CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP040174	Arthrobacter sp. UKPF54-2 chromosome, complete genome	1 crisprs	csa3,DEDDh,WYL,DinG	1	6	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040174_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040174_1

2531175-2531552

Orphan

Consensus_repeat	Method
NGACCAGNGNGGCGNCNC	CRT

8 spacers

The CRISPR arrays of NZ_CP040174_1

>merge|NZ_CP040174|1|2531175-2531552|CRT
CGACCCTGGTGGTGACACTGGTGGCAACCAGAACGGCGACCAGGGTGGCGGCACCGGCGGCGACCAGGGCGGTGACCAGAACGGCGACCAGGGTGGCGGCACCGGCGGCGACCAGGGTGGCGACCAGGGCGGTGACCAGAACGGCGACCAGGGTGGCGGCACTGGTGGTGACCAGGGTGGCGGCACTGGTGGTGACCAGGGTGGCGACCAAGGCGGTGACCAGAACGGCGACTCGGGTGGTGACCAGAACGGCGACCAGGGCGGTGACCAGAACGGCGACTCGGGTGGTGACCCGAACGGCGACCAGGGCGGTGACCACAGCGGCGACTCGGGCGGTGACCACAACGGCGACCACGGCGGTGACCAGAGCGGCGACTC

>NZ_CP040174|1|1|2531175-2531552|CRT
CGACCCTGGTGGTGACAC	TGGTGGCAACCAGAACGG
CGACCAGGGTGGCGGCAC	CGGCGGCGACCAGGGCGGTGACCAGAACGG
CGACCAGGGTGGCGGCAC	CGGCGGCGACCAGGGTGG
CGACCAGGGCGGTGACCA	GAACGGCGACCAGGGTGGCGGCACTGGTGG
TGACCAGGGTGGCGGCAC	TGGTGGTGACCAGGGTGGCGACCAAGGCGG
TGACCAGAACGGCGACTC	GGGTGGTGACCAGAACGGCGACCAGGGCGG
TGACCAGAACGGCGACTC	GGGTGGTGACCCGAACGGCGACCAGGGCGG
TGACCACAGCGGCGACTC	GGGCGGTGACCACAACGGCGACCACGGCGG
TGACCAGAGCGGCGACTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040174.1\|WP_146337246.1\|2515620_2516586_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|184735
NZ_CP040174.1\|WP_146337258.1\|2533955_2535068_+\|branched-chain-amino-acid-aminotransferase	unknown	unknown	gnl\|CDD\|237363
NZ_CP040174.1\|WP_146337247.1\|2516691_2517630_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP040174.1\|WP_146337257.1\|2532771_2533824_+\|3-isopropylmalate-dehydrogenase	unknown	unknown	gnl\|CDD\|179579
NZ_CP040174.1\|WP_146337251.1\|2523549_2525145_+\|phosphoglycerate-dehydrogenase	unknown	unknown	gnl\|CDD\|237436
NZ_CP040174.1\|WP_146337263.1\|2539584_2540973_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224428
NZ_CP040174.1\|WP_146337261.1\|2537224_2538772_+\|glutamate--tRNA-ligase	unknown	unknown	gnl\|CDD\|234953
NZ_CP040174.1\|WP_146337259.1\|2535586_2536402_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293836
NZ_CP040174.1\|WP_146337262.1\|2538771_2539503_+\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|223943
NZ_CP040174.1\|WP_146337250.1\|2522392_2523418_+\|ketol-acid-reductoisomerase	unknown	unknown	gnl\|CDD\|235491
NZ_CP040174.1\|WP_146337249.1\|2519892_2521791_+\|acetolactate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|236098
NZ_CP040174.1\|WP_146337253.1\|2528136_2528904_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP040174.1\|WP_146337264.1\|2543482_2545099_+\|ABC-transporter	unknown	unknown	gnl\|CDD\|206743
NZ_CP040174.1\|WP_146338566.1\|2541713_2543486_+\|ABC-transporter	unknown	unknown	gnl\|CDD\|366045
NZ_CP040174.1\|WP_146337252.1\|2525350_2528140_+\|FtsX-like-permease-family-protein	unknown	unknown	unknown
NZ_CP040174.1\|WP_138768975.1\|2521793_2522306_+\|acetolactate-synthase-small-subunit	unknown	unknown	gnl\|CDD\|183365
NZ_CP040174.1\|WP_146337256.1\|2531959_2532709_+\|sortase	unknown	unknown	gnl\|CDD\|320678
NZ_CP040174.1\|WP_146337260.1\|2536412_2537189_+\|DUF2437-domain-containing-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP040174.1\|WP_146337248.1\|2517769_2519491_+\|dihydroxy-acid-dehydratase	unknown	unknown	gnl\|CDD\|234861
NZ_CP040174.1\|WP_146337254.1\|2528913_2530473_+\|methionine--tRNA-ligase	unknown	unknown	gnl\|CDD\|237012

Protein	Function_ID	Function_description	E-value
NZ_CP040174.1\|WP_146337246.1\|2515620_2516586_-\|hypothetical-protein	gnl\|CDD\|184735	PRK14547, rplD, 50S ribosomal protein L4; Provisional.	6.32243e-09
NZ_CP040174.1\|WP_146337258.1\|2533955_2535068_+\|branched-chain-amino-acid-aminotransferase	gnl\|CDD\|237363	PRK13357, PRK13357, branched-chain amino acid aminotransferase; Provisional.	0
NZ_CP040174.1\|WP_146337247.1\|2516691_2517630_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.74094e-29
NZ_CP040174.1\|WP_146337256.1\|2531959_2532709_+\|sortase	gnl\|CDD\|320678	cd05829, Sortase_F, Sortase domain found in the class F family of sortases. Class F sortases are mainly present in Actinobacteria, Chlorobacteria and Firmicutes. Their functions are largely unknown.	4.94869e-21
NZ_CP040174.1\|WP_146337251.1\|2523549_2525145_+\|phosphoglycerate-dehydrogenase	gnl\|CDD\|237436	PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional.	0
NZ_CP040174.1\|WP_146337263.1\|2539584_2540973_-\|hypothetical-protein	gnl\|CDD\|224428	COG1511, COG1511, Predicted membrane protein [Function unknown].	9.44986e-20
NZ_CP040174.1\|WP_146337261.1\|2537224_2538772_+\|glutamate--tRNA-ligase	gnl\|CDD\|234953	PRK01406, gltX, glutamyl-tRNA synthetase; Reviewed.	0
NZ_CP040174.1\|WP_146337259.1\|2535586_2536402_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293836	cd16278, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	2.07163e-76
NZ_CP040174.1\|WP_146337262.1\|2538771_2539503_+\|HAD-IA-family-hydrolase	gnl\|CDD\|223943	COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only].	4.82375e-29
NZ_CP040174.1\|WP_146337250.1\|2522392_2523418_+\|ketol-acid-reductoisomerase	gnl\|CDD\|235491	PRK05479, PRK05479, ketol-acid reductoisomerase; Provisional.	0
NZ_CP040174.1\|WP_146337249.1\|2519892_2521791_+\|acetolactate-synthase-large-subunit	gnl\|CDD\|236098	PRK07789, PRK07789, acetolactate synthase 1 catalytic subunit; Validated.	0
NZ_CP040174.1\|WP_146337253.1\|2528136_2528904_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	5.33853e-67
NZ_CP040174.1\|WP_146337264.1\|2543482_2545099_+\|ABC-transporter	gnl\|CDD\|206743	cd11383, YfjP, YfjP GTPase. The Era (E. coli Ras-like protein)-like YfjP subfamily includes several uncharacterized bacterial GTPases that are similar to Era. They generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.	4.52093e-29
NZ_CP040174.1\|WP_146338566.1\|2541713_2543486_+\|ABC-transporter	gnl\|CDD\|366045	pfam00350, Dynamin_N, Dynamin family.	1.44148e-09
NZ_CP040174.1\|WP_138768975.1\|2521793_2522306_+\|acetolactate-synthase-small-subunit	gnl\|CDD\|183365	PRK11895, ilvH, acetolactate synthase 3 regulatory subunit; Reviewed.	4.42334e-86
NZ_CP040174.1\|WP_146337257.1\|2532771_2533824_+\|3-isopropylmalate-dehydrogenase	gnl\|CDD\|179579	PRK03437, PRK03437, 3-isopropylmalate dehydrogenase; Provisional.	0
NZ_CP040174.1\|WP_146337260.1\|2536412_2537189_+\|DUF2437-domain-containing-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	4.57873e-99
NZ_CP040174.1\|WP_146337248.1\|2517769_2519491_+\|dihydroxy-acid-dehydratase	gnl\|CDD\|234861	PRK00911, PRK00911, dihydroxy-acid dehydratase; Provisional.	0
NZ_CP040174.1\|WP_146337254.1\|2528913_2530473_+\|methionine--tRNA-ligase	gnl\|CDD\|237012	PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed.	0

>NZ_CP040174.1|WP_146337254.1|2528913_2530473_+|methionine--tRNA-ligase
MTPSEKTPYYITTAISYPNGVPHIGHAYEVIATDAMARFKRLDGYDVFFMTGTDEHGLKMQQTAEKEGIPVKELADRNSTAFRQMSDDLGISLNRFIRTTDPDHYEAAKALWQRMEANGDIYLSKYAGWYSVRDERYFVEDETEVRDDGLRYASETGTEVTWTEEESYFFKLSAYQDRLLALYADHPEFGAPHSRFNEVISFVKGGLEDLSISRTSFKWGVPVPGNPDHVMYVWVDALTNYLTGVGFPDTESESFRKYWPADVHVIGKDISRFHAVYWPAFLMSAGLDLPKRVMIHGHLHNQGIKMSKSLGNVVAPADWVAQYGLDQVRFFLLREVPFGADGNYSHDAIVGRMNSDLANNFGNLAQRSLSMVAKNCEGAVPVPGGFSAEDAALLGQAKGLLGIARAAFEKQEFSRALEAIWNVLGDTNAYFAEQAPWVLRKTDVERMNTVLYVTLEVLRTVAILAQPVMPAAAGAILDSLGQPEGEARDFAALETPIEAGTALPAPSPVFPKYEEPAEA
>NZ_CP040174.1|WP_146337253.1|2528136_2528904_+|ATP-binding-cassette-domain-containing-protein
MTNELNLTRAARNRMPESTGNGGHQTRANTIVKASDHATPLELSNITIHYGGGKGGAEPVNVVDDFNMTLHAGEMHCVAGRSGSGKTSILTVGAGLTLPTSGRVFWEGDSLETMGDDEIADRRRALIGYVDQGGALIDGMSALENVLLPAVPDGEVEQRRDMAKDLLDLVGLGRRMRHRPAQLSGGERQRVAIARALILGTRVLVVDEPTASLDRTSANRIISILKDTTSDGIAVLVASHDHELVRQSDTLTELI
>NZ_CP040174.1|WP_146337252.1|2525350_2528140_+|FtsX-like-permease-family-protein
MNAVQRFIRSRVLLLTASILIVAMCLSVLVQGQSQAALNRTVDQNSRGLYDVLVQAKADDNAGLMQPEIATGQGGVSFEQLDAIRKLAGTSVAAPISLVSRVSQNLESPRLDATDYLGYSAGLAGTAGDPSATDPSKWPAAESVLSDTAKKYRLTASAVSSDGKSEQTLFKTTAEGSLGKAKLVEEQVAGGKNVRIAGPAGETGIKFPAPAGGSEHNLFNLSVSLPMAPQVTESVVAVDPVAERALLGGAGDFLAPLEKAPPADARNAGAIGRHFESLFTNGISMEQLKQGPDFLGVKLKYWAPLMSQYQQAKRAGQLTADSQAIPLIVRSGTSLDLKYSVKIEEIDAAGNVIKDVGTATRSLDKDYLPFVSKSPFALAWPGSKDLTQLMGDTGSFGQGLYNPATWSTDFAAAPKYKDGETAGNGAVDKSAVPGDWITVNRLPEKGANGAPVDQTQRTPVDERAYRDNLATGKKPATPLAMVYGTFDPAKVQEAAGDVNRLPLGGYDPTPMTLSKDAAGNDAGQAVLKPSLSGTGLVSQSAGAITDYYGLAAARGYEKNASVIDAVRVRAKVDGSWKQAQPEVEKLANEIRDMGLQATVVAGSAREDANIFVPGYSKDDAGKESPLGTVQQSWVRQDAADAVSGSLTGTNLTLLFLTLCGAALLTGASTVSYVRKRRREAGTLRAMGWTQRKIRSWVLAEFGVGAALLTVAGIALSLISWNVATAIVSASVLVLYSGAAFFAAQQLRHREVIDQEPQHDERLIPVDSPLTFASRQLSTNKFNTGSLAVAVGVFGAAVGGLAALLIDIPRAAGASALSGLAAASIALPSIVLGVSGVAVGLLLTMVTGRFELGAKRQYLGTLQAMGWNPDMLGQVRFFENAMVGTIALPLGVLGALGISLLLAPYAAIWAGIAGLVAVLCWIPIATKVVQ
>NZ_CP040174.1|WP_146337251.1|2523549_2525145_+|phosphoglycerate-dehydrogenase
MTSTKPVVLLAEELSPATVEALGPDFEIRQTDGADRSQLLSAIADVDAILIRSATQVDAEAIAAAKNLKVIARAGVGLDNVDIKAATQAGVMVVNAPTSNIVSAAELTVGHILSLARHIPQASAALKDGEWKRSKYTGTELFEKKIGIIGLGRIGALVAARLKGFDTKILAYDPYITSARAAQLGVQLVTLDELLAQSDFITIHMPKTPETVGMLGEDAFKKMKRTAYVVNVARGGLVDEEALYAALESGEIAGAGVDVFVKEPSTDLPFFKLDNVVVTPHLGASTDEAQEKAGVSVAKSVRQALAGELVPDAVNVAGGVIAPDVRPGIPLIEKLGRIFTAMTHASLTQFDVEVAGEISSLDVKVLELAALKGIFADVVTEQVSYVNAPVIAEQRGINVRLITTPDTESYRNVLTLRGALSDGTQISVAGTLTGPKQVQKLVGINGFEVEIPISEHLVVVAYSDRPGVIGTIGHILGMNNINIAGMQVARQTEGGQVLALLTIDSSVPQQVLDAIKAGIGAEMVREVDLED
>NZ_CP040174.1|WP_146337250.1|2522392_2523418_+|ketol-acid-reductoisomerase
MTEMFYDDDADLSIIQGRTVAVIGYGSQGHAHALSLRDSGVDVRVGLKEDSKSRAKAEAEGLRVLNVADAVAEADLIMVLTPDQVQRHVYAEDIAPNLQSGDALFFGHGFNIRYGYIKPPADVDVALVAPKGPGHIVRREFEAGRGVPDLIAVEQNPSGKAKELALSYAKAIGGTRAGVIETTFTEETETDLFGEQAVLCGGASQLIMYGFETLTEAGYKPEVAYFEVLHELKLIVDLMVEGGIAKQRWSVSDTAEYGDYVSGPRVITPEVKENMKAVLKDIQDGTFAKRFIDDQDAGAPEFKALRKKGEDHPIEATGRELRKLFSWIKNEDDYTEGSVAR
>NZ_CP040174.1|WP_138768975.1|2521793_2522306_+|acetolactate-synthase-small-subunit
MTRHTLSVLVEDKPGVLTRVASLFARRAFNINSLAVGPTEVPGISRMTVVVDADGELIEQVTKQLNKLINVIKIVELTPESSVQRDHILVKVRADAATRLQVTQAADLFRASVVDVSTESVVIEATGHPDKLTALLSVLEPFGVREIVQSGTLAVGRGSRSMSDRALRSA
>NZ_CP040174.1|WP_146337249.1|2519892_2521791_+|acetolactate-synthase-large-subunit
MSKGSPISPSLMATKSAGAPKAPDRVERPADAGVEHAAASPVLGPNNVVPPTVMTGSQAIVRALEELGVEDIFGLPGGAILPTYDPLMASKMNHILVRHEQGAGHAAQGYAMVTGRVGVCIATSGPGATNLVTAIMDAHMDSVPMVAITGQVSSGVIGTDAFQEADIVGITMPITKHSFLVTDPNDIPHVMAEAFHLASTGRPGPVLVDVAKDAQQGQMTFSWPPKIDLPGYRPVLRGHSKQVREAARLIAAASKPVLYVGGGVVKAHASAELRELAELSGAPVVTTLMARGVFPDSHPQHVGMPGMHGTVSAVTALQQSDLLITLGARFDDRVTGILKSFAPNAKVIHADIDPAEISKNRTADVPIVGSVKEIIPELSEALRLQFETSGTPDLANWWAFLNNLKETYPLGWTEPEDGLSAPQRVIERIGALTGPEGVYVAGVGQHQMWASQFIKYERPHAWLNSGGAGTMGYAVPAAMGAKVGEPDRVVWAIDGDGCFQMTNQELATCAINKIPIKVAVINNSSLGMVRQWQTLFYEGRYSNTDLNTGHDTVRIPDFVKLADAYGCAAFRCERDEDIDATIQKALEINDRPVVIDFVVSPNSMVWPMVPAGVSNDQIQVARNMTPDWEEED
>NZ_CP040174.1|WP_146337248.1|2517769_2519491_+|dihydroxy-acid-dehydratase
MSEDTQTATATTPDIKPRSRVVTDGIHAAPARGMFRAVGMGDDDFAKPQIGVASSWNEITPCNLSLNRLAQGAKEGVHAGGGFPMQFGTISVSDGISMGHEGMHFSLVSREVIADSVETVMQAERIDGSVLLAGCDKSLPGMLMAAARLDLASVFLYAGSIMPGWVKLEDGSEKEVTLIDAFEAVGACAAGKMSMEDLTRIEKAICPGEGACGGMYTANTMACIGEALGMSLPGSAAPPSADRRRDDFARKSGEAVVNLLRKGITARDIMTKKAFENAIAVTMAFGGSTNAVLHLLAIAREAEVELTLDDFNRIGDRIPHLGDLKPFGRYVMTDVDKIGGVPVIMRALLDAGLLHGDCLTVTGKTVAENLAAINPPDLDGKILRAMDNPIHKTGGITILHGTMAPEGAVVKSAGFDADVFEGTARVFEREQGALDALDKGQIKAGDVVVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCIGHVAPEAVDGGPIAFVKDGDRIRVDIAARSFDLLVDEAELEARKVGWEPLPAKFTKGVLAKYAKLVHSASTGAYCG
>NZ_CP040174.1|WP_146337247.1|2516691_2517630_+|LysR-family-transcriptional-regulator
MDFKRLRILRELADRGTVGATADALRVTPSAVSQQLKTLQEELGVVLVEKSGRGVRLTEAGLAMAGAAADVATAMARAEATIDTYRLGWQTRIKAAFFPSAAEMFLPGLLHRVKEIEGLRFEAHFEDPGVAGFAALAADYDIVLAHSVDGPDVFARQGLQVIPLLDEPLDVAVPTGHALAGKATLSADDVIGFPWMGVPEGFPFDTVLRQIETQADSPALRAQLFPDLRVLEALVSAGHGLSLLPRYTALKNQGKGFVLRPLRGVKASRSIVALARPEAAARTTIREVLSMLKAEARAVAEAPELRDAAHSG
>NZ_CP040174.1|WP_146337246.1|2515620_2516586_-|hypothetical-protein
MDWIIWLIVIAVIVGVVWWQLNRNGSRSRTGTSTSTGAGSAAAPHAAPDRERHDGALSGGTAAASAAAAATTGMPSAAGFSNAEPEPPSTADDDADDTALASAPSAGAPTADAPAASAPAAAAPAQETGAESADWETQWSETAPAEAHPATHHDHAHTGHTAAGSRPGDMAAGDMAAGDMAAGVAGREQPAGHTPVHHPEYTEPHAPTLPGAESAAAEAADVAEAETMQAASSAAAAEGFASHTAAPAGHLAAEQPYGEGSAMPAPDGSGPDGFTVKGNASSMIYHDETSPSYEETRAEVWFLSAAHAEAAGFRPPRRSRT
>NZ_CP040174.1|WP_146337256.1|2531959_2532709_+|sortase
MASHRKTPRFRAAGNRGLLLSARDILVLAVCALGIVAAWLTYGAGVIPDAGAAAVGRDSGTSTPAPPHQQSGGPAAKAPVVLPAGAAAAGKSAAPAVPVLPAASVPLRISFPAAGMDVAVHPLEPGRDDTESRSIVPPETKDGYWLAPFGTPGAGSTNTTYIVGHSWLDQDAPFNHLSTQAAPGDVLTVTTATGVLRYRVDSVTTYSKATLKDSGVWEAVANRLVLISCYTEDPWGRNVVVVASPLKGS
>NZ_CP040174.1|WP_146337257.1|2532771_2533824_+|3-isopropylmalate-dehydrogenase
MSASTIDLAVIPGDGIGPEVTAEALKVLEKAAAAEGIVLQQTHYELGAAHWLATGETLPEHTLADLRTRDAILFGAVGAAPDDTRIPSGIIERELLLKLRFSLDHYVNLRPSKLYAGVGSPLANPGEVDFIVVREGTEGPYVGNGGTLRAGTPHEVATEVSLNTAHGVERVVRDAFRRANDRPRKKLTLVHKHNVLVFAGHLWKRTVEAVAPEFPEVSHDYLHVDAATIFMVTDPSRFDVIVTDNLFGDILTDLAAAVTGGIGLAASGNINMDRTAPSMFEPVHGSAPDIAGQQKADPSAAILSAALLLDHLGHAAAARKVEAAVAADVEARDGSFRSTAAIGDAIAAAL
>NZ_CP040174.1|WP_146337258.1|2533955_2535068_+|branched-chain-amino-acid-aminotransferase
MTQTAHGVEFTQRLSATPKSAQEREAILANPGFGDYFTDHTAIVDYSVDAEGKGGWHDARIEPYGPIMLDPSAAVLHYGQEIFEGLKAYRHADGSIWTFRPEANAARLNKSARRLALPELPEEYFLAAIRELVSVDRDWVPSGDGEALYLRPFMIATEAFLGVRAAREVSFRVIASPAGNYFGGELKPVSIWISREYARAGRGGTGAAKCGGNYAASLIAQQEAEAHGCKQVLFLDQFNDNAVEELGGMNVFFVMKDGSLVTPALSGTILEGVTRSSVIQVARDMGREVTERKITLDEWRDGVATGEIAEVFACGTAAVITPIGILKDATEFIGSEDATAGETTMAIREQLLGIQTGTVEDTHGWLTRLA
>NZ_CP040174.1|WP_146337259.1|2535586_2536402_+|MBL-fold-metallo-hydrolase
MKAPRWEDGRVIPDDARALVRSTELTRFRLAPNPGPMSLHGTNSYVVAAPGSPNVVVVDPGPLDEEHLRELTEYGAVELILITHRHADHTAAAARFSELTGAPVRAADPAHCHGAEPLREGEVLHAAGVEIRVLATPGHTSDSVCFHLPQDGAHGAVLTGDTILGLGTTVLDYPDGTLGDYLDSLDRLESLGPATVLPAHGPMLPALDSIVRAYRDHRQDRLAQIRAALAELGAEAGVQDVANAVYAAVDPAVRPAAELSVAAQLEYLRGR
>NZ_CP040174.1|WP_146337260.1|2536412_2537189_+|DUF2437-domain-containing-protein
MRIARFVVDSDPMYGIVEGQPGSEEITVINGDPFFHGVERTAVKHKLEDVRLLAPIIPRSKVIGVGRNFVEHAHELGNEVPAQPLLFLKPNTSVIGPNDPIILPEFSEEVSFEAELCVVIGRICKDVPEERVDDVVFGYTCGNDLTARDVQKTDLQWARAKGFDTSAPLGPWIETELDTEDLQIQGRLNGELRQDGSTSQMIRGVRELVSIVSQAFTLLPGDVIMTGTPAGVGLVQAGDRFEVEIEGIGRLSNPVVRR
>NZ_CP040174.1|WP_146337261.1|2537224_2538772_+|glutamate--tRNA-ligase
MTTPTAPDAVSSTATTELTREATREVTAETPVRVRFCPSPTGTPHVGLIRTALFNWAHAKHTKGTFVFRIEDTDAARDSEESYQQLLEALKWLGISWEEGVEVGGPHEPYRQSQRLDLYKDVVAKLLEAGYAYECYSSPEEVEARHRAAGRDPKLGYDNFDRELTDEQLAAFKAEGRKPVLRVRMPDEDVTFTDMVRGEITFKAGSIPDYVIVRADGSPLYTLVNPVDDALMGITHVLRGEDLLSSTPRQVVLIRALMDIGVASYLPVFGHLPYVMGEGNKKLSKRDPQSNLFLLRDRGFIPEGLLNYLSLLGWSLSADEDIFTVDQLIEHFDVNDVLANPARFDIKKAEAINGTHIRMLDAEDFRGRLVPYLQAAGLVGESFTAREEEILAEAAPLIQERISLLGEAPEMLAFLFKADDAIDVADDARKGLPENLTEVLDAALAALEPLADWTAETIQAALKEALVEGLGVKPRLAFGPVRTAVSGRRISPPLFESMVILGKDSSLARLRAFRG
>NZ_CP040174.1|WP_146337262.1|2538771_2539503_+|HAD-IA-family-hydrolase
MSGGAGSGVLAAGLDGIRGVLFDIDDTLVDLEFAMTTALRDVSEHLLPGLDEAGWERFGRIFTRETTHFYDRYLAGELSFNEQRLLRGRAALGHFGVELEEGEQAHHWVSSYASLQHSYVRAFDDVAPLLDALDAAGVPYGAVSNNVHDYQRVKLDAAGLRRIGILVGTDTVGVPKPDPAIYLEGVRRLGTGPGETLYVGDNRLLDAEGSTAAGLLGVWLNRGGEPAPGFAGREVSSLLDLLA
>NZ_CP040174.1|WP_146337263.1|2539584_2540973_-|hypothetical-protein
MSQSRAATAPTRTRAQQIAIAVLALLLIALLGFYTLVTGRITDGSAKLNDGAGQAAAGAQQLKDGAGKLATGAGQADAGAGKLSEGAEKIHAGIAGKLAPGADRLQEGASALATGAVKIETDVNNKLAPGVYKVDDGAQKLAAGAVQLSAALTPTAAGNAENNLADGATQLNAGAGQLEAGTGQLAAGTDQLKGYRGANNDPAAGTGTAALAQAMEQLYAAANDPIQGAVPLAVVKDKIAKILAGAQRLDAGASQLQAGAAKLNAGAGQLHAGTGKLTAGFATLAGKLNSRDPNSPGVVMGTALLAEGTAKIRVGMDGVPGDPEHPGLLKATAKMTDGSSRLADGTQALNTGIKGDPADPANPGLLNGSTALASGASKLSEGNTKLASGSSQLSTGAEKLADGNAKIAAGTGTLYSSAAAVSPSNMVKADAAVALGLVALLGLGAVGAFLALRNRRLAEKTA
>NZ_CP040174.1|WP_146338566.1|2541713_2543486_+|ABC-transporter
MESAGPAGQQSQAARQGAAVELLEAVRGELSAVSLPLALPGAEAARLDIRQALAQLDDYILPRYRSLDAPLLAVVGGSTGAGKSTLVNGLVGHAVTRAGAIRPTTRQPILLHHPGDAAWFEDQRVLPNLSRIRGTVVAAPLPANQAGPTPDGAAITSLVLAADPAVPAGIALLDAPDVDSISDDNRRLAGQLLAAADLWVFVTTANRYADAVPWRLLLDAASRDIMVAVVLDRVPQAAEEEVSADLRSMLGREGLGSARLFVIPEVALDAMGMLPAVAVAPLRNWLRELAADAAGRAAIARRTLNGTVKALGGRVGAVAEAVRAQHRAAELLGSDASNAYEEAVGRILDATKDGALLRGEVLARWQDFVGTGEFFRVMEQNIGRLRDRMGAFFRGEPTPAVRVETAIETGLQAVILDEAANAAEEADQRWRSDPAGRQLLGTDDLSGTSEGFSDAVAAEIRAWQGSLMELIRTEGQGKRSQARWLSFGINGLGAALMIVVFSMTAGLTGLEIGVAGGAAVVGQRVLEAVFGEDAVRRLAKTAREDLQARCRRLLRAESRRFLDRLDASGAVPPAALAEQAEALGKLAGTA
>NZ_CP040174.1|WP_146337264.1|2543482_2545099_+|ABC-transporter
MNRHGAAREASQLHRRLEALDEARQLAAGALPEETLDEVLEVLERASSRRSLSAEHTVVGFFGATGSGKSSLFNAVSGAEIATAAARRPTTSEPLAGIWGADGSEALLDWLEVRNRHHADAVPGFADETTGLILLDLPDFDSTRSENREIVQRMVGLVDVLVWVLDPQKYADAAVHNDFLTPLASHAAVMLVVLNQVDRLPDHEIRPVLESLKAILARDGLGKVQVLGASALVGTGVDKVRAAIRQVAMQRLALSQRLAADVDRAAERLTEASGAGEAAGVKAGTRDRLARELAVAANVPLVVDAVARSYRQEATRRTGWPVTRWLVRFRPDPLRRLNLRREGERPELNRTSLPPAGAPERARTDAAVRQFADAASDGAPGPWRAVIRGAAREGRERLPDALDQAIAGTDLKAGRGSWWWTAFNVVQWLGLLTALGGLGWLGVLAALAYFQLPVPEVPRVQGWPVPTVLVAGGVLLGIVLAVAARFIAGAAARARAAAAGRRLRGSVAAVAEDLVVDPVELEVSRLRSFNAALKSAAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP040174_1	1.3\|2531277\|18\|NZ_CP040174\|CRT	2531277-2531294	18	NZ_CP040174.1	1204681-1204698	2	0.889
NZ_CP040174_1	1.3\|2531277\|18\|NZ_CP040174\|CRT	2531277-2531294	18	NZ_CP040174.1	1486440-1486457	2	0.889
NZ_CP040174_1	1.3\|2531277\|18\|NZ_CP040174\|CRT	2531277-2531294	18	NZ_CP040174.1	1580415-1580432	2	0.889
NZ_CP040174_1	1.3\|2531277\|18\|NZ_CP040174\|CRT	2531277-2531294	18	NZ_CP040174.1	3085195-3085212	2	0.889
NZ_CP040174_1	1.3\|2531277\|18\|NZ_CP040174\|CRT	2531277-2531294	18	NZ_CP040174.1	848298-848315	2	0.889
NZ_CP040174_1	1.3\|2531277\|18\|NZ_CP040174\|CRT	2531277-2531294	18	NZ_CP040174.1	1048953-1048970	2	0.889
NZ_CP040174_1	1.3\|2531277\|18\|NZ_CP040174\|CRT	2531277-2531294	18	NZ_CP040174.1	1120641-1120658	2	0.889
NZ_CP040174_1	1.3\|2531277\|18\|NZ_CP040174\|CRT	2531277-2531294	18	NZ_CP040174.1	2850223-2850240	2	0.889
NZ_CP040174_1	1.3\|2531277\|18\|NZ_CP040174\|CRT	2531277-2531294	18	NZ_CP040174.1	3017799-3017816	2	0.889
NZ_CP040174_1	1.3\|2531277\|18\|NZ_CP040174\|CRT	2531277-2531294	18	NZ_CP040174.1	3185527-3185544	2	0.889
NZ_CP040174_1	1.3\|2531277\|18\|NZ_CP040174\|CRT	2531277-2531294	18	NZ_CP040174.1	3466337-3466354	2	0.889
NZ_CP040174_1	1.3\|2531277\|18\|NZ_CP040174\|CRT	2531277-2531294	18	NZ_CP040174.1	3468348-3468365	2	0.889

1. spacer 1.3|2531277|18|NZ_CP040174|CRT matches to position: 1204681-1204698, mismatch: 2, identity: 0.889

cggcggcgaccagggtgg	CRISPR spacer
cggcggcgatcagcgtgg	Protospacer
*********.*** ****

2. spacer 1.3|2531277|18|NZ_CP040174|CRT matches to position: 1486440-1486457, mismatch: 2, identity: 0.889

cggcggcgaccagggtgg	CRISPR spacer
cggcggcgaccaaggcgg	Protospacer
************.**.**

3. spacer 1.3|2531277|18|NZ_CP040174|CRT matches to position: 1580415-1580432, mismatch: 2, identity: 0.889

cggcggcgaccagggtgg	CRISPR spacer
cggcgtcgatcagggtgg	Protospacer
***** ***.********

4. spacer 1.3|2531277|18|NZ_CP040174|CRT matches to position: 3085195-3085212, mismatch: 2, identity: 0.889

cggcggcgaccagggtgg	CRISPR spacer
cggcggcggccagggcgg	Protospacer
********.******.**

5. spacer 1.3|2531277|18|NZ_CP040174|CRT matches to position: 848298-848315, mismatch: 2, identity: 0.889

cggcggcgaccagggtgg	CRISPR spacer
cggcggcggccaggatgg	Protospacer
********.*****.***

6. spacer 1.3|2531277|18|NZ_CP040174|CRT matches to position: 1048953-1048970, mismatch: 2, identity: 0.889

cggcggcgaccagggtgg	CRISPR spacer
cggcggcgaccgaggtgg	Protospacer
***********..*****

7. spacer 1.3|2531277|18|NZ_CP040174|CRT matches to position: 1120641-1120658, mismatch: 2, identity: 0.889

cggcggcgaccagggtgg	CRISPR spacer
cggcggcgagcagggagg	Protospacer
********* ***** **

8. spacer 1.3|2531277|18|NZ_CP040174|CRT matches to position: 2850223-2850240, mismatch: 2, identity: 0.889

cggcggcgaccagggtgg	CRISPR spacer
cgccggccaccagggtgg	Protospacer
** **** **********

9. spacer 1.3|2531277|18|NZ_CP040174|CRT matches to position: 3017799-3017816, mismatch: 2, identity: 0.889

cggcggcgaccagggtgg	CRISPR spacer
cggcggcgtccaggctgg	Protospacer
******** ***** ***

10. spacer 1.3|2531277|18|NZ_CP040174|CRT matches to position: 3185527-3185544, mismatch: 2, identity: 0.889

cggcggcgaccagggtgg	CRISPR spacer
cggcggcgcgcagggtgg	Protospacer
********  ********

11. spacer 1.3|2531277|18|NZ_CP040174|CRT matches to position: 3466337-3466354, mismatch: 2, identity: 0.889

cggcggcgaccagggtgg	CRISPR spacer
cgtcggcgaccaggatgg	Protospacer
** ***********.***

12. spacer 1.3|2531277|18|NZ_CP040174|CRT matches to position: 3468348-3468365, mismatch: 2, identity: 0.889

cggcggcgaccagggtgg	CRISPR spacer
cggtggcgaccagggagg	Protospacer
***.*********** **

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	309984-310013	4	0.867
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1743530-1743559	4	0.867
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	815181-815210	4	0.867
NZ_CP040174_1	1.6\|2531409\|30\|NZ_CP040174\|CRT	2531409-2531438	30	NC_042342	Pseudomonas virus H66, complete genome	43104-43133	4	0.867
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	915301-915330	5	0.833
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1422715-1422744	5	0.833
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_023283	Streptomyces sp. FR1 plasmid pFRL3, complete sequence	135379-135408	5	0.833
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	172007-172036	5	0.833
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP024583	Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence	153248-153277	5	0.833
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	490296-490325	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1712115-1712144	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1731526-1731555	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	350497-350526	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP049142	Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence	316034-316063	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	LR606151	Rhizobium sp. Q54 genome assembly, plasmid: 8	27822-27851	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_021209	Sinorhizobium sp. M14 plasmid pSinA, complete sequence	35658-35687	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	84995-85024	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP028965	Burkholderia sp. IDO3 plasmid p1, complete sequence	385460-385489	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	68296-68325	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	727310-727339	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP013369	Burkholderia ubonensis strain RF23-BP41 plasmid pRF23, complete sequence	46147-46176	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	125501-125530	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP039909	Agrobacterium tumefaciens strain CFBP6624 plasmid pAtCFBP6624, complete sequence	418678-418707	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	317718-317747	6	0.8
NZ_CP040174_1	1.4\|2531313\|30\|NZ_CP040174\|CRT	2531313-2531342	30	NC_029017	Pseudomonas phage KPP21 DNA, complete genome	53205-53234	6	0.8
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1512528-1512557	6	0.8
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	300734-300763	6	0.8
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	MN694488	Marine virus AFVG_250M70, complete genome	69-98	6	0.8
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	MN694488	Marine virus AFVG_250M70, complete genome	45366-45395	6	0.8
NZ_CP040174_1	1.6\|2531409\|30\|NZ_CP040174\|CRT	2531409-2531438	30	NC_004933	Streptomyces lividans 1326 plasmid SLP2, complete sequence	24543-24572	6	0.8
NZ_CP040174_1	1.6\|2531409\|30\|NZ_CP040174\|CRT	2531409-2531438	30	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	502178-502207	6	0.8
NZ_CP040174_1	1.6\|2531409\|30\|NZ_CP040174\|CRT	2531409-2531438	30	NZ_CP023738	Methylosinus trichosporium OB3b plasmid pOB3b1, complete sequence	34746-34775	6	0.8
NZ_CP040174_1	1.8\|2531505\|30\|NZ_CP040174\|CRT	2531505-2531534	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4392265-4392294	6	0.8
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP054618	Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence	421530-421559	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	385940-385969	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP015733	Arthrobacter sp. U41 plasmid unnamed1, complete sequence	27378-27407	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP015733	Arthrobacter sp. U41 plasmid unnamed1, complete sequence	3295-3324	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP015733	Arthrobacter sp. U41 plasmid unnamed1, complete sequence	90235-90264	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	343245-343274	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_010604	Mycobacterium marinum M plasmid pMM23, complete sequence	4692-4721	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP024895	Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence	158811-158840	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP026745	Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence	17835-17864	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP010860	Marinovum algicola DG 898 plasmid pMaD5, complete sequence	122426-122455	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP044072	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence	71320-71349	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_047992	Microbacterium phage Zeta1847, complete genome	10818-10847	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP034180	Mycobacteroides abscessus strain GZ002 plasmid pMabS_GZ002, complete sequence	11772-11801	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	144212-144241	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP042827	Ruania sp. HY168 plasmid unnamed, complete sequence	6935-6964	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_010394	Mycobacterium abscessus plasmid, complete sequence	13519-13548	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP041606	Streptomyces sp. S1D4-14 plasmid pS1D4-14.2, complete sequence	16144-16173	7	0.767
NZ_CP040174_1	1.4\|2531313\|30\|NZ_CP040174\|CRT	2531313-2531342	30	NZ_AP022338	Mameliella alba strain KU6B plasmid pKUB257, complete sequence	199159-199188	7	0.767
NZ_CP040174_1	1.4\|2531313\|30\|NZ_CP040174\|CRT	2531313-2531342	30	NZ_CP054608	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed9, complete sequence	14833-14862	7	0.767
NZ_CP040174_1	1.4\|2531313\|30\|NZ_CP040174\|CRT	2531313-2531342	30	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	279607-279636	7	0.767
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NC_014718	Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence	737093-737122	7	0.767
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NC_011961	Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence	487256-487285	7	0.767
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	484293-484322	7	0.767
NZ_CP040174_1	1.6\|2531409\|30\|NZ_CP040174\|CRT	2531409-2531438	30	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	1194020-1194049	7	0.767
NZ_CP040174_1	1.6\|2531409\|30\|NZ_CP040174\|CRT	2531409-2531438	30	NZ_CP054608	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed9, complete sequence	14845-14874	7	0.767
NZ_CP040174_1	1.6\|2531409\|30\|NZ_CP040174\|CRT	2531409-2531438	30	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	682933-682962	7	0.767
NZ_CP040174_1	1.7\|2531457\|30\|NZ_CP040174\|CRT	2531457-2531486	30	NZ_CP021084	Deinococcus ficus strain CC-FR2-10 plasmid pDFI3, complete sequence	252896-252925	7	0.767
NZ_CP040174_1	1.7\|2531457\|30\|NZ_CP040174\|CRT	2531457-2531486	30	NZ_CP054608	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed9, complete sequence	14845-14874	7	0.767
NZ_CP040174_1	1.7\|2531457\|30\|NZ_CP040174\|CRT	2531457-2531486	30	NZ_CP027299	Streptomyces sp. SGAir0924 plasmid unnamed_5	366101-366130	7	0.767
NZ_CP040174_1	1.7\|2531457\|30\|NZ_CP040174\|CRT	2531457-2531486	30	NC_017805	Deinococcus gobiensis I-0 plasmid P1, complete sequence	268673-268702	7	0.767
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	629214-629243	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	879304-879333	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_016972	Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG2, complete sequence	44677-44706	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP010611	Phaeobacter inhibens strain P92 plasmid pP92_a, complete sequence	105256-105285	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP010716	Phaeobacter piscinae strain P18 plasmid pP18_a, complete sequence	105256-105285	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP010662	Phaeobacter inhibens strain P74 plasmid pP74_a, complete sequence	105256-105285	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1085466-1085495	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP010737	Phaeobacter inhibens strain P72 plasmid pP72_b, complete sequence	143550-143579	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	909579-909608	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	353921-353950	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_018023	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.02, complete sequence	62884-62913	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP017300	Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence	375059-375088	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_022125	Rhodococcus erythropolis CCM2595 plasmid pRECF1, complete sequence	46910-46939	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NC_019018	Mycobacterium marinum DL240490 plasmid pMUM003, complete sequence	81062-81091	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP045095	Streptomyces sp. GY16 plasmid unnamed1, complete sequence	18182-18211	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP011297	Rhodococcus erythropolis strain BG43 plasmid pRLLBG43, complete sequence	127611-127640	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	344286-344315	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP044550	Hydrogenophaga sp. BPS33 plasmid pBPS33-1, complete sequence	137044-137073	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP014519	Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence	71936-71965	8	0.733
NZ_CP040174_1	1.4\|2531313\|30\|NZ_CP040174\|CRT	2531313-2531342	30	MT230534	Pantoea phage vB_PagM_SSEM1, complete genome	52512-52541	8	0.733
NZ_CP040174_1	1.4\|2531313\|30\|NZ_CP040174\|CRT	2531313-2531342	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2927982-2928011	8	0.733
NZ_CP040174_1	1.4\|2531313\|30\|NZ_CP040174\|CRT	2531313-2531342	30	NZ_CP039640	Azospirillum sp. TSH100 plasmid p1, complete sequence	175450-175479	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	639125-639154	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	455835-455864	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	444880-444909	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	142930-142959	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	450840-450869	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	442425-442454	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	102939-102968	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1109432-1109461	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	798276-798305	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	702684-702713	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1231218-1231247	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	463131-463160	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	292500-292529	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1276361-1276390	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_LR134461	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence	54943-54972	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	150129-150158	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1247889-1247918	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1343909-1343938	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	848986-849015	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	435696-435725	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	964173-964202	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	588157-588186	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1407653-1407682	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	616065-616094	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1180654-1180683	8	0.733
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1276368-1276397	8	0.733
NZ_CP040174_1	1.6\|2531409\|30\|NZ_CP040174\|CRT	2531409-2531438	30	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	162084-162113	8	0.733
NZ_CP040174_1	1.6\|2531409\|30\|NZ_CP040174\|CRT	2531409-2531438	30	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	156085-156114	8	0.733
NZ_CP040174_1	1.7\|2531457\|30\|NZ_CP040174\|CRT	2531457-2531486	30	AM419438	Archaeal BJ1 virus complete genome	2611-2640	8	0.733
NZ_CP040174_1	1.7\|2531457\|30\|NZ_CP040174\|CRT	2531457-2531486	30	NC_008695	Archaeal BJ1 virus, complete genome	2611-2640	8	0.733
NZ_CP040174_1	1.8\|2531505\|30\|NZ_CP040174\|CRT	2531505-2531534	30	KJ019089	Synechococcus phage ACG-2014j isolate Syn7803US23, complete genome	6735-6764	8	0.733
NZ_CP040174_1	1.8\|2531505\|30\|NZ_CP040174\|CRT	2531505-2531534	30	NC_022590	Brevibacterium sp. Ap13 plasmid pAP13, complete sequence	14891-14920	8	0.733
NZ_CP040174_1	1.8\|2531505\|30\|NZ_CP040174\|CRT	2531505-2531534	30	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	108055-108084	8	0.733
NZ_CP040174_1	1.8\|2531505\|30\|NZ_CP040174\|CRT	2531505-2531534	30	NZ_CP017303	Rhodococcus sp. YL-1 plasmid pYLL1 sequence	201952-201981	8	0.733
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	465394-465423	9	0.7
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP013072	Sphingobium indicum B90A plasmid pSRL2, complete sequence	22954-22983	9	0.7
NZ_CP040174_1	1.2\|2531229\|30\|NZ_CP040174\|CRT	2531229-2531258	30	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	132906-132935	9	0.7
NZ_CP040174_1	1.4\|2531313\|30\|NZ_CP040174\|CRT	2531313-2531342	30	NC_008760	Polaromonas naphthalenivorans CJ2 plasmid pPNAP04, complete sequence	96460-96489	9	0.7
NZ_CP040174_1	1.4\|2531313\|30\|NZ_CP040174\|CRT	2531313-2531342	30	KP027201	Mycobacterium phage Sbash, complete genome	21263-21292	9	0.7
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NC_011961	Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence	352365-352394	9	0.7
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	MH067970	Arthrobacter sp. strain ANT_H40 plasmid pA40H1, complete sequence	36886-36915	9	0.7
NZ_CP040174_1	1.5\|2531361\|30\|NZ_CP040174\|CRT	2531361-2531390	30	NZ_CP048428	Rhizobium daejeonense strain KACC 13094 plasmid unnamed4, complete sequence	86956-86985	9	0.7
NZ_CP040174_1	1.8\|2531505\|30\|NZ_CP040174\|CRT	2531505-2531534	30	MF403007	Agrobacterium phage Atu_ph04, complete genome	105276-105305	10	0.667

1. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.867

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgaccagggcggcgaccagggccg	Protospacer
******************.******..* *

2. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.867

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgaccagggcggcgaccagggccg	Protospacer
******************.******..* *

3. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 4, identity: 0.867

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgaccagggcggcgaccagggccg	Protospacer
******************.******..* *

4. spacer 1.6|2531409|30|NZ_CP040174|CRT matches to NC_042342 (Pseudomonas virus H66, complete genome) position: , mismatch: 4, identity: 0.867

gggtggtgaccagaacggcgaccagggcgg	CRISPR spacer
gggtggtgaccaggacggcggccaggcctg	Protospacer
*************.******.***** * *

5. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.833

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcggccagggcggtgaccgccacgc	Protospacer
********.**************.  ***

6. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 5, identity: 0.833

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcggccagggcggtgaccgccacgc	Protospacer
********.**************.  ***

7. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_023283 (Streptomyces sp. FR1 plasmid pFRL3, complete sequence) position: , mismatch: 5, identity: 0.833

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggccaccagggcggcgaccagcgcga	Protospacer
******* **********.****** .**.

8. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 5, identity: 0.833

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggccaccagggcggcgaccagcgcga	Protospacer
******* **********.****** .**.

9. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP024583 (Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgacgagggcggcgaccagggcgc	Protospacer
********** *******.******..**

10. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

-cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cccacagc-accagggcggtgaacagaacga	Protospacer
 * .*.** ************* *******.

11. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcggccagggcggtcaccgccacgc	Protospacer
********.********** ***.  ***

12. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cagcggcggccagggcggtgaccgccacgc	Protospacer
*.******.**************.  ***

13. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgaccagggcggtgatccggcggt	Protospacer
*********************.* *.  *

14. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP049142 (Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
aggcggcgaacagggcgttgaccagggccg	Protospacer
 ******** ******* *******..* *

15. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to LR606151 (Rhizobium sp. Q54 genome assembly, plasmid: 8) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cgtcggcgaccaggtcggtgaccgtcacgc	Protospacer
** *********** ********.  ***

16. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_021209 (Sinorhizobium sp. M14 plasmid pSinA, complete sequence) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cgtcggcgaccaggtcggtgaccgtcacgc	Protospacer
** *********** ********.  ***

17. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggccaccagggcggcgacctccccgg	Protospacer
******* **********.****    ***

18. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP028965 (Burkholderia sp. IDO3 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
ccgcggcgacgaaggcggtgaccagccagg	Protospacer
* ******** *.************   **

19. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcggccagggcggtcaccgccacgc	Protospacer
********.********** ***.  ***

20. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcggccagcgcggtgacccagtcgg	Protospacer
********.**** ********* .. ***

21. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP013369 (Burkholderia ubonensis strain RF23-BP41 plasmid pRF23, complete sequence) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
ccgcggcgacgaaggcggtgaccagccagg	Protospacer
* ******** *.************   **

22. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgaccagcgcgttgacctcgccgg	Protospacer
************* *** *****  . ***

23. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP039909 (Agrobacterium tumefaciens strain CFBP6624 plasmid pAtCFBP6624, complete sequence) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cgtcggcgaccaggtcggtgaccgtcacgc	Protospacer
** *********** ********.  ***

24. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 6, identity: 0.8

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcggccagggcggtcaccgccacgc	Protospacer
********.********** ***.  ***

25. spacer 1.4|2531313|30|NZ_CP040174|CRT matches to NC_029017 (Pseudomonas phage KPP21 DNA, complete genome) position: , mismatch: 6, identity: 0.8

gaacggcgaccagggtggcggcactggtgg	CRISPR spacer
cgacggcgaccacggtgtcggcactggttt	Protospacer
 .********** **** **********

26. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 6, identity: 0.8

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aggtggtgaccagggtggtgacgagcccgg	Protospacer
 *****************.*** *.  ***

27. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 6, identity: 0.8

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aggtggtgaccagggtggtgacgagcccgg	Protospacer
 *****************.*** *.  ***

28. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to MN694488 (Marine virus AFVG_250M70, complete genome) position: , mismatch: 6, identity: 0.8

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aggtggtgaccagggtgatgaccatcgccg	Protospacer
 ****************..*****  ** *

29. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to MN694488 (Marine virus AFVG_250M70, complete genome) position: , mismatch: 6, identity: 0.8

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aggtggtgaccagggtgatgaccatcgccg	Protospacer
 ****************..*****  ** *

30. spacer 1.6|2531409|30|NZ_CP040174|CRT matches to NC_004933 (Streptomyces lividans 1326 plasmid SLP2, complete sequence) position: , mismatch: 6, identity: 0.8

gggtggtgaccagaacggcgaccagggcgg	CRISPR spacer
ggacgacgaccaggacgacgaccagggcgg	Protospacer
**..*..******.***.************

31. spacer 1.6|2531409|30|NZ_CP040174|CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gggtggtgaccagaacggcgaccagggcgg	CRISPR spacer
tggccgcgaccagaacggcgacaaggccgg	Protospacer
 **. *.*************** *** ***

32. spacer 1.6|2531409|30|NZ_CP040174|CRT matches to NZ_CP023738 (Methylosinus trichosporium OB3b plasmid pOB3b1, complete sequence) position: , mismatch: 6, identity: 0.8

gggtggtgaccagaacggcgaccagggcgg	CRISPR spacer
gcgtcgtgaccagcacggcgaccagagtga	Protospacer
* ** ******** ***********.*.*.

33. spacer 1.8|2531505|30|NZ_CP040174|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.8

gggcggtgaccacaacggcgaccacggcgg	CRISPR spacer
gtgcggtgaccatcacggcgaccaccctgg	Protospacer
* **********. ***********  .**

34. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP054618 (Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgaccagggcggcgaccgcatgct	Protospacer
******************.****. *

35. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgaccatggcggtgatctcgtcga	Protospacer
************ ********.*  . **.

36. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP015733 (Arthrobacter sp. U41 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggccaccagggcggtggccatgtgag	Protospacer
******* ************.*** .  .*

37. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP015733 (Arthrobacter sp. U41 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggccaccagggcggtggccatgtgag	Protospacer
******* ************.*** .  .*

38. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP015733 (Arthrobacter sp. U41 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggccaccagggcggtggccatgtgag	Protospacer
******* ************.*** .  .*

39. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
tggcggcgaccagggcggtaagcagggcaa	Protospacer
.******************.* ***..*..

40. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_010604 (Mycobacterium marinum M plasmid pMM23, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
gggcggggaccagggcggtggccaccgccg	Protospacer
 ***** *************.***  .* *

41. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP024895 (Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggccgcgaccagggcggcgaccgcgccga	Protospacer
**** *************.****. . **.

42. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP026745 (Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcgtcgaccaggccggtgaccgcgcccg	Protospacer
***** ******** ********. . * *

43. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP010860 (Marinovum algicola DG 898 plasmid pMaD5, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgaccatggcggcgaccttgtcga	Protospacer
************ *****.****  . **.

44. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP044072 (Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggccaccagggcggtgatggaatagg	Protospacer
******* *************. ..*  **

45. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_047992 (Microbacterium phage Zeta1847, complete genome) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
ccgcgccgacgagggcggtgaccagttgcg	Protospacer
* *** **** **************    *

46. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP034180 (Mycobacteroides abscessus strain GZ002 plasmid pMabS_GZ002, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
gggcggggaccagggcggtggccaccgccg	Protospacer
 ***** *************.***  .* *

47. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgaccatggcggtgatctcgtcga	Protospacer
************ ********.*  . **.

48. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP042827 (Ruania sp. HY168 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggccgcgaccaaggcggtgacccacccga	Protospacer
**** *******.********** .  **.

49. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_010394 (Mycobacterium abscessus plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
gggcggggaccagggcggtggccaccgccg	Protospacer
 ***** *************.***  .* *

50. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP041606 (Streptomyces sp. S1D4-14 plasmid pS1D4-14.2, complete sequence) position: , mismatch: 7, identity: 0.767

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
caccggcgacaagggcggtgaccaatgcga	Protospacer
*. ******* *************. .**.

51. spacer 1.4|2531313|30|NZ_CP040174|CRT matches to NZ_AP022338 (Mameliella alba strain KU6B plasmid pKUB257, complete sequence) position: , mismatch: 7, identity: 0.767

gaacggcgaccagggtggcggcactggtgg	CRISPR spacer
gcacggcgaccaggaaggcggcacttgcat	Protospacer
* ************. ********* *..

52. spacer 1.4|2531313|30|NZ_CP040174|CRT matches to NZ_CP054608 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed9, complete sequence) position: , mismatch: 7, identity: 0.767

gaacggcgaccagggtggcggcactggtgg	CRISPR spacer
gaacggcgacgagggcggcggcatggacga	Protospacer
********** ****.*******. *..*.

53. spacer 1.4|2531313|30|NZ_CP040174|CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gaacggcgaccagggtggcggcactggtgg	CRISPR spacer
tggcgttgaccaggatggcggcgctggtgg	Protospacer
 ..** .*******.*******.*******

54. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NC_014718 (Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence) position: , mismatch: 7, identity: 0.767

tggtggtgaccagggtggcga----ccaaggcgg	CRISPR spacer
tggtgatgaccagggtggcgaatcttcagg----	Protospacer
*****.***************    .**.*

55. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NC_011961 (Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aggtggtgagcagggcggcgaccaggcctt	Protospacer
 ******** *****.********.* *

56. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.767

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
tgctggtgaccagcgtggcgaccggcacga	Protospacer
** ********** *********.. .**.

57. spacer 1.6|2531409|30|NZ_CP040174|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

gggtggtgaccagaacggcgaccagggcgg	CRISPR spacer
cgtcgtcgaccagcacggcgagcagggcgg	Protospacer
 * .* .****** ******* ********

58. spacer 1.6|2531409|30|NZ_CP040174|CRT matches to NZ_CP054608 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed9, complete sequence) position: , mismatch: 7, identity: 0.767

gggtggtgaccagaacggcgaccagggcgg	CRISPR spacer
ggcccccgacctgaacggcgacgagggcgg	Protospacer
** .  .**** ********** *******

59. spacer 1.6|2531409|30|NZ_CP040174|CRT matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 7, identity: 0.767

gggtggtgaccagaacggcgaccagggcgg	CRISPR spacer
gccggaagaccataacggcgacaagggcgg	Protospacer
*   *. ***** ********* *******

60. spacer 1.7|2531457|30|NZ_CP040174|CRT matches to NZ_CP021084 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI3, complete sequence) position: , mismatch: 7, identity: 0.767

gggtggtgacccgaacggcgaccagggcgg	CRISPR spacer
gaggtccgactcgaacggcgtccagggcgg	Protospacer
*.*   .***.********* *********

61. spacer 1.7|2531457|30|NZ_CP040174|CRT matches to NZ_CP054608 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed9, complete sequence) position: , mismatch: 7, identity: 0.767

gggtggtgacccgaacggcgaccagggcgg	CRISPR spacer
ggcccccgacctgaacggcgacgagggcgg	Protospacer
** .  .****.********** *******

62. spacer 1.7|2531457|30|NZ_CP040174|CRT matches to NZ_CP027299 (Streptomyces sp. SGAir0924 plasmid unnamed_5) position: , mismatch: 7, identity: 0.767

gggtggtgacccgaacggcgaccagggcgg	CRISPR spacer
cgggcccgacccgcacgtcgaccagggcgg	Protospacer
 **   .****** *** ************

63. spacer 1.7|2531457|30|NZ_CP040174|CRT matches to NC_017805 (Deinococcus gobiensis I-0 plasmid P1, complete sequence) position: , mismatch: 7, identity: 0.767

gggtggtgacccgaacggcgaccagggcgg	CRISPR spacer
ccttgtcgacccgcacggcgtccagggcgg	Protospacer
   ** .****** ****** *********

64. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cccataggaccagggcggtgaacagaacga	Protospacer
*    . ************** *******.

65. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
gggcggcgaccaggccgttgaccacgccct	Protospacer
 ************* ** ****** . *

66. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_016972 (Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG2, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgaccagggcgccgacctgccaca	Protospacer
***************** .**** *    .

67. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP010611 (Phaeobacter inhibens strain P92 plasmid pP92_a, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
gcgcgccgaccagggcggtgaccaccccca	Protospacer
  *** ******************   * .

68. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP010716 (Phaeobacter piscinae strain P18 plasmid pP18_a, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
gcgcgccgaccagggcggtgaccaccccca	Protospacer
  *** ******************   * .

69. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP010662 (Phaeobacter inhibens strain P74 plasmid pP74_a, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
gcgcgccgaccagggcggtgaccaccccca	Protospacer
  *** ******************   * .

70. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
acgcggcgaccaaggcggtgaccaacgagc	Protospacer
  **********.***********. . *

71. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP010737 (Phaeobacter inhibens strain P72 plasmid pP72_b, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
gcgcgccgaccagggcggtgaccactccca	Protospacer
  *** ******************   * .

72. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgaccagggcggcgacggcggcct	Protospacer
******************.*** . ..*

73. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
tggcggcgaccatggcggtgatcacgattc	Protospacer
.*********** ********.** .*.

74. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_018023 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.02, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
gtatcgcctccagcgcggtgaccagaacgg	Protospacer
  .. **  **** ****************

75. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP017300 (Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
aggcgtcgaccagggcggtgacgtcgatga	Protospacer
 **** ****************   .*.*.

76. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_022125 (Rhodococcus erythropolis CCM2595 plasmid pRECF1, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
aggcgtcgaccagggcggtgacgtcgatga	Protospacer
 **** ****************   .*.*.

77. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NC_019018 (Mycobacterium marinum DL240490 plasmid pMUM003, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
gcgcggcgagcatggcggtgaccagttgtg	Protospacer
  ******* ** ************    *

78. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP045095 (Streptomyces sp. GY16 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgaccagggcgccgacctgccaca	Protospacer
***************** .**** *    .

79. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP011297 (Rhodococcus erythropolis strain BG43 plasmid pRLLBG43, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
aggcgtcgaccagggcggtgacgtcgatga	Protospacer
 **** ****************   .*.*.

80. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcggccagggcggtgatgcgggtgc	Protospacer
********.************.  *...*

81. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP044550 (Hydrogenophaga sp. BPS33 plasmid pBPS33-1, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
aggcggcgaccaagccggtgaccaagatcc	Protospacer
 ***********.* *********..*.

82. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP014519 (Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence) position: , mismatch: 8, identity: 0.733

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cagcggcgaccatgggggtgaccaggcgca	Protospacer
*.********** ** *********.   .

83. spacer 1.4|2531313|30|NZ_CP040174|CRT matches to MT230534 (Pantoea phage vB_PagM_SSEM1, complete genome) position: , mismatch: 8, identity: 0.733

gaacggcgaccagggtggcggcactggtgg	CRISPR spacer
tgttaacaaccaaggtggcggcactggtgg	Protospacer
 . ...*.****.*****************

84. spacer 1.4|2531313|30|NZ_CP040174|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.733

gaacggcgaccagggtggcggcactggtgg	CRISPR spacer
tcacggcgaccagggcggcggcacccaccg	Protospacer
  *************.********. .. *

85. spacer 1.4|2531313|30|NZ_CP040174|CRT matches to NZ_CP039640 (Azospirillum sp. TSH100 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

gaacggcgaccagggtggcggcactggtgg	CRISPR spacer
caacggcaaccagggcggcggcaccgacca	Protospacer
 ******.*******.********.*.. .

86. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
cggtggtgaccaggatggcgacgatcttcg	Protospacer
.*************.******* *   . *

87. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

88. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

89. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
cggtggtgaccaggatggcgacgatcttcg	Protospacer
.*************.******* *   . *

90. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

91. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

92. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
cgtcctcgaccagggtggcgacgaaggcag	Protospacer
.* .  .*************** *****.*

93. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

94. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

95. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

96. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

97. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

98. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
cggtggtgaccaggatggcgacgatcttcg	Protospacer
.*************.******* *   . *

99. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

100. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_LR134461 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
cggtgttgaccagggcggcgaccagaagcg	Protospacer
.**** *********.********...  *

101. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
cggtggtgaccaggatggcgacgatcttcg	Protospacer
.*************.******* *   . *

102. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

103. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

104. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

105. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
cggtggtgaccaggatggcgacgatcttcg	Protospacer
.*************.******* *   . *

106. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

107. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
cggtggtgaccaggatggcgacgatcttcg	Protospacer
.*************.******* *   . *

108. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

109. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
gaaagccgaacagggtggcgaccacggcgg	Protospacer
 .. * .** ************** *****

110. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

111. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.733

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
aatcgctgaccagggtggcgcccagggcgt	Protospacer
 . .* ************** ***.****

112. spacer 1.6|2531409|30|NZ_CP040174|CRT matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 8, identity: 0.733

gggtggtgaccagaacggcgaccagggcgg	CRISPR spacer
cggtggtgaccagagcgccgaccagacgct	Protospacer
 *************.** *******.

113. spacer 1.6|2531409|30|NZ_CP040174|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 8, identity: 0.733

gggtggtgaccagaacggcgaccagggcgg	CRISPR spacer
tccaggtgaccaggaaggcgaccagggtga	Protospacer
    *********.* ***********.*.

114. spacer 1.7|2531457|30|NZ_CP040174|CRT matches to AM419438 (Archaeal BJ1 virus complete genome) position: , mismatch: 8, identity: 0.733

gggtggtgacccgaacggcgaccagggcgg	CRISPR spacer
cgtgaaggacgcgcacggcgaccagggcgg	Protospacer
 *  .. *** ** ****************

115. spacer 1.7|2531457|30|NZ_CP040174|CRT matches to NC_008695 (Archaeal BJ1 virus, complete genome) position: , mismatch: 8, identity: 0.733

gggtggtgacccgaacggcgaccagggcgg	CRISPR spacer
cgtgaaggacgcgcacggcgaccagggcgg	Protospacer
 *  .. *** ** ****************

116. spacer 1.8|2531505|30|NZ_CP040174|CRT matches to KJ019089 (Synechococcus phage ACG-2014j isolate Syn7803US23, complete genome) position: , mismatch: 8, identity: 0.733

gggcggtgaccacaacggcgaccacggcgg	CRISPR spacer
ctaccaagaccacgacggcgaccacggcga	Protospacer
  .* . ******.***************.

117. spacer 1.8|2531505|30|NZ_CP040174|CRT matches to NC_022590 (Brevibacterium sp. Ap13 plasmid pAP13, complete sequence) position: , mismatch: 8, identity: 0.733

gggcggtgaccacaacggcgaccacggcgg	CRISPR spacer
ccgcggtgaccgcgacggcgaccacgagcc	Protospacer
  *********.*.************.

118. spacer 1.8|2531505|30|NZ_CP040174|CRT matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 8, identity: 0.733

gggcggtgaccacaacggcgaccacggcgg	CRISPR spacer
tggcggtgaccacgacggcgagcagcaggc	Protospacer
 ************.******* **  . *

119. spacer 1.8|2531505|30|NZ_CP040174|CRT matches to NZ_CP017303 (Rhodococcus sp. YL-1 plasmid pYLL1 sequence) position: , mismatch: 8, identity: 0.733

gggcggtgaccacaacggcgaccacggcgg	CRISPR spacer
cggcggtgaccacgacggcgagcagcaggc	Protospacer
 ************.******* **  . *

120. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
cggcggcgaccacggcggtgatgtcggaga	Protospacer
************ ********.   .. *.

121. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP013072 (Sphingobium indicum B90A plasmid pSRL2, complete sequence) position: , mismatch: 9, identity: 0.7

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
gcgcggcgagcaggtcggtgaccagcggat	Protospacer
  ******* **** ********** . .

122. spacer 1.2|2531229|30|NZ_CP040174|CRT matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 9, identity: 0.7

cggcggcgaccagggcggtgaccagaacgg	CRISPR spacer
gcgcggcgaacagggcggtgacctcgtccc	Protospacer
  ******* *************  . *

123. spacer 1.4|2531313|30|NZ_CP040174|CRT matches to NC_008760 (Polaromonas naphthalenivorans CJ2 plasmid pPNAP04, complete sequence) position: , mismatch: 9, identity: 0.7

gaacggcgaccagggtggcggcactggtgg	CRISPR spacer
cgacggcgaccagggaggcggcagtttcaa	Protospacer
 .************* ******* *  ...

124. spacer 1.4|2531313|30|NZ_CP040174|CRT matches to KP027201 (Mycobacterium phage Sbash, complete genome) position: , mismatch: 9, identity: 0.7

gaacggcgaccagggtggcggcactggtgg	CRISPR spacer
actcggcgaccagggcgtcggcactgacct	Protospacer
.  ************.* ********..

125. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NC_011961 (Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
cgcgcccgaccaggttggcgaccaaggcac	Protospacer
.*    .******* *************.

126. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to MH067970 (Arthrobacter sp. strain ANT_H40 plasmid pA40H1, complete sequence) position: , mismatch: 9, identity: 0.7

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
ccaccgtgtccagggtgacgaccaaggcct	Protospacer
. .. *** ********.**********

127. spacer 1.5|2531361|30|NZ_CP040174|CRT matches to NZ_CP048428 (Rhizobium daejeonense strain KACC 13094 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.7

tggtggtgaccagggtggcgaccaaggcgg	CRISPR spacer
gcgacacgagcagggtggcgaccaaggcta	Protospacer
  *  ..** ****************** .

128. spacer 1.8|2531505|30|NZ_CP040174|CRT matches to MF403007 (Agrobacterium phage Atu_ph04, complete genome) position: , mismatch: 10, identity: 0.667

gggcggtgaccacaacggcgaccacggcgg	CRISPR spacer
caatcttggccacaacggcgaccacggttt	Protospacer
 ...  **.******************.

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage