIANNIEGTERMIFPSKKHEEYEAMLDEVGSDTPFGDVHYRRTDGYVEENE
>NZ_CP042593.1|WP_057772310.1|3839514_3839886_-|VOC-family-protein
MSKSFIEQVHYIRIPVKDLELSAQWYRDVLGLKLLKNTEELAILKVNEGPFLLILVPTEDETFAHFTIDNEQEFSIGFTSPELSKFHQHLIDNQVKVEDIIEDNGHAFFHFYDPNGNKLQVHW
>NZ_CP042593.1|WP_057772308.1|3838428_3839358_+|1,4-dihydroxy-2-naphthoate-polyprenyltransferase
MQTQMHTNIPPSNLKNWKVWWQLTRPHTLTASFVPVLLGTALALQEAEIHFGLLFAMLIASLLIQAATNMFNEYYDYKHGLDNEESVGIGGAIVRDGIKPKTILNLALALYGISLLIGVYICMSSSWWLALVGLVCMLVGYLYTGGPMPIAYTPFGEIVSGFFMGMIIILISFFIQTGTITPTSILVSFPILILVGAIMLSNNIRDLDGDKEFGRKTLAILLGRNRAIRLLAGMFIISYAWVFILIAMNIISPWLAIVILSAPKAIKATKGFIGKTVPIQMMPAMKATAQTNTIFGFLLSIGLFIGYLL
>NZ_CP042593.1|WP_057772306.1|3836331_3837738_-|isochorismate-synthase
MVTKQETELKEGILEAIDRAKALSKPVLVSEVQQINHIDPLTFFTAGVEGFFGERFFWKDPSEETFIIGMGICNQIQSDQAAGRFFHVEKEWKRFIKDAIIFNRFNLNGIGPLMFGGFSFDPLKEKTKLWSKYSDSLFHIPTFMYSVIQGKAFLTTNIICTQHDDYTLVEIINKERKALFSSIINAKKQDGHQLVKEIEINPAEWKETVSSVVKELKQGPLEKVVLARETRLIFDKQVKVENVLELLLKQQQDSFIFAFESNGDCFIGASPERLVKKTGNNLFTTCLAGSIARGKTKDEDQMLGEELLNDPKNLIEHQYVVKMIKEAMEEVCEEVSLPKETNLLKMRDIQHLYTPVAGVAKEDTSLLLLVDRLHPTPALGGLPKQEAVEKIREVEELDRGFYGAPLGWMDYQDNGEFAVSIRSGLIQKDEASIFAGCGVVKDSNADSEYIETKIKFRPMLTALGGNHK
>NZ_CP042593.1|WP_057772304.1|3834583_3836335_-|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase
MNHQEILTSYIAAFVSELVNIGVEDVVVSPGSRSTPMAMVMAEHPELRVHIHVDERSAAFFALGMAKASKRPVAILCTSGTAAANYFPAIVEANIARVPLIVLTADRPHELRDVGAPQAIDQVHLYGNHVKWFVEMAPPENSKDMIRYVRTICARAASTAKRSPAGPVHLNFPFREPLIPQLDTADLFELTERSAGYVSIQAGEYKLTNEEYREIGESLRSYKRGIIVCGSIEAEGFNDAVIALAERLQFPILSDPLSQLRSGSHSGTYIIDTYDTFLKNEKAKQFLKPDVVIRFGAVPVSKPLTIFLKENSDVRQFVIDGGAGWRDPGMVSSEMVYCHETDFCRSIISYINKDNSLSYFEKWEKINQLTRKNLAKVNEIDVLSEGKLFYQLTERLPEGATLFVGNSMPIRDLDTFFHFNHKSIRIMANRGANGIDGVISTALGAGTFLQPLYLVLGDLTFFHDQNGLIAAKQFGIDINILLINNNGGGIFSFLPQASHPKNFEQLFGTPLDLKFQSVVEMYGGHYELITSWEHLSSSINANKEKPGLKVMEITTNRDNNIQEHRELWDAVSREISQLLDGKC
>NZ_CP042593.1|WP_057772302.1|3833735_3834584_-|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase
MNFVINGIRYHVEIWGNPIGRPLLLLHGFTGNGASWREFETQWQDYSYLISVDIIGHGKTDSPKELHKYEIESAASDLYTLLEEMKIEQTDLLGYSMGGRLALTFALLYPEKVRKLILESSSPGLETDMEREARRLQDEKLANRIQVQGIEEFVDYWENIPLFESQKRLPEMIRRKLRMERLMNSTVGLMNSLKGMGTGSQPSWWGKLEKLTAPVLFITGSIDEKFCRIAERMQKEVKNGEWITVDDCGHAIHVEKPKIFGTIVREFLSHEIGKKISSTYHE
>NZ_CP042593.1|WP_057772300.1|3832845_3833667_-|1,4-dihydroxy-2-naphthoyl-CoA-synthase
MSAVEWVAGRKYEEIMYETYNGIAKITINRPEKHNAFTPRTVMELIDAFAYARDDSNVGVIILTGAGDRAFCSGGDQSVRGHGGYVGDDQIPRLNVLDLQRLIRVIPKPVVAMVKGYAIGGGHVLHIVCDLTIAADNAVFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLDKVEEETIKWCEEMLDKSPTALRFLKAAFNADTDGLAGIQQFAGDATLLYYTTDEAKEGRDAFKEKRKPDFGQFPRFP
>NZ_CP042593.1|WP_146846518.1|3830905_3832396_-|o-succinylbenzoate--CoA-ligase
MNDQMMQNFLLKRASLTPDRPAIYFADQTYTFSDVFDKAFHIAGQLTSLGLKRGQFAGVLLANHADSAFIYLAFQLLGVKAVILNNRLTAHELAWQMEDSDSLFLITEELFTLKSKEMEKSLPNVTIINKEDLFNSPFVEPIVVNEMNLNEVCTVMYTSGTTGFPKGVLQTYGNHMWSAIGSALNLGLTEQDCWLCAVPLFHISGYSILMRSIIYGMKMVILDSFHEKKAIDLIENEKVTIMSVVSTMLTRIEEELGDQRLPEHFRCMLLGGGPAPRGLLEKCMFKLIPVYQTYGMTETSSQIVTLSPEYSISKLGSAGKALFPSQLKIIVSNGKDAKPNEAGEILVKGPNITIGYLNREEETAKRIVDGWLSTGDIGYLDSDGFLFVLDRRSDLIISGGENIYPAEIEGVLVSHPNISDAGVIGMKDEKWGEVPIAFVTIKKDMKEEEMIQYCLEKLAKYKVPKKIYIIDEIPRNAAKKILRRNLRLLLNKNMKR
>NZ_CP042593.1|WP_082625252.1|3830620_3830773_+|DUF1540-domain-containing-protein
MAKDVLCEVNNCSYWAKGNKCAAEQIYVVSHKGNTADNSKETDCKTFEPS
>NZ_CP042593.1|WP_057772298.1|3829527_3830475_+|zinc-ABC-transporter-substrate-binding-protein
MKKLLLFLFIFNLILTGCTTKKESPKKNDNKLTVYTTVYPLQYFTERIGGDYVETHSIYPPGADEHTFEPTQKDMIKLADADLFIYIGLGLEGFVEKSKKTLKNEHVKLISAGDNVHLDSTAAEDGHHEDGEHHEDDGHNHGGIDPHVWIDPVYAKELAEAVKDALLEEMPEHKDEFIANYDELIKELDQLNADFEQVANHAKHKEIIVSHSAYGYWEKRYGIKQIGVSGLNTSNEPSQKQLEKIINVAKEHDLKYVFFEQNVSSKLTEIIQKEIGAEPLVLHNLSTLTDNDIKNNADYFSIMKDNLQALEKALN
>NZ_CP042593.1|WP_057772314.1|3842268_3844662_-|glycogen/starch/alpha-glucan-phosphorylase
MFSNKENFKQAFLQKLEMMCGKSFGESTKRDQFSTLGNMVREYISTEWINTNECYRTSKGKQVYYFSIEFLLGRLLYHNLLNLGIEDVVKDGLKDLGIDLCALEEIESDAGLGNGGLGRLAACFMDSLASLNLPGHGCGIRYKHGLFEQKIVDGYQVELPEQWLRHGHVWEVRREDLAVKVPFWGSVDCKEENGELLFRHIDAETITAVPYDMPIVGYKTETVNTLRLWNAEPSAYPVHKDILKYKRDTELVSEFLYPDDTHDEGKILRLKQQYFLVSASLQSIILSYKKQHQCLHAFHEHISIHINDTHPVLAIPELMRILLDEEGMGWDEAWHITVNTISYTNHTTLSEALEKWPVRIFQPLLPRIYMIVDEINERFCQHLWEKYPGEWKRIESMAIIAQDQVKMAHLALVGSYSVNGVAALHTDILKKREMNSFYQIFPGKFNNKTNGITHRRWLLKANPLLASLISEGIGDDWIWEPNKLIQLRKYEEDRSFLQQLFQVKQQNKTRLASRIKEKTGLVVDTASIFDIHVKRLHAYKRQLLNILHVMYLYNRLKEDSSFQMHPRTFIFGAKASPGYYYAKKIIKLINTVADKVNEDVMTKEKLKVVFLENYRVSSAEEVFPAADISEQISTASKEASGTGNMKFMMNGALTVGTLDGANVEMMEKVGSDHLFIFGLTAEKVMEYEQQGGYHSLDYYHHDKRIRQVVDQLINGFFSDVDGEFEPIVDSLLMENDQYFVLRDFDSYVNIQKQAERTYENQDQWLKMSLRNIAASGYFSSDRTIREYAEDIWKIKSI
>NZ_CP042593.1|WP_057772316.1|3844651_3846103_-|glycogen-synthase-GlgA
MKVLFVVSECVPFVKSGGLADVAGSLPKEIIKQGTDIRVILPKYGLILNEFKSKMTKKAEFTVKVGWRNQYCGIEEIKYEGITYYFIDNEYYFNREKLYGDYDDGERFAFFNRAVLDALPYIPFYPDVIHCHDWHTGMIPFLLRVEYQAKKGYEFIRTVFTIHNLKFQGIMPKEALADLLCLSDRHFHVDQLEFYGNINFMKGAIVAADKITTVSPTYKNEIQMEHYGENLHLLLQHRSSDLEGILNGIDETIYNPENDYFLTESYHHKNLKKKSANKLHIQEQFALPKAANIPLIAMVTRLTEQKGLDLLRCVFQELMSDNIQMMILGTGDDQYEQFFKEMELAYPNKFRAYIGFDEGLAHQIYAAADLFLMPSKFEPCGLGQMIAMKYGAIPIVRETGGLNDTVQSFNEGTGKGNGFSFKHFNAHDMLFTIQRALSFYRDESCWNMIVKNAMTMDYSWAQSAYQYNSLYAEIISRSESHVF
>NZ_CP042593.1|WP_057772318.1|3846099_3847128_-|glycogen-biosynthesis-protein-glgD
MKNRLLGVIDATTYHEELGELMIHRSLAALPFAGRYRLIDFVLSNMVNSDIESVAIFPKFQYRSLMDHLGSGKNWDLNRKRDGLFFFPSPIVDGEKHGIGSFSHFAANLDYFKKSRQEYALISNCYTVFNMDFRPVLDRHIQTGCDITEIRKHGRSLEMYLIKTSLLIELILKRDMTGYSCMHDVVSSYHHSYQICTYEYEGYAEMIDTINKYFTINLDLLQPHIWKSLFLRDQPIYTKVKDEPPTRYLKEASVHHSMIANGCQIEGTVENCIISRGVKIGVGSVVRNCIIMQKSQIGENCRLDSVILDKDVKVESGTLLKGSNESPYVIRKGTIQGALMNS
>NZ_CP042593.1|WP_146846520.1|3847500_3848646_-|glucose-1-phosphate-adenylyltransferase
MAKKKCVAMLLAGGKGSRLHSLTQNLAKPAVPFGGKYRIIDFTLSNCTNSGIDTVGVLTQYQPLVLNSYIGIGSAWDLDRRNGGVTVLPPYSESSEVRWYTGTASAIYQNLNYLKQYDPEYVLVLSGDHIYKMNYELMLDYHIEKGADATISVIEVPWEEANRFGIMNTSDDMKIIQFEEKPTGPKNNLASMGIYIFNWRLLKEYLEIDALNPDSSHDFGKDIIPMLLEEKKHLFAYPFKGYWKDVGTVKSLWEANMDLLDEKCELNLFDYDWRIYSVNPNHPPQYISTEARVKCSLINEGCTVEGEVEKSVLFQGVMIGKGSFIRETVIMPNAKIGQNVFIENAIIPSNMSIPDGMVIRGSEEKDKIVLVSNEMLQKFVS
>NZ_CP042593.1|WP_057772320.1|3848563_3850534_-|1,4-alpha-glucan-branching-enzyme
MYMNTVSPTDYEMHLFHEGTLYEGFRLFGSHVIKQEDKVSTRFCLWAPNAEIIRLVGDFNDWNGEGYPLHRVNNEGIWVIDIDHNLQGALYKYEIFTKEGNRFLKSDPFSYYSEIRPGTASIVYSLEDYKWNDHIWMQKREKKNLLAEPVAIYEVHLGSWRKRADGSFLSYKELAHTLIPYVVEHGFTHIELLPLIEHPLDESWGYQGTGYYSVTSRYGTPHDFMFFIDQCHQKGIGVILDWVPGHFCKDANGLHQFDGSYLYEYENEWDRENMIWGTANFDLSKNEVQSFLISNAIFWMEYYHIDGFRLDAVANILFWPNRYEKSESPFGIQFLQKLNQVVYDRDPSFLLMAEDSTDWPQVTFPTQYGGLGFHYKWNMGWMNDVLCYMETSPESRSHAHGKMTFSLLYAFKENFVLPLSHDEVVHGKKSLLNKMPGDYWEKFAQMRLLLSYMIAHPGKKLLFMGSELGQFAEWKDKEQLDWHLLDYEMHQKMNVFVKELLKLYSRSRPFYELDFLQDGFEWIDVNNYQQSIFSFIRFGKREDEHLVVICNFKDQAYDEYQVGVPKYGSYREIFNSDREVFGGSNCINKKVLKTENQAYHGKPYSVKMTIAPFSVSILRPVKHRKERKGNGKEKVCSHVTGRGKGKQASFIDTKSS
>NZ_CP042593.1|WP_057772322.1|3850744_3850942_+|hypothetical-protein
MSNREEDFLIKEATKNEIKIPVFGPPDGKIMATGEIFRGPSTGITSEFDLENPGRKLLEKDQKFD
>NZ_CP042593.1|WP_082625463.1|3858912_3859092_+|hypothetical-protein
MLLETAALYLSVFMAVYLFSYAYVEGIKIANSEGKIYGGTFIFSVTSGFIFSGLTYVFI
>NZ_CP042593.1|WP_057776960.1|3859126_3859684_-|GNAT-family-N-acetyltransferase
MHFEKTFVEFPELETEKVILRKLQMSDAPRMFSYFSKDEVTKFYDLDTFTSEKQASDLIERLLNRYNERKQIRWAIVLKETGLFIGTCGFHAIEEEHWKAEIGYELHPDNWGQGIMTEVIGAVIQYGFNEMKLNRIEAFYDPKNISSGRVLEKNGFVYEGLLKKRFFEKGKFVDAAISAIIKDNF
>NZ_CP042593.1|WP_057776959.1|3859709_3860636_-|DMT-family-transporter
MSDTKINPYVALAIGVFSVSTSAILVKVSTAPSGVIAFYRLFFSVLIMLPIFLIKYVPELRLITKRDWLFSTIAGVFLAFHFILWFESLNYTSVASSTVLVTLQPLFAFIGTYFFFKEKFSWKAILSGIIAVFGSVIISWGDFKISGSALFGDILALIACALVTAYLMFGQTVRKRLSLITYTFVVYSISTITLFIYVLIKQEPLLPYGTSDWVYFILLALIPTLLGHTIFNWSLKWLSTSTISMAILFEPVGAAVLAYYLLQESVVWTQLLGGGIIIIGVSLFLLDERSVRMKEMKKRKVSDQTRLN
>NZ_CP042593.1|WP_057776958.1|3860883_3861576_+|MgtC/SapB-family-protein
MSELELEILMKLGISAVLGLVIGIERELKRKPVGLKTSLVISIVSCLLTIVSIESAYIFPGKEGVNIQMDPLRLAAQIVSGIGFLGAGVILRRGNDSISGLTTAALIWGAAGIGIAVGAGFYLEAMTGVALLIISVEVIPFLIGLIGPKQLREKEFTLQLKVTNKENIEEILSAIKNLKISIKRVRIKDLEEKKHLVQLKVTINNKKSITDVYYSVSELEGVKSVDIESL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1082228 : 1124367

Bacillus_phage(20.0%)

transposase,coat,integrase

attL 1080102:1080148|attR 1125518:1125564

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1080102:1080148	attL	NA	NA	NA	NA
WP_146846389.1\|1082228_1083556_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.8e-31	36.3
WP_146846391.1\|1083863_1085048_+	DUF4309 domain-containing protein	NA	NA	NA	NA
WP_057775926.1\|1085175_1086408_-	aminopeptidase	NA	NA	NA	NA
WP_057775925.1\|1086542_1087823_-	MFS transporter	NA	NA	NA	NA
WP_057775924.1\|1088043_1088994_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_057775923.1\|1089013_1090630_-	hypothetical protein	NA	NA	NA	NA
WP_057775922.1\|1090831_1092028_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_057775921.1\|1092011_1093115_-	GerAB/ArcD/ProY family transporter	NA	NA	NA	NA
WP_057775920.1\|1093130_1094654_-	spore germination protein	NA	NA	NA	NA
WP_057775919.1\|1095079_1097269_+	DNA topoisomerase III	A0A2K9V7T1	Bandra_megavirus	1.8e-23	26.0
WP_057775918.1\|1097441_1098137_+	response regulator transcription factor	NA	NA	NA	NA
WP_057775917.1\|1098140_1099076_+	sensor histidine kinase	B5LWN0	Feldmannia_species_virus	1.4e-09	24.6
WP_057775916.1\|1099232_1099688_-	hypothetical protein	NA	NA	NA	NA
WP_057775915.1\|1100066_1100558_+	hypothetical protein	NA	NA	NA	NA
WP_057775914.1\|1100691_1101369_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_057775913.1\|1101361_1102285_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.9e-44	45.9
WP_057775911.1\|1103142_1104642_+	histidine ammonia-lyase	A0A1V0S940	Catovirus	1.7e-102	43.5
WP_057776053.1\|1104682_1104862_-	hypothetical protein	NA	NA	NA	NA
WP_057775910.1\|1105036_1105411_+	DUF1992 domain-containing protein	NA	NA	NA	NA
WP_057775909.1\|1105877_1106975_+\|coat	spore coat protein	NA	NA	NA	NA
WP_146846393.1\|1107113_1107332_+	hypothetical protein	NA	NA	NA	NA
WP_057775908.1\|1107645_1108440_+	flagellar motor stator protein MotA	NA	NA	NA	NA
WP_057775907.1\|1108432_1109209_+	flagellar motor protein MotB	NA	NA	NA	NA
WP_057775906.1\|1109223_1109535_-	hypothetical protein	NA	NA	NA	NA
WP_057775905.1\|1109571_1110057_-	hypothetical protein	NA	NA	NA	NA
WP_057776989.1\|1110391_1111666_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_057776980.1\|1112102_1112675_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_146846394.1\|1112981_1113245_-	hypothetical protein	NA	NA	NA	NA
WP_057776982.1\|1113540_1114341_+	hypothetical protein	NA	NA	NA	NA
WP_057776984.1\|1115031_1115652_-	hypothetical protein	NA	NA	NA	NA
WP_057776983.1\|1115982_1116921_-	hypothetical protein	NA	NA	NA	NA
WP_057776985.1\|1117178_1117670_-	hypothetical protein	NA	NA	NA	NA
WP_057776989.1\|1117896_1119171_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_035443795.1\|1119848_1120166_+	hypothetical protein	NA	NA	NA	NA
WP_057775408.1\|1120428_1120902_-	hypothetical protein	NA	NA	NA	NA
WP_057775439.1\|1120870_1123009_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_057775406.1\|1123014_1124367_-\|integrase	site-specific integrase	NA	NA	NA	NA
1125518:1125564	attR	NA	NA	NA	NA

DBSCAN-SWA_2

3128309 : 3179542

Bacillus_phage(25.0%)

coat,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_057771338.1\|3128309_3129509_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	1.7e-41	43.0
WP_057771339.1\|3129510_3130650_-	N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA	NA	NA	NA	NA
WP_057771530.1\|3130646_3131363_-	bacillithiol biosynthesis deacetylase BshB1	NA	NA	NA	NA
WP_057771340.1\|3131355_3131775_-	methylglyoxal synthase	NA	NA	NA	NA
WP_057771341.1\|3131785_3132586_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_057771342.1\|3132601_3132931_-	nucleotide pyrophosphohydrolase	NA	NA	NA	NA
WP_057771343.1\|3133130_3133991_+	YitT family protein	M1Q1P6	Streptococcus_phage	1.4e-69	45.3
WP_057771344.1\|3134093_3134774_-\|protease	Zn-dependent protease	NA	NA	NA	NA
WP_057771345.1\|3134867_3135662_-	sporulation protein YpjB	NA	NA	NA	NA
WP_057771346.1\|3135750_3136347_-	DUF1405 domain-containing protein	NA	NA	NA	NA
WP_057771347.1\|3136531_3137305_-	cytochrome C oxidase Cbb3	NA	NA	NA	NA
WP_057771348.1\|3137348_3138023_-	cytochrome b6	NA	NA	NA	NA
WP_057771349.1\|3138026_3138533_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_057771350.1\|3138682_3139147_-	YpiF family protein	NA	NA	NA	NA
WP_057771351.1\|3139244_3139787_-	YpiB family protein	G3MAV7	Bacillus_virus	2.1e-42	50.6
WP_057771352.1\|3139928_3141185_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_057771353.1\|3141204_3142110_-	hypothetical protein	NA	NA	NA	NA
WP_057771354.1\|3142226_3143513_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_057771355.1\|3143555_3144662_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_057771531.1\|3144820_3145918_-	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	2.3e-24	29.3
WP_057771356.1\|3145958_3146333_-	chorismate mutase	NA	NA	NA	NA
WP_057771357.1\|3146350_3147421_-	3-dehydroquinate synthase	NA	NA	NA	NA
WP_057771358.1\|3147422_3148595_-	chorismate synthase	NA	NA	NA	NA
WP_057771359.1\|3148850_3149624_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_057771360.1\|3149958_3150405_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	1.1e-28	45.1
WP_057771361.1\|3150524_3151487_-	heptaprenyl diphosphate synthase component II	NA	NA	NA	NA
WP_057771362.1\|3151556_3152264_-	demethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_057771363.1\|3152266_3153085_-	heptaprenyl diphosphate synthase component 1	NA	NA	NA	NA
WP_057771364.1\|3153302_3153539_-	trp RNA-binding attenuation protein MtrB	NA	NA	NA	NA
WP_057771365.1\|3153605_3154172_-	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	2.0e-48	55.6
WP_082625227.1\|3154464_3154785_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.4e-30	80.0
WP_057771367.1\|3155128_3156607_-	stage IV sporulation protein A	NA	NA	NA	NA
WP_057771532.1\|3156829_3157543_-	hypothetical protein	NA	NA	NA	NA
WP_057771368.1\|3157634_3157835_-	DUF2768 domain-containing protein	NA	NA	NA	NA
WP_057771369.1\|3158353_3159424_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_057771370.1\|3159494_3160805_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_057771371.1\|3161003_3161612_-	hypothetical protein	NA	NA	NA	NA
WP_082625228.1\|3161742_3161880_+	YpzI family protein	NA	NA	NA	NA
WP_057771533.1\|3161928_3162990_-	type 2 isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_057771372.1\|3163001_3164141_-	30S ribosomal protein S1	NA	NA	NA	NA
WP_057771373.1\|3164310_3164892_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_057771374.1\|3164894_3165569_-	(d)CMP kinase	NA	NA	NA	NA
WP_057771375.1\|3165683_3165863_-	YpfB family protein	NA	NA	NA	NA
WP_057771534.1\|3165926_3166589_-	pilus assembly protein PilZ	NA	NA	NA	NA
WP_057771376.1\|3166755_3168105_-	germination protein YpeB	NA	NA	NA	NA
WP_057771377.1\|3168119_3168950_-	spore cortex-lytic enzyme	A0A172JHR8	Bacillus_phage	1.6e-22	41.5
WP_057771378.1\|3169070_3169742_-\|protease	intramembrane metalloprotease PrsW	NA	NA	NA	NA
WP_057771379.1\|3169951_3170929_+	asparaginase	NA	NA	NA	NA
WP_057771380.1\|3170994_3171960_-	YpdA family putative bacillithiol disulfide reductase	NA	NA	NA	NA
WP_057771535.1\|3172304_3173579_-	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
WP_057771381.1\|3173849_3174428_-	genetic competence negative regulator	NA	NA	NA	NA
WP_057771382.1\|3174539_3175319_-	metallophosphoesterase	NA	NA	NA	NA
WP_057771383.1\|3175371_3175734_-	hypothetical protein	NA	NA	NA	NA
WP_057771384.1\|3175784_3176417_-	CBS domain-containing protein	NA	NA	NA	NA
WP_057771385.1\|3176554_3176785_+\|coat	spore coat associated protein CotJA	NA	NA	NA	NA
WP_057771386.1\|3176781_3177042_+\|coat	spore coat protein CotJB	NA	NA	NA	NA
WP_057771387.1\|3177085_3177655_+\|coat	spore coat protein CotJC	NA	NA	NA	NA
WP_057771388.1\|3177708_3178167_-	YpbF family protein	NA	NA	NA	NA
WP_057771389.1\|3178280_3178952_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_057771390.1\|3178948_3179542_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

4151597 : 4156066

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_146846537.1\|4151597_4152158_-	YitT family protein	M1Q1P6	Streptococcus_phage	2.8e-10	29.9
WP_057773591.1\|4152586_4153276_-	LysM peptidoglycan-binding domain-containing protein	A0A0N6W8I1	Bacillus_phage	5.1e-54	41.1
WP_057773593.1\|4153370_4153610_-	hypothetical protein	A0A0S2SXN3	Bacillus_phage	2.5e-16	60.3
WP_057773595.1\|4153624_4153879_-	hypothetical protein	NA	NA	NA	NA
WP_057773598.1\|4154204_4154663_-	helix-turn-helix domain-containing protein	A0A2H4J4R7	uncultured_Caudovirales_phage	1.1e-41	55.3
WP_057773599.1\|4155172_4155613_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	1.4e-25	43.2
WP_057773601.1\|4155631_4156066_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	2.0e-43	59.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP042593

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection