CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP036288	Planctomycetes bacterium Pla133 plasmid pPla133_1, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP036287	Planctomycetes bacterium Pla133 chromosome, complete genome	3 crisprs	csa3,DinG,RT,DEDDh,cas3,PrimPol,PD-DExK	1	1	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP036287_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP036287_1

2186741-2186894

Orphan

Consensus_repeat	Method
CTAGGCGCGCCGACGACGCGTATCCGCTGCGATACTCGGAGGAGGCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP036287_1

>merge|NZ_CP036287|1|2186741-2186894|CRISPRCasFinder
CTAGGCGCGCCGACGACGCGTATCCGCTGCGATACTCGGAGGAGGCGCAACGACGCCAGCGGCGATCGGAGCCCGGGAAGTGACGCCGAATTTCTGATCCAGGACACTAGGCGCGCCGACGACGCGTATCCGCTGCGATACTCGGAGGAGGCGC

>NZ_CP036287|1|1|2186741-2186894|CRISPRCasFinder
CTAGGCGCGCCGACGACGCGTATCCGCTGCGATACTCGGAGGAGGCGC	AACGACGCCAGCGGCGATCGGAGCCCGGGAAGTGACGCCGAATTTCTGATCCAGGACA
CTAGGCGCGCCGACGACGCGTATCCGCTGCGATACTCGGAGGAGGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP036287.1\|WP_145064392.1\|2187757_2190949_-\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|223911
NZ_CP036287.1\|WP_145064399.1\|2199359_2199608_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036287.1\|WP_145064391.1\|2186953_2187565_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036287.1\|WP_145064385.1\|2179759_2180782_-\|L-histidine-N(alpha)-methyltransferase	unknown	unknown	gnl\|CDD\|378355
NZ_CP036287.1\|WP_145168321.1\|2195487_2196894_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237171
NZ_CP036287.1\|WP_145064386.1\|2180803_2181661_-\|class-II-glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|132483
NZ_CP036287.1\|WP_145064388.1\|2182976_2184635_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274583
NZ_CP036287.1\|WP_145064389.1\|2184560_2185241_+\|response-regulator	unknown	unknown	gnl\|CDD\|223816
NZ_CP036287.1\|WP_145064394.1\|2192112_2193543_-\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP036287.1\|WP_145064393.1\|2190958_2192209_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_CP036287.1\|WP_145064400.1\|2199717_2200893_-\|carotenoid-1,2-hydratase	unknown	unknown	gnl\|CDD\|227908
NZ_CP036287.1\|WP_145064398.1\|2197428_2199117_-\|gamma-glutamyltransferase-family-protein	unknown	unknown	gnl\|CDD\|223482
NZ_CP036287.1\|WP_145064395.1\|2193539_2194313_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380065
NZ_CP036287.1\|WP_145064383.1\|2177862_2178705_-\|SpoIIE-family-protein-phosphatase	unknown	unknown	gnl\|CDD\|223704
NZ_CP036287.1\|WP_145064381.1\|2176234_2177299_+\|3-isopropylmalate-dehydrogenase	unknown	unknown	gnl\|CDD\|179579
NZ_CP036287.1\|WP_145064387.1\|2181663_2182971_-\|ergothioneine-biosynthesis-protein-EgtB	unknown	unknown	gnl\|CDD\|274581
NZ_CP036287.1\|WP_145064384.1\|2178837_2179587_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036287.1\|WP_145064390.1\|2185237_2186647_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|273593
NZ_CP036287.1\|WP_145064396.1\|2194418_2195528_+\|DUF429-domain-containing-protein	unknown	unknown	gnl\|CDD\|227260
NZ_CP036287.1\|WP_145064382.1\|2177385_2177823_+\|glyoxalase	unknown	unknown	gnl\|CDD\|319945

Protein	Function_ID	Function_description	E-value
NZ_CP036287.1\|WP_145064400.1\|2199717_2200893_-\|carotenoid-1,2-hydratase	gnl\|CDD\|227908	COG5621, COG5621, Predicted secreted hydrolase [General function prediction only].	7.41528e-89
NZ_CP036287.1\|WP_145064394.1\|2192112_2193543_-\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	3.50093e-74
NZ_CP036287.1\|WP_145064385.1\|2179759_2180782_-\|L-histidine-N(alpha)-methyltransferase	gnl\|CDD\|378355	pfam10017, Methyltransf_33, Histidine-specific methyltransferase, SAM-dependent. The mycobacterial members of this family are expressed from part of the ergothioneine biosynthetic gene cluster. EGTD is the histidine methyltransferase that transfers three methyl groups to the alpha-amino moiety of histidine, in the first stage of the production of this histidine betaine derivative that carries a thiol group attached to the C2 atom of an imidazole ring.	3.99761e-130
NZ_CP036287.1\|WP_145168321.1\|2195487_2196894_+\|hypothetical-protein	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	2.55537e-07
NZ_CP036287.1\|WP_145064386.1\|2180803_2181661_-\|class-II-glutamine-amidotransferase	gnl\|CDD\|132483	TIGR03442, TIGR03442, ergothioneine biosynthesis protein EgtC. Members of this strictly bacterial protein family show similarity to class II glutamine amidotransferases (see pfam00310). They are distinguished by appearing in a genome context with, and usually adjacent to or between, members of families TIGR03438 (an uncharacterized methyltransferase) and TIGR03440 (an uncharacterized protein). [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs].	4.12158e-60
NZ_CP036287.1\|WP_145064392.1\|2187757_2190949_-\|MMPL-family-transporter	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
NZ_CP036287.1\|WP_145064389.1\|2184560_2185241_+\|response-regulator	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	7.15049e-71
NZ_CP036287.1\|WP_145064388.1\|2182976_2184635_-\|hypothetical-protein	gnl\|CDD\|274583	TIGR03444, EgtA_Cys_ligase, ergothioneine biosynthesis glutamate--cysteine ligase EgtA. Members of this bacterial protein family, EgtA, resemble the glutamate--cysteine ligase of the two-step pathway for glutathione (GSH) biosynthesis, but instead are involved in the biosynthesis of the histidine-derived thiol, ergothioneine (EGT). Successful in vitro reconstitution of EGT biosynthesis using EgtBCDE and gamma-L-glutamyl-L-cysteine suggests that this enzyme is a bone fide glutamate--cysteine ligase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs].	7.97508e-44
NZ_CP036287.1\|WP_145064393.1\|2190958_2192209_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	1.17778e-46
NZ_CP036287.1\|WP_145064398.1\|2197428_2199117_-\|gamma-glutamyltransferase-family-protein	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
NZ_CP036287.1\|WP_145064395.1\|2193539_2194313_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|380065	pfam17939, TetR_C_30, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in the Pseudomonas aeruginosa PsrA which regulates the fadBA5 beta-oxidation operon. Functional analysis of PsrA indicated its importance in regulating b-oxidative enzymes. It has also been suggested that PsrA, a member of the TetR family of repressors, could affect global gene expression including activation of rpoS.	9.85502e-20
NZ_CP036287.1\|WP_145064383.1\|2177862_2178705_-\|SpoIIE-family-protein-phosphatase	gnl\|CDD\|223704	COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms].	3.26646e-30
NZ_CP036287.1\|WP_145064381.1\|2176234_2177299_+\|3-isopropylmalate-dehydrogenase	gnl\|CDD\|179579	PRK03437, PRK03437, 3-isopropylmalate dehydrogenase; Provisional.	1.27189e-159
NZ_CP036287.1\|WP_145064387.1\|2181663_2182971_-\|ergothioneine-biosynthesis-protein-EgtB	gnl\|CDD\|274581	TIGR03440, egtB_TIGR03440, ergothioneine biosynthesis protein EgtB. Members of this family include EgtB, and enzyme of the ergothioneine biosynthesis, as found in numerous Actinobacteria. Characterized homologs to this family include a formylglycine-generating enzyme that serves as a maturase for an aerobic sulfatase (cf. the radical SAM enzymes that serve as anaerobic sulfatase maturases). [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs].	3.47369e-117
NZ_CP036287.1\|WP_145064390.1\|2185237_2186647_+\|hypothetical-protein	gnl\|CDD\|273593	TIGR01386, Probable_sensor_protein_PcoS, heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.	1.36078e-41
NZ_CP036287.1\|WP_145064396.1\|2194418_2195528_+\|DUF429-domain-containing-protein	gnl\|CDD\|227260	COG4923, COG4923, Predicted nuclease (RNAse H fold) [General function prediction only].	3.25608e-36
NZ_CP036287.1\|WP_145064382.1\|2177385_2177823_+\|glyoxalase	gnl\|CDD\|319945	cd08357, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) familyprotein, glyoxalase I, and type I ring-cleaving dioxygenases. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	5.15916e-54

>NZ_CP036287.1|WP_145064390.1|2185237_2186647_+|hypothetical-protein
MKTLVGRLTLWLVGGVGATLLLVGLLIWTRVDAFLIDYFDDNLYTRVLSLGAAAQWDSDGMVSLPYETALYKDYEGPFERDVFQVVDLEGEELARSPTLGVGADITLDPERIQQAWASNSAVTADLELPGGSSGRAVAMVLEVADPEGEPRRALFIVATPRLMLSQAQKSLFVPLSLGALAALIGLGVWVRAVVRRGLRPLEDIADRLGDLDEDTLERRLPVVDLPGELRPIAGQANALFDRLDAAFERERRTTNNIAHELRTPIAELRGLTEVALRLGDDPEFAAKTVAEAYAIATEMDRIATTLLRVARAQAGELEVKREVLSSSAVLERAIRSVGESARGRGIEFELKLRDDLELAADPDLLDLILINLLSNSIQHAPAGDRVTCEVWRGQDDVQFVIENTNPGLEPGDMKHLTETFWKKDDARTDAVHTGLGLALVDQLAQTCGYSFSMALAGDRVRARVTVPLD
>NZ_CP036287.1|WP_145064389.1|2184560_2185241_+|response-regulator
MRILLIEDSERLQLALTTGLRKEGHGVDVAGDGEAGLSYARNNQYDAIVLDLMLPKIDGLTVLQTLREEGNDTHVLVLTAKDTVDERVTGLRRGADDYLVKPFAFDELLARLEALGRRVYNAKSPEVTVGDLMIDTSAKSVERAGRRIDLSTREYALLEYLARRLGETVSRIEIEDHLYDETSLPTSNAVDRAVCSLRAKIGGPDDLPLIHTRRGLGYVLEAREDR
>NZ_CP036287.1|WP_145064388.1|2182976_2184635_-|hypothetical-protein
MALLAKAGGQGELEPLGVLDEQDSHGRPQTNPPSGAGPGGHERGHRIGPGSGPRGPGSTSKSGRAPEFVAPRLRSHRAHLRWALPRTRMPTKDPELTITVDEALERAAARAFPEIDESRAGARDVGLEPERFAIEMDAQGRPLRRLPLAGPGGVLEAIDQVAGRDDLIQARDPERVPPTVGLTQGGSLTFEPGAQIEHSTAVHPSASAALDDVRAVVSKLEEVFGPRRVALISLGLDPWFGPGDVPQQLDADRYRSMAAYFDARGPSGPWMMRLSCSLQVNVDLGSRQVRDERWLLGNLLSPALVGIFSTSPERAGEDYFHCRRARVWQTIDPTRTGFPAGLLDGSLEGPERQYAAAALDADVLLFRTEAGHAVTGEPGLRFRDWIERGHPVHGWPTIDDLDYHLTTLFFEVRPRGFFELRGIDALPYCMRPAAVAFVCGLLYDERARGLALERLAPSLAGLDQRWRDSAERGLEIPRLRDEVDFLWRTALDGMERLGPQFMREEHMSDARAFAERFFARTAAPVDELRAAVAVGPAAALRWADGSGCSAAV
>NZ_CP036287.1|WP_145064387.1|2181663_2182971_-|ergothioneine-biosynthesis-protein-EgtB
MDALRERLRRELAAARRRTLELVEATSAADLARRADAALGPGIWDLGHLASFEDLWGVRRVLGESERVSAPELDELYDAFEQPRSKRCDLPLLDRDGALELLERVRARTLEGLERARLTDGDDLVRSGYVWSMLVQHEAQHQETLLQSLQHLGVAIPTADPMAGEPRAEQAPAVDDEQRIQLPGAEVVIGGQTEWGPYDNERPRHAVELAPFALDRYPLTNRRFLAFVEAGCYARSELWTAEGRSWLARCGARSPAGWTRNDDGRWSVRRFGRQIAVDPREPVQHISCHEAEAFATWVGARLPTEFEWEHAATAGGARAPYPWGTPQIDEARANCDGRRDGPAPVGSFPRGASPLGIEQMLGDVHEWTASSFDGYRGFEPFPYPEYSQVFFDRGYRVLRGSSWAAAGALARVTYRNWDLPERRQIFAGCRLAWDA
>NZ_CP036287.1|WP_145064386.1|2180803_2181661_-|class-II-glutamine-amidotransferase
MCRLGAHVGVRVPLSSLLYDPEHSLEVQAYRPREMCSGHVNVDGTGVAWWPRRGAGEPLRYVTERPPWSDPNLPALAPRIEAEVILAAVRSATPGMPFSAAAVAPFVADGVAFAHNGFVEDFERAVARSVLARLPDDLFGELQVRTDSLVLFALLRRHLRERPAAGLAEAHAAATAELAEICVAAGVRANLVSVAVDGGSLSAIRSAVGLPPNSLYIRADKEAESAQIASEPLQGSIPDPGSTKSPPASWEPVPDQTQVRMCVDRPAESLRSVALEVGAPSPPAE
>NZ_CP036287.1|WP_145064385.1|2179759_2180782_-|L-histidine-N(alpha)-methyltransferase
MSDDSTPTLIIRRLEGPEEQEREALDELRAGLAGSPKELQPKLLYDGHGSELFERITRQPEYYPTRSEAEILEQHAPAIMERYRPEELFEIGSGSSRKTRALLEAMLEHGGSRYVPFDVSDDAVRAAADVLCRDYAELEVRGVVGDFHTDLHAVPHPGRRVVAFLGSTIGNLMESERRAFLKQVHSLLRPGDALLLGFDLVKDREALEAAYNDAAGVTREFIRNVLVVLNRDYGADFDPERFRYRGTWDAAARRMDIGLVATAAMTVRIEALDLTLDFERGEYLRVEVSGKFSPSDVGAELRAAGLEPVQFLFDRARRFGLAVAEPSAVPTTRTGSGTAD
>NZ_CP036287.1|WP_145064384.1|2178837_2179587_-|hypothetical-protein
MFSALAGPPARQVSILYRAPARALREALPSDLTAVEREGWVLLELACAAPIDLPLGGDVALIAWRVPVSRADGARGLWVLDRWSSARIGAGWPERWGVPRSAERPPRHSQWNETARGDLEVEVRSGPRRVCIRATPGPRTERSMFVSTRQAELFLAEGGRVLNPHPLSWLIDRQPLARGQVGLGPLIVHSLEVTAPNGIARRGELVLDCAFRVIDRRREGADATTRGRIRANSGGLTSPSPAMTSGQLR
>NZ_CP036287.1|WP_145064383.1|2177862_2178705_-|SpoIIE-family-protein-phosphatase
MLPGPPLSAQDAFTTRFYTGCNRRICEGIDLTAGELVVYTSPSPLHPDRNEDGAAVFRVGDAVVIAVADGVGGLPGGAMASTRALEEIGRTLGELGGDVTESRLRNAVLDGIELAHRAIRETGDGGATTLAAVEILGRQLRTYHAGDSAILIFDADGELRLQTVAHSPVGYALESGLITEAEAFFHDHRNIIFNCLGLERIHIEFSSAIELDPGDTVLLATDGLFDNLTLAELSELSRGGELASVCQQLESVATERMNAPGGQAPSKPDDLTFATFRLAP
>NZ_CP036287.1|WP_145064382.1|2177385_2177823_+|glyoxalase
MSASEPLPGARFHLAFPVDDLAAAEAFYAVLLGCPIGRRSQAWIDFDLGGNQLTAHLVSGTEQGVGSNPVDGDQVPVRHFGLVLPWEVWEALAERLAAAGAAFQISPRVRFVGEVGEQGTFFIHDPAGNALEFKAFRDPRRLFAR
>NZ_CP036287.1|WP_145064381.1|2176234_2177299_+|3-isopropylmalate-dehydrogenase
MKQYDIASIGGDGIGPEVTAQAMRILDAAAEQFGFSLKIQDYPLGTDYYLANNEIFPSSIFEECKQQHAIFLGAIGDPRVPVGMIEFGIIAKLRFELDLYINLRPVKLYDARLCPLKDKTPEDIDMLIVRENTEGAYSGMHGFAHKGQPLEVATQTMVYTREGVERAVRYAFELTKTRAERKVTLVDKANAIRAQDIWTRTFAEVAAEYPDVATDHAYVDAACMWMIKNPEWFDVIVTPNLFGDIITDLGASLQGGMGIAASGNIHPGQVSLFEPIHGSAPKHAGKNVASPVAAIMAASMLLDYVGEKEAGAAIETAIVDLVRDGSIRGVSTAMHRTDEVGDMVLERMRSTAGV
>NZ_CP036287.1|WP_145064391.1|2186953_2187565_-|hypothetical-protein
MPTLAPLIAACIRRIDAGLDPCADDLEQLAIALDNEPSEQELLSIGRLISDPRRANHLGELVDAIHRAFERTPRARRRFEQDVAVPGLRRAPQSAPRDRELVGLYAWTEHGDETSFALTNTVLLLLAPEGHFARGPADPAAKPSDGLTGQDAGDRGVWSSARGRLLLASDVGRHESYAFVRKARSLHLTDDHRVRRLLRPITD
>NZ_CP036287.1|WP_145064392.1|2187757_2190949_-|MMPL-family-transporter
MDKWIRWFAGNGVAANLLMALILVAGVVTIPTIQVEVFPELSSDMVTIQVPYPGAAPEETEQSICVRIEEAIWDVSGVEEITSTAAENMATVTVEVRSDADAREVLDDVKVRVDAIDTFPDEAEQPIVAELVTRKPVIDVTVFGSTDEFTLRRLAERVREELSALPEISQAQLAGAPPYEISIEVSEDSLRQFGLTFDEVTAAVRRGSIELPGGSVKTRGGEILLRTAGRAKEREAFEALVVRTAPDGSRLTVGDVAQVVDAFADTDERTRFDGLPSAQIRVYRVGDQNALEIAAAVRDYVERTRLDLPQGLNIDTWQDQSIILRDRLRVMIQNGLSGLGLVFVVLALFLRFRLALWVALGIPVSFLGALAMLPHLGGSINLISLFAFILVLGIVVDDAIVVGESVHRFQERGEGGIKGSRRGALDVSQPVQFAIFTTVLAFVPMALLDGFSGRIWFIIPAVVIPTLLFSLIESLLILPAHLAHSSHLLDRLSERPPFVWWVRFQKRIADGQETFVDRFFTPTLRAALRFRYATLSAGLVALALTLETVAGGHIRFDFMPPVEADNVAAQVSMPLGTPIERTAAAAAQLEAAIVELKDELAAEGQPDLIRHWFTAVGSQPFRGDQSSNGGRIGGSFSGEHLAEVTLELAPAQEREVPSLEIAKRWRDLVGEIPGAIELEFDSDLIASGKPVHVRLQSTDTSRLRALTDDLRAELRDLPGVFAIADTFREGKRELRLDVKPQAQALGLSRAELARQVRQGFYGDEAQSIQRGRDDVDVMVRYPKDERLSLADVAAMRVRTPDGGEVPFGEVATAFETRGDSTIMRADRMRAIEVTADVDDAMADPNAVRARLQEEILPRLVAAYPGSRWSMVGEQQEQAETISQLARLYAVALLGIFALMAIPFRSYFQPLIVMSAIPFGLVGAVGGHLLTGYQLSMISVLGVVALGGVVVNDSLVLVDFVNRERIAHPHKSASQAAIDACRTRFRPILLTSLTTFAGLTPLMLERSVQAKFLIPMAISLAFGVAFATFITLGLVPSLYLIQEDARGLVQRLLPGRPRVDRAVQ
>NZ_CP036287.1|WP_145064393.1|2190958_2192209_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MARHAARLAREPDRPAPGPGWRVRRHRGGAGVKPVLFQVALCAVILALGAAGVSALVASRGEVQVEPREAVVPLVQVQWIELSPLVLEVQSQGMVESAREATIAAEVGGRITRIAAPLESGARVHQGDVLVELDRRDLEIARIAASAAVAEARAALELEQAEAEITRRDLLASGVDEPSALARREPQLARAQARFDSAVAAGEKALLDLERTVLRAPFDAVVDRRLVDAGQVIAAGTPLAQLIATEAYEVALPLGAADLARLEPLGVGEIDGPAVELSVEVDGRPATFSGRVVRTAAQLDPRSRSLMAITRIDAPLDQGSAPLRLGAFASARIAGREIERAATIPTEALRGADQVWIVDADQRLQRRTVQVVQRGTDDVVIESGLSDGERVITSALDLAVDGMAVAVEQPDAPARN
>NZ_CP036287.1|WP_145064394.1|2192112_2193543_-|efflux-transporter-outer-membrane-subunit
MKQLATSLLGLLALGSCAAIDPPEARARVEAPPLPDVFVADESAPPAAEQAADAWWEELGTPELDALIVEALERSYDLRAALERVAQADAEAELAGVSRRPQVSAGLSADRSRRNYVGLPIPGSGGVLSSTATTFGLSLNLSWELDLWGRLSALERAAELQRDATTADFAGVRLSIAGQVAKAYVSAVEAKAQLRVADDAVEIRRRSLQLVQDRFEGGLAPRLELEQSRTQLANSEALVAGRRRAAEASIRRLEILMGRYPSGDLQVADSLPNPPERPPVGIPATIVSRRPDLFSAELRLRAADERFQAARADLYPRLALTASGGTSSNELGDLLDGDFRVWSLAGNLVQPIFEGGRIRAQIASSDALASEASAQFAGAVLRACAEVEIALDAEDDLALQVTHLASAVESSRASEALVDERYRSGLENLLQLLIERRTRLDAESAWLDTRRAWLENRIDLHLALGGGFDATAEVQE
>NZ_CP036287.1|WP_145064395.1|2193539_2194313_-|TetR-family-transcriptional-regulator
MLDSDDQQPPAQPPASPAAESPARGQVDPSSDVSRDTRTRLLDAAERLFAERTFASTSLRQITAAADANIAAVHYHFGSKDELFRAVFHRRVGPVNDRRLQGLRALLTAAAPAEPSLEDVLRALVEPAAALRATPAGRSFACLIGRSLSADGPHWKTIEREFEGVKAEFMPVFVRLCPELSTADLVWRLHFGLASLCMVLSDTDRLRLATGGLCDPDDVGTVVEQIVSFTAAGLRAPATASPTGPRAGRPSNLDSDR
>NZ_CP036287.1|WP_145064396.1|2194418_2195528_+|DUF429-domain-containing-protein
MKRLRRFPRGPWTGVDGCRAGWVRARLSPAGRIEIDLVKSARALIADPADPLVIDMPIGLFPGGRARARDCDRAARERLGPRRSSVFNPPTRAMLRAREHGEVGRLGLSIQAFHLIPKIAELDRALSADDASRVLEGHPELAFACLAGAPLEAPKRTTAGRHARARLLEAAVAGSLDAFADFAAATRRKDVALDDILDAMVLAVAARDVAAGTALRLPEGELDRDRRGLPMQIFGASSVPTPVDDQRTRIDTLRPFGMARRPAVRGQTDERRARVLATVDAIPSGKVATYGLVATEAGLPRRARFVGGCLRDLPPGTSLPWWRVVNASGGISPRGDGSSTGEQRRRLEREGVQLTGGGRVDLSLHLWRP
>NZ_CP036287.1|WP_145168321.1|2195487_2196894_+|hypothetical-protein
MGASTSVSTSGGPEAVSSRNLALGSSGVTRRAEVACGTNQRGAHMFQRIPAPLPGDQAPRPISEVRQVDQAAGGPPDRRTAGELPKARRVDEIAISREAEDRLLREDQSRAAATQRDGTSSLRERPQGTEARERTEGIQARERPEGVQTREGPEGPVERERPEGPAARERVDRPEARAEQAREREVSRSRPDDGVRTSASRGEATDRSDAAPQRDAEGPRAPREVATERINERIQAARADEETRTESRQDVVAQQRAVVEERGIGGDAPRGVAAVDEATRIDNQAADRARRGEADTFEVERNRDSVELVREDVERGIERQASTERQIESEARLRSDDVAVDERSREGSERVAAERSEREAATRDGILRNRLDEARAVRPSDSRSVEATAVRGDDLDRLRESAARQRVAAQAESRPNGAMGEERQDREVKLPFPDGGRTDFGPDAATLLEELDGRPDPPESTLPEELFG
>NZ_CP036287.1|WP_145064398.1|2197428_2199117_-|gamma-glutamyltransferase-family-protein
MNPTSIALGLALLVPTALAAQDRITGAPFATRSEVLATGGMAATSQPLATQAALEILRAGGNAVDAAIAANAVLGLTEPTGSGIGGDLFAIVWDAEEGRLFGLNGSGRSPRSLTLEEFERRGLKSIPPHGPLPVSVPGCVDGWFTLHERFGELPMERILAPAIGYAREGFPVTQTIAYYWQASARILHPYPGFREQMTIDGRGPEEGEIWRNENLARTYEVLVAGGRDAFYEGDIARTIAAFMAENDGFLTYEDLAAHHSEWVEPVGVDYRGHTLWELPPNGQGIAAQQILQVLEGYDIAAMGLGSAQYLHLFVEAKKLAFEDRARLYADPDFFETPIARLVSDEYAAERRALIGERASKHLPSGFPDQGDTVYLCTADAAGNMVSLIQSNYRGMGSGMTPTGLGFVLQDRGELFDLTPGRANSYAPGKRPFHTIIPAFLTRADGARMAFGVMGGATQPQMHAQIVVDLVDFGLGLQEAGDTPRLIHSGSSQPTGERMEDGGVVNLESGFAPEVVRELMHRGHRIEWARGPYGGYQAIWRDPQTGVLRGASESRKDGHAAGF
>NZ_CP036287.1|WP_145064399.1|2199359_2199608_-|hypothetical-protein
MKNKILILLGAIGAVAALVELTSAPEAGPERERHSMASGTASGLLEVAIPEVAVPNFGRDDEKPSSDERGPVQLRVPKGLGD
>NZ_CP036287.1|WP_145064400.1|2199717_2200893_-|carotenoid-1,2-hydratase
MSRRSLLLALLALSACGGSKPSTPAVALSDLLGAGDTASFARADGPRDFTFPADHGPHPGFRTEWWYVTGNLTSADGRPFGFHLTLFRRGLAQPEGRASDLAPSDLWMAHFAIADGAGREVHAHERTARGAGGLAGAAWSDDGAGDSQLRVWLEDWELAFVDGLGAGELPRLRLVARAGDDALELNLAARKPAVLQGDAGLSIKGSAPGQASYYYAVTRLTASGSVEVGGETFAVDGSAWLDREWSTSVLGQGQVGWDWFALQLDDGTDVMLYQMRLADGGVDATSHGSITEKDGSHSKLEGSGYTLRSADTWHSPRSGAPYPSGWTAVVPEKGLELRITPLLPDQELPLSVVYWEGAVQIEGTRAGRPVRGVGFVELTGYADIGEGGAPR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP036287_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP036287_2

3068092-3068188

Unclear

Consensus_repeat	Method
CCGACCCTCAACCCCTTCGAGAACTTCGGAC	CRISPRCasFinder

1 spacers

cas3

The CRISPR arrays of NZ_CP036287_2

>merge|NZ_CP036287|2|3068092-3068188|CRISPRCasFinder
CCGACCCTCAACCCCTTCGAGAACTTCGGACAGTCCGCGCCCGCCGCGCCGCCCAAGCCCGCGGGTCCGACCCTCAATCCCTTCGAGAACTTCGGAC

>NZ_CP036287|2|2|3068092-3068188|CRISPRCasFinder
CCGACCCTCAACCCCTTCGAGAACTTCGGAC	AGTCCGCGCCCGCCGCGCCGCCCAAGCCCGCGGGT
CCGACCCTCAATCCCTTCGAGAACTTCGGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP036287.1\|WP_145065176.1\|3052466_3055223_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379232
NZ_CP036287.1\|WP_145065194.1\|3068237_3068987_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|132557
NZ_CP036287.1\|WP_145065213.1\|3084247_3085228_-\|YggS-family-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|143483
NZ_CP036287.1\|WP_145065200.1\|3072545_3075152_+\|DEAD/DEAH-box-helicase	cas3	mkCas0139_cas3_CAS-I	gnl\|CDD\|274800
NZ_CP036287.1\|WP_145065188.1\|3062765_3064832_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036287.1\|WP_145065196.1\|3068986_3070567_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378253
NZ_CP036287.1\|WP_145065186.1\|3061132_3062626_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036287.1\|WP_145065204.1\|3076910_3079475_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379297
NZ_CP036287.1\|WP_145065211.1\|3081038_3084251_-\|protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP036287.1\|WP_145065180.1\|3057074_3058733_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|316802
NZ_CP036287.1\|WP_145065209.1\|3080163_3081711_-\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350160
NZ_CP036287.1\|WP_145065182.1\|3058956_3059700_+\|DUF3667-domain-containing-protein	unknown	unknown	gnl\|CDD\|378853
NZ_CP036287.1\|WP_145065178.1\|3055300_3056884_-\|sulfatase-like-hydrolase/transferase	unknown	unknown	gnl\|CDD\|293755
NZ_CP036287.1\|WP_145065190.1\|3064932_3066597_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036287.1\|WP_145065206.1\|3079543_3080167_-\|phosphoribosylglycinamide-formyltransferase	unknown	unknown	gnl\|CDD\|187714
NZ_CP036287.1\|WP_145065198.1\|3070604_3072416_+\|DUF4340-domain-containing-protein	unknown	unknown	gnl\|CDD\|379518
NZ_CP036287.1\|WP_145065172.1\|3047851_3049432_+\|AarF/ABC1/UbiB-kinase-family-protein	unknown	unknown	gnl\|CDD\|270872
NZ_CP036287.1\|WP_145065184.1\|3059779_3061117_+\|histidine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234586
NZ_CP036287.1\|WP_145065202.1\|3074770_3076819_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379215
NZ_CP036287.1\|WP_145065174.1\|3049809_3052191_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|185001

Protein	Function_ID	Function_description	E-value
NZ_CP036287.1\|WP_145065176.1\|3052466_3055223_-\|hypothetical-protein	gnl\|CDD\|379232	pfam13517, VCBS, Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).	4.2965e-09
NZ_CP036287.1\|WP_145065194.1\|3068237_3068987_+\|ABC-transporter-permease-subunit	gnl\|CDD\|132557	TIGR03518, ABC_transporter_permease_protein, gliding motility-associated ABC transporter permease protein GldF. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldF is believed to be a ABC transporter permease protein (along with ATP-binding subunit, GldA and a sunstrate-binding subunit, GldG) and is linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldF abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.	7.35314e-22
NZ_CP036287.1\|WP_145065213.1\|3084247_3085228_-\|YggS-family-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|143483	cd00635, PLPDE_III_YBL036c_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, YBL036c-like proteins. This family contains mostly uncharacterized proteins, widely distributed among eukaryotes, bacteria and archaea, that bear similarity to the yeast hypothetical protein YBL036c, which is homologous to a Pseudomonas aeruginosa gene that is co-transcribed with a known proline biosynthetic gene. YBL036c is a single domain monomeric protein with a typical TIM barrel fold. It binds the PLP cofactor and has been shown to exhibit amino acid racemase activity. The YBL036c structure is similar to the N-terminal domain of the fold type III PLP-dependent enzymes, bacterial alanine racemase and eukaryotic ornithine decarboxylase, which are two-domain dimeric proteins. The lack of a second domain in YBL036c may explain limited D- to L-alanine racemase or non-specific racemase activity.	9.89171e-79
NZ_CP036287.1\|WP_145065200.1\|3072545_3075152_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|274800	TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase. A conserved gene neighborhood widely spread in the Actinobacteria contains this uncharacterized DEAH-box family helicase encoded convergently towards an operon of genes for protein homologous to type II secretion and pilus formation proteins. The context suggests that this helicase may play a role in conjugal transfer of DNA.	0
NZ_CP036287.1\|WP_145065196.1\|3068986_3070567_+\|hypothetical-protein	gnl\|CDD\|378253	pfam09822, ABC_transp_aux, ABC-type uncharacterized transport system. This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins.	3.62978e-31
NZ_CP036287.1\|WP_145065204.1\|3076910_3079475_-\|hypothetical-protein	gnl\|CDD\|379297	pfam13620, CarboxypepD_reg, Carboxypeptidase regulatory-like domain.	1.01977e-09
NZ_CP036287.1\|WP_145065211.1\|3081038_3084251_-\|protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	9.86744e-98
NZ_CP036287.1\|WP_145065180.1\|3057074_3058733_-\|hypothetical-protein	gnl\|CDD\|316802	pfam14312, FG-GAP_2, FG-GAP repeat.	0.000525622
NZ_CP036287.1\|WP_145065209.1\|3080163_3081711_-\|purine-nucleoside-phosphorylase	gnl\|CDD\|350160	cd09009, PNP-EcPNPII_like, purine nucleoside phosphorylases similar to human PNP and Escherichia coli PNP-II (XapA). Human PNP catalyzes the reversible phosphorolysis of the purine nucleosides and deoxynucleosides inosine, guanosine, deoxyinosine, and deoxyguanosine. Patients with PNP deficiency typically present with severe immunodeficiency, neurological dysfunction, and autoimmunity. Escherichia coli PNPII, product of the xapA/pndA gene, catalyzes the phosphorolysis of xanthosine, inosine and guanosine with equal efficiency and has been referred to as xanthosine phosphorylase and inosine-guanosine phosphorylase. E. coli PNPII is also capable of converting nicotinamide to nicotinamide riboside, and may be involved in the NAD+ salvage pathway. It is one of two purine nucleoside phosphorylases found in E. coli, which also contains PNPI, which displays a different substrate specificity and belongs to a different subgroup of the nucleoside phosphorylase-I (NP-I) family than PNPII. NP-I family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases, such as purine nucleoside phosphorylase (PNPs, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases, such as AMP nucleosidase (AMN, EC 3.2.2.4), and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	1.27966e-35
NZ_CP036287.1\|WP_145065182.1\|3058956_3059700_+\|DUF3667-domain-containing-protein	gnl\|CDD\|378853	pfam12412, DUF3667, Protein of unknown function (DUF3667). This domain family is found in bacteria and eukaryotes, and is approximately 50 amino acids in length. There is a single completely conserved residue P that may be functionally important.	6.18457e-07
NZ_CP036287.1\|WP_145065178.1\|3055300_3056884_-\|sulfatase-like-hydrolase/transferase	gnl\|CDD\|293755	cd16031, G6S_like, unchracterized sulfatase homologous to glucosamine (N-acetyl)-6-sulfatase(G6S, GNS). N-acetylglucosamine-6-sulfatase also known as glucosamine (N-acetyl)-6-sulfatase hydrolyzes of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate. Deficiency of N-acetylglucosamine-6-sulfatase results in the disease of Sanfilippo Syndrome type IIId or Mucopolysaccharidosis III (MPS-III), a rare autosomal recessive lysosomal storage disease.	0
NZ_CP036287.1\|WP_145065206.1\|3079543_3080167_-\|phosphoribosylglycinamide-formyltransferase	gnl\|CDD\|187714	cd08645, FMT_core_GART, Phosphoribosylglycinamide formyltransferase (GAR transformylase, GART). Phosphoribosylglycinamide formyltransferase, also known as GAR transformylase or GART, is an essential enzyme that catalyzes the third step in de novo purine biosynthesis. This enzyme uses formyl tetrahydrofolate as a formyl group donor to produce 5'-phosphoribosyl-N-formylglycinamide. In prokaryotes, GART is a single domain protein but in most eukaryotes it is the C-terminal portion of a large multifunctional protein which also contains GAR synthetase and aminoimidazole ribonucleotide synthetase activities.	1.17506e-71
NZ_CP036287.1\|WP_145065198.1\|3070604_3072416_+\|DUF4340-domain-containing-protein	gnl\|CDD\|379518	pfam14238, DUF4340, Domain of unknown function (DUF4340). This domain is found in bacteria, and is typically between 183 and 196 amino acids in length.	1.30783e-09
NZ_CP036287.1\|WP_145065172.1\|3047851_3049432_+\|AarF/ABC1/UbiB-kinase-family-protein	gnl\|CDD\|270872	cd13970, ABC1_ADCK3, Activator of bc1 complex (ABC1) kinases, also called aarF domain containing kinase 3. This subfamily is composed of the atypical yeast protein kinase Abc1p, its human homolog ADCK3 (also called CABC1), and similar proteins. Abc1p (also called Coq8p) is required for the biosynthesis of Coenzyme Q (ubiquinone or Q), which is an essential lipid component in respiratory electron and proton transport. It is necessary for the formation of a multi-subunit Q-biosynthetic complex and may also function in the regulation of Q synthesis. Human ADCK3 is able to rescue defects in Q synthesis and the phosphorylation state of Coq proteins in yeast Abc1 (or Coq8) mutants. Mutations in ADCK3 cause progressive cerebellar ataxia and atrophy due to Q10 deficiency. In algae and higher plants, ABC1 kinases have proliferated to more than 15 subfamilies, most of which are located in plastids or mitochondria. Subfamily 13 (ABC1K13) of plant ABC1 kinases belongs in this subfamily with yeast Abc1p and human ADCK3. ABC1 kinases are not related to the ATP-binding cassette (ABC) membrane transporter family.	5.17796e-71
NZ_CP036287.1\|WP_145065184.1\|3059779_3061117_+\|histidine--tRNA-ligase	gnl\|CDD\|234586	PRK00037, hisS, histidyl-tRNA synthetase; Reviewed.	3.63616e-112
NZ_CP036287.1\|WP_145065202.1\|3074770_3076819_+\|hypothetical-protein	gnl\|CDD\|379215	pfam13482, RNase_H_2, RNase_H superfamily.	4.08351e-36
NZ_CP036287.1\|WP_145065174.1\|3049809_3052191_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	9.00248e-63

>NZ_CP036287.1|WP_145065190.1|3064932_3066597_-|hypothetical-protein
MTTLSPARAGALLLAAGTLTSIASAQCQVRTITPPAGAAEGGFGLRIAASADRFAVSSYVEVPGSQGTEGIVHLFRDQGAAGWQLSQSVTMPSAPGLRFFGEKLGFGGDVLAVLTRNEPGAVGPTGLPVSSSIFVFERQGSDFVLSQQLDTGVVSDALGFNAVHAVDANDATIVAGYSDLGLGWAGGAVATYERSGSLWISGPTISAPAGFGNANFGGDVDLDGNQLLVAQWPGFVHHYERSAGTWQYTQTFATSACSQNSGVMDVALAGNQAFVSVYETPADCPSHIEIFERPAAGLPFAASQTLLSPVTDPQLRWGQKMVAEPNRLVVGSPSNDTSAPFTHSEVHVYDRGPSGWVAGALLTPSWPANNHTGAARSLALVGNTVVNGAYSDNSVGVAAGSVSLWSIDGSGCPSLAGVPDARSIGYVNDVPGYAPAGRQDLVLDAGQAHAGELYLVLGSVTGTAPGINLDGQVLPLVFDAWTAFTLSSPNSGPLQSTFGVLDSQGRALAAIQLAAPLDGALAGLTLHHAFVTLGTVPLPTVTFASEAAPLSLLP
>NZ_CP036287.1|WP_145065188.1|3062765_3064832_-|hypothetical-protein
MNWRTVGGASALAALSLLGWLLFDCGDPVDPAGDATVAVPQTDPRRDTVEARPPVETVGERREVAPPIEGQVDPNENGTPVFSALDGPGARVTGRLVEHDGRPVPGAILRVRSQPDPASSFLYLLGADESRPAAGAFDAVVTDGDGLFDLRFAEDTARAGFGHGLTVVTADGRWESLELPRVGSGDRVDDLILRLPAARRLDIDVPDVDLQRLTQDRYVDFDRDRSWSWDVYRDHGLVGATGHVVDGEGRITALTAVQTGGRRLTAWLDPEGSAPLEVELTIPGRELASAPVTRAGVDAFHARLSAPPQRELTLRVRSAVAGHREGEVRLEVRGNQEPSLSREHYDWAAHLRVRLEELPREVVVALGSRSIDLLEVVLMEPDGSEQLLASCEPELDPRPLSVEIPAVGAWPPPDPRTTARQPSCFDLSPETVTVAGTAIDAVSGEPLAGVVLVRSGLGGPLTIERPASAPSDGRGRTLAGGLPPHVATTVGFDLPGYRLETVEVPPLAAGSRYDLGHVALEPEPPSHRLRVLGPDGEPVAGIAVALGQLTRETDVEGRVGFPSRPPYDTSFVTVGREPGWRFAPPTGPDEVTLRLTQVRSVELRIEGGVGRPFQLIDVDLRKAGVDWLPDLGFFGAPLEDAPRRDAWFLLDLPAGRYRLGGPVSGTDAFEFTVEPGTGRQVVDASTGG
>NZ_CP036287.1|WP_145065186.1|3061132_3062626_-|hypothetical-protein
MVTQSGPISRLIACCAASTLISSLAAGVVVLAAPGAGDLDPARSPLDPLPQTSTTAVDPLPQLSPWEGEGAVLSGILLDSDGSPLVDALVVVTPRRVDLETGALLPGELSYRGAARSRPRTRTGEDGRFELTIPTDLARWAFGQILSVYTRDNRDELVPMPRVLEGERCDGTILRLRPRRRIDLHVALERSFASLAEHRCVDPTRDRDVPYQREGVGAALRWLGEDGAWRAAWAQHVDGDRMTAWQEVDEPRLREVELDLVGHAPTRASVQSVADGLEVAHLAPRPLASVTLDLSAVHSTSGSNPVDLRVRAKRAEGSLAEQWSVGLPVVSAELPYDVTVVVGDEPPPWIDVGYGERNVISGFDPRTDGRHGVALLPSYVCRYYGHVRLVNPFNLAPDGVIAVATVVDSRTGAPLPEALAERATEGGKLEAAQPAGAPTDRAGRLVLGGLPIGTPTEIALHLEGYESVVVTVPAGQPGDRLQLPPIALEPLEAATER
>NZ_CP036287.1|WP_145065184.1|3059779_3061117_+|histidine--tRNA-ligase
MAKIRAISGFPEWTPEQQLVENHVLDQVRRQFELHGFTPLETRAVEPLDVLLSKGETSQEVYVLKRLHAKGDEPAEFGLHFDLTVPFARYVAQNRGNLPLPLRRYQIQKVWRGERPALGRYREFIQADIDVIASENLAVEYDAEVLRTLHNVLASLPIPPVTLRVNNRKLLQGAYEALGFRELDEVLRLVDKLDKVGPDEVAKLLVKELGASEDQARSVLSIAKVRGTTPAALEAVRAMGLANATLDEGLEELSTLLENLADLPEGAVLCDLSIARGLNYYTGMVCEGQMRGYEDMGSVCSGGRYDNLASMGSNEKLPGVGLSIGVTRILGRLFSEKRLVASRATPTTVLVALDAPEARSAADAVAVALRARGIATEVFDRPLKYGKQIAYADKKGIPFVWFPTGADGAHAVRDIRTGEQTEVDPAAWEPPAEDRGVSVRLVDQV
>NZ_CP036287.1|WP_145065182.1|3058956_3059700_+|DUF3667-domain-containing-protein
MTEVPSDATCPNCGAPRLDRFCQVCGQDNVYARLRARQIVGDLLGGMFGWESRVALTVRGLLRDPGGLVLDFLRGRRVRYVRPARFALMCLALWLVLGRLLDFDPMESSGITIGATNEVAVELRAFLTRHLDLFLYLSLPLRALILKQMFRRQGLDLAEELVLVLYLEGLKFLIAVATFPLVLMGVEGMLPLQRLVALVWFIWAVRRVHAVGWWTAIWRGTLVAFLHAVGTFVLMTAVALPWVLFTR
>NZ_CP036287.1|WP_145065180.1|3057074_3058733_-|hypothetical-protein
MQPISLLLRHGSLLLAALATSSVAAAQCPLQHVTDFGGSTGDEFGRAIAVHGDVAVFSAHRKAHPGATSTGSLFVYLRDGQGQWQFSQELTAPPTETVQGFGRRVAIADDFLVTVGVGNLQGGSLVAPDAIYVFDRVGDEFTFEERIVTAAVPAAAALVRDLAADGDHFVAGFPFNPSGVGYARIYGRQSGTWSLEGQFGAFGQPPKVHGDNVDIRGERCVVTSNENLVFIYDRNTNGDWFLSEQVLLSLCTPDTDLVDLAFDGELIAVSLQVAAGAPDPGCGARVDVLAPIGSGGSYNLLQQVPQPFGTPSEAWGESIDLDEGRLAVGSSLALAAQGGAHGKVYLYQDGVTGFEPAGVLTPSWPPSNTTEFGSNVAVSGDTVAVGAYLDDSLEVSAGSGSLWSFAGVGCPDMLGVPWARSISFINASAAPSGAGRQDLLLDAGPDHAGELYLVLGSVSGTAPGIPFGGVLIPLVLDAWTLATLSAPNLPPLESTFGVLDGDGRALAALDLQGPLDPVLAGLTLHHAFVTIDAGLGLALTSASQATPLTLVP
>NZ_CP036287.1|WP_145065178.1|3055300_3056884_-|sulfatase-like-hydrolase/transferase
MHRCAPARRVAAVLFFALVGCSAPDAADHSERREARGLTSRPNIVFILADDHAIEGFGAYGSERAYTPNLDRLAAEGLLFENAFCENSLCGPSRAAFLTGAYSHVHGFRQNGNSFDPSLDTFPRRLHDAGYQTALYGKWHLGSDPQGFDDWAILPGQGNYYSPDFIGPDGKFTVSGYVSDVVTDMAVEWLREERDPDAPFLLHVHHKAPHRTWMPGPQELSLWADEDLPEPATLFDDWSGRAPAAAEQEMTIANHLWPAHDLKLPIPAGVELTGPDRWAQALLDRMSDDERAAWDAHFGPRNDAFLADPPEGDERVRWNYQRYIKNYLRSVAGVDRNVGRLLAELDELGLAENTLIVYASDQGFYLGEHGWYDKRWMYEESLRLPLVMRWPGVIEAGRREGALVQNIDLAATLCELAGTPAPTLNQGRSLVPLVAGREPAGWREAIYYHYYEWGTHNVAPHFGVRTERYKWIVYPGVEGESEAAVELFDLEADPHELHSVHADPAYAGRRAELEARLAQMRVAVGES
>NZ_CP036287.1|WP_145065176.1|3052466_3055223_-|hypothetical-protein
MQLSPIALGLVLLAVTHPSTAEASPTDVLVVSSDAALAPDFSSPQAAIDAAQPGDVVLIGPGAFEGDSLVVAKSLVLAPYPGAAGDVALSRLLVRDLQASDVFVGIGLRLENVTSALTPSVQLTNDAGVVLFQDCTILPGAAGGTPTSATLVASDCDAIVLATTTVTGMNGEDGGDHCDGGADGLQAMALTRSSILLSSATAAGGDGGALCCNCFAGGCDWLFGARAIVATEFCALVLTDSEIVGGAGDGSTEAIVAQGGSAVGGFGGLLSAGFHQCAGTANGQAVQGPYTEHASSARVLSSNSVGFAGHPQTVQLTGEPLEAVHVYASPDLLVQLDADATDLPWSLGPSELATSALLLPNGKTVAALPAATLPAGAKARLRFVQAQFVDAGGVLTHNGPPRAQLILEASFAPVPSQPAPLFAAVELDLDQSGVTSPVAVDLDADGDLDLAVAARFDDRIVWYENTDGLGNFGPAWNVASGVDGPVSLVAAKLDLGGTVDLLSVSTGDGLVRLHPNNGNGVFGAPTILTLVTGSPSAAATADLDGDGDQDLVIAEQTQDRVVWYPNISGFGFGAGQQIGGSIESPQQIRTADIDGDGDADLVVATAVAFGDSLTWFENVDGAGAFGSSQLVTDLLLPGARFDLADLDGDGDLDIAAGEYSPGSISDAAVVWIENLDGLGSFGPVVTVDPGSSTSTAIFDVAAADFDGDGDLDLFAASSEAGTDQSFLWFENTDGSGAFASAVRVETSAGLARALVAEDVDNDGDADLLATTGGSSVVLFRNLLAPLTADLVWLSLSSGGSQQLDLRAGAQSQFATFFVGGSASGVSPGTSLGGALWPLNLDAYTLFTLTAANGAVLSNTLGQLDQYGRATAAIALPAATDPALAGLALDHAFGLLDPAAPAGAVVSFVSNPVGLLLLP
>NZ_CP036287.1|WP_145065174.1|3049809_3052191_+|methyl-accepting-chemotaxis-protein
MTSSNAPEGSRPIDLESLNDADSKVLTLIEDLVELLENRVVRAEAAVGGSATACMQIDRDLVVTYVNPATVKLVHENLAVFQGLYPNVDFDDLIGTCIDVFHVKPELQRAILGSADNLPYGAEIQAGPLKFLLNISALIDADGEYIGAHLEWQDVTALRASEIATARLESAVAGSGTASMQIDLDLVITGANPATIELVSNNLSTFQKAFPSADFSNLIGVCIDDFHKDPSLQRRILGNPANLPHQAEIQVGDLRFALNISAMFDNEGNHIGANLEWQDVTEMRLKEDAAARLESAVLGSSTASMQVDRDLVITSANPATIKLVRENVDTFRRVFPGIDFSNLIGVCIDVFHEDPGLQRRILSDPGNLPYQAEIQIGELFFALNISAMVNRDGDYIGANLEWTEITERKLNEEQQRLANGAIADLVDAASRGDLATRAETSALTGQFATLVHGVNEMLDAILAPINEASAVLEAVAGKDLRARVRGAYVGDHEKIKRNLNLAVQNLDEALAQVDAGAVQVGSASDQISQGSATLADGASSQASAIEEISASLEQMSSMTSQNAESAQQAKTLAISAKESADRGDEQMLRLKEAIDTIKASSDETAKIVKTIDEISFQTNMLALNAAVEAARAGDAGKGFAVVAEEVRSLAQRSAEAAKNTASLIEGSTRNVEGGVVLTESVQAILAEINQGANRVTDLITEIAAASKEQSEGIGQVAVAVDQMNKITQDNAAGSEESSAAASQLNDQVADLIQLVGQFQMTRHGDGAEPPMTMSPDDVPGAVPSGRQSEVSSF
>NZ_CP036287.1|WP_145065172.1|3047851_3049432_+|AarF/ABC1/UbiB-kinase-family-protein
MNPGESRTASEIPSVVQTSRLRRGAALAAAGLGGLTVGRRTSEATRRKSAEHLARRLGGLRGLPQKVGQILSMGAQDSMAEPFRALTDGAQAVPLADLAPVLEQAWGRPLAEVVADIDPQGRAASIGQVHRATLLDGRDVAIKIQYPGIAAAIDSDLSLIGLIAQPLAVGASGLDQGRLRATLREALLEELDYRCEAASQIAYREACAAQSVRVPAVVEELSGDRILVSVWEEGQTIEEARAWPAQDRSALARLLVEHFLQQLFDRGMVHADPHPGNVRFRRGAGGPELLLYDFGSVYRVDAPTRLALLRLIAETFGRPEVDPFPLMVAVGFDADLLRPLRAKLPAVCRVLFTPFGAPTKFDVSGWQRSELLAGILGDDRWNFRMSGPPEFMLLVRAFQGLLYYLAELGEGVCWSRLLDPLVARHALEMGALALAEPPDPRTTFNSIARQLCIRVIEAGSVRVKVSLPVTTVDSLDDWLDGEIRQRIAARGIDLADLVRRVRSRCYEPQSLIRLEDDAKQYEVWLE
>NZ_CP036287.1|WP_145065194.1|3068237_3068987_+|ABC-transporter-permease-subunit
MSGAVAIFRRELSGLFFQPLAWVLLFLALLFNGYLFTYYVQATEGDVTEAMLLSLGQALPFWGVLCVLAPLITMRMISEESRNGVLEFLLTAPVTDAAVVAGKLLAATFFFAVLWSSVPLYGLVIDLLGTSPDWGQLLTAYAGSVLLSAFFCALGLFASTLTSTPALAAFLAFLLNIGFLLLPLLKRVLVGVVSEDLLEAAVAKVDVMTRFQSSFMVGALDTGHLVFFLAWTGALLFATVRLLETRRWS
>NZ_CP036287.1|WP_145065196.1|3068986_3070567_+|hypothetical-protein
MVARTFTRWTRASLSIQVAFAVLLSIAAAVLVIGLAEQPRFRARVDLTESGRNSLDSQTVALLESLEEEVQVDLFFRAQTGALGPPLAEVQQRTRELLFVAGEAVPGSLDVTDHDLYSREGRAAADERMRELGVSVIQVMVISIGERRAVLGVDTDLATFDPGDPNPRSYRAPSVASYRGEEAFDEALARLLSERSPRVLFATGHGEYGIDPVPAAERQTLRAASLLGAELRGEGFDVGTWDPLRDGGVPADCDVLAIIGPDQPYPANHADAVAAFVERGGGLMVAVDDGLFMRDDALSELLARYGMGIQRGIVNAPVRNPLSGSLESGFEQCALLDVSEDRLSNGHPITAPLRERGRRLRLWRSRSFERLPAPAGAVLLDLVQTPENAWRDLPDDFGRWNFIYEPKREDRSPAHLALAAQISVDGSSAVDGGLGAADDDARIVAVGAASAFDDEFVTINLDFARNAFNWLVDRDLRIRVAERDPFEARIDTRRGTAFPVLSKVALFGLPGLCLALGCFVAWRRRR
>NZ_CP036287.1|WP_145065198.1|3070604_3072416_+|DUF4340-domain-containing-protein
MHLRTTLALLLVVLALGALAWWGGDGQETDPIAQLDRPLFSGLESSRVVGLRVDFTDRELTLELERGPSGSWSLIAPVSFAADPGPVKHLLDLVTRSRAELAPLMTPDAVGLDPGVVEIEVIESLADGSTRSRSIQLGETDFDGAQVFATIRAGGADDELADAVYRVPRALLTAVDLPLVEWRERRLLQASSRDVIVFRRRGSLPEMDGSFDPAFAGELDLDFELAANQFYATAPYRARLHPSAVEPLRLAIAGARARRFLADDTSDLRPFGLEPPAFTIEVELRDGVRQRVLFGVMPDPGADPADRRWTALVEGRPVVYELNPVDVRILSAPVDQLLDYDVINVLATGVFGLELRVDGAEVGLERDNLGWTVADSAATGDEPRRADEGAVADLLGEVLSAEVAAFLTEPEQREQPVTGRVSVRLEGGEEIGADVGPRIEYRGLEGRLVRRDGEDLWGLVTVDLDGLATTDQSSLLSAYVFRLDELNQATIELAGDERSATWRRDPQQGLWSRAGASGEDREFALQVESILAPRVRRWLEVDSGAVMESALSVEIVDRAGRSQTYELGRMAVGGESLSVVRAGVRTGEIAPRLTETLVDLLAR
>NZ_CP036287.1|WP_145065200.1|3072545_3075152_+|DEAD/DEAH-box-helicase
MSLDQDPEFHRPLGVPRTPPVGAGAGPGASPSVTPRPDRGGPRRARRVHGVDRIVDALKADPELRDRFLHWHEAPPRPALVQDLPASLDPRLVAMLRAQGFDGLYAHQARAIELALAGEDVLVATPTASGKTLAYSLPVLQRMLETGGRARSLWLFPTKALSQDQSAALNARIEGLAATCASEGGEPLDWHSFTYDGDTPPSVRRTLRDRGNVILTNPWMLHQGILPNHGKWSELFRDLAFVVIDEVHTLSGVFGSSVANVLRRLVRLARFYGSDPKFLLSSATIPEPAAHARALIGRDVQVVDQDGSPAGRRIFGVYDPPLVNPVAGLRASALEEARRLAAHVCGPKHQTIFFCNRRTAVEVLTRYLKEGASRMGLSPDEVRGYRGGYLPNLRREIETGLRDGSVKVVVTTNALELGVDVGALDVAVLVGYPGSQASFWQRAGRVGRRAGASLCVMIARSDPVDQFLAQHPDWLFAAPKERLGVDPDNLVLLSEQLKCAAFELPFRAQDDSGGGEPTVGDFGDSPHLVDVLDYLAEEAGFLHRRGDAWYWMADAYPAQDVSLAGGEPDNVLVIDLETQKAIGEVDREGSITTVHEGAIYQVEGETWKVERFDYAGRRAYVRQTVSDYYTDAQTDTEVRVLRLEERRARVLEGTDTEDASLFRGEVHVTTLATLYKKIRFYTLENVGAEDIHLPAEELDTEAFVLTLSEETAATLELHQGSRGAAWSAVGGLLRRVAPLFLRCQPADLGLSSQVKSGHFNRPALFLYDRVQGGVGLSALLFNHARELIGAALEVVERCACLSGCPACVGPTQEAGVLGKETALAILRHLHGGAGFEPAEIGEDEVVHAPDDGETLASGGEKAAAESSG
>NZ_CP036287.1|WP_145065202.1|3074770_3076819_+|hypothetical-protein
MPTGGPGALLASQERPLQPASAVPLRPRPGRRGLVGAALQPRARVDRRGPRSGRTLRLPERLSGLRRSDPGGGGVGQGDRAGDPATLARGRRLRAGRDRRGRGRARAGRRRDVGERRREGGRGELGVSGGDFRAKLRRLRREEPAQAAAGGPGAAEASAVGAPDPGTGGEPTGDRATPVADPGLGGALDGAEGTEVEQAAGGTAERAELVVRSDSTDERVPAVSPRLVVPTGPAPRGELPSWLRSHLGRGARPISSGGSIDPPAGLEPVLVDGVPSRAVARTTRFEPDHRHGAWRLEAVHGADCACLSFVARDPAVAEFDSSRAVFLDIETTGLSGGAGTYPYLVALGSFAEDGRFELWQGFLREPDEERDLLREVARRVASAGQLVTFFGKSFDRHRLEDKMRLHGVAAPFESVLHLDLYHPCRRLYREGFVDGRLQTMERGLCGFERVDDLPGSMAPAAWFDFIGGRPHQLERVFDHNRDDVLSLVTLTAHLGRTVLERDADGGELEGCSLARARGMGKLAGAAGERAAELQWVERALERLEHTRGDRDHARREHLLWRAATIERLGDRARALELLVELAQERLDANAAHAWARASKLLEHHARDFDGAVEACDRASSLAARTLLGRERRMLEAEVSKRRARLEQRQADPRANSTRADGPGPDSRRTDEPRPADSEPAPN
>NZ_CP036287.1|WP_145065204.1|3076910_3079475_-|hypothetical-protein
MIDPMSTDDSRAGSIRPALLVVLAILAVLVVAVISNLGSSAAERETAAPEQPGVGPARLSAPSAPSVELEAPVGALVERTVVVGDQSFSGEDDGVAATPDDLPRFSLRGQLIDEFGQGLEGIELRLESVGEPWHLTPPAGFDPDQPLVAETDAEGRFALGTILPTSSWVALTAASPPMRAQLRRDFGRAGGRNEPPLQAGENDLGRIELAECGLLHGLVVGPDGAPVEAARIGVAGPGRGQRVRSGPDGSFVLEHLPGGSHVLSADCEGFLTREFESVEVQPGRTCEQPTIVLEIAPTIAGRVVDASGRPIAAAQVWGVPERGGYSISAEADDQGHFEVSLLVDRRYGLTAGRPDQTPPMWDGRWQEFPPGAREVELVVADKPSFRISVQDAEGQAVEEFGLRVIQVRTTSGGTIHSSVFGTPAAVVPHPGGSAQVQADPEVDDFTVFAPGFVLQRGTFDRADAAGHLVVQLERQSGIRGRFVHEGRPVPHPMVSVRADRIPKVPGAPEDRYDIFEADTRRDLGDVQGSERSLRGSADGTFEVEGLAAGTWELELRGPGAPTTWVELLEISRGDVLDLGDVPSSPGAALGGTIVVATGHSAEGLRVGLGSENYPDDEPFTETDPAGRFEFTGLRPGRYHLWVHAAPGVLDENYRERVDLGPQERRELLVDLTAGATVEARLAVRVDGEPAAGFGVWRLQQIEGESAADELGKTDANGRCVAWVKDGSRLRFDLRNGRGLSVGVSREFEVRGALDEELDFETGALTVHVPAESTLAEGEPAPLAIRSSDTDAPRSFFTWLTPRADDRTLEGDWSINLGPIAPGTYTARLSREPTRLSTTFEVVAGTTTEASLQYE
>NZ_CP036287.1|WP_145065206.1|3079543_3080167_-|phosphoribosylglycinamide-formyltransferase
MSPSRIAVLISGTGRSLENLLRVCAAGELDAEVGLVVADRGKLRGLEIAEAASVPTQVIRPRDCDGPEDFSAQVFDAVEAAACGTVVLAGFLRHLPIPAGWLGRVLNIHPSLLPAHGGKGFWGDHVHRSVLEAGDAVTGCTVHYVDNVFDAGPIILQRRVDVRPDDDVHSLAGRVFDEECIALPEALRQHLAGEVRFVAGRVVRGDG
>NZ_CP036287.1|WP_145065209.1|3080163_3081711_-|purine-nucleoside-phosphorylase
MASTVPGPARRRSQRGRGARRDLVGPGPRHGRRRSANAALVRLRRRHGRPAAALRIAPTARIRHGRADRRRHAAARRRGQRGPGPGGSRARFRAAVSAQPFRGATDCRRLRASHGLGCPSGRRGRGRRGGRSPRRLPVERCPASPRRGRLDQRGPRLRDPARAGDHLPARDDPLRRASARGTRPLAADAARRGRSRGDASAGSGHSRGRSRVDRSPPHERGPPLIASPPNLDDSVERLRAQLDEHDVPAPRALLLMATGVGLLPERCSASTSVPLAELDGVPAPWTTTTLVAGRLGPLPVWVLDDLSGEALDDGGPDWRRALPVWLAAACGAQVMVHVSAGVALGTGAAARASGLALASDHINLSGRSPLTGLGTTTLGPLFPDQTTVHDRELRHAALEVCTENGIEAREAVVACTAGPSLDTPAECRYFAKAGADVAVQSAAWPYIAAAHAGLSSVAIVALAASAEERVDLRRILERAERSAPAIEELIVHLAGPIARQTDHDEGLGTPRPRRS
>NZ_CP036287.1|WP_145065211.1|3081038_3084251_-|protein-kinase
MSAARSDRLVVRAPDGRTAEIPPQGRLVVGSAPGEGGFELAGVGVAPEHVALAAVRGGGHGVVALDDGATTEIDGHPVRKARLHAGTRLRLGSVELTIEARGAAPAERARPAAAATAAATATAAATAAANANANATAASRGAEVDVTGFRVSKLLGKGTMGLVYLAVQESLDREVALKLLRRQLCENADFVARFQAEARAAAKLAHPNVVTVYDVGEDKGQHYLALEYMQRGSLEDRLAAEGPLPWRAVLGILRDAAAGLEFAEQHGIVHRDIKPANLMQSAAGATKIVDLGLATAAEAESDGKIRGTPHFMAPEQARGMAVDARSDLYALGATAYRLLSGKTPFEGASSKAILRAVVQDEPRPLTELVPDLPPPVAALVHGLMAKDPDARPRSASVLRARVEELASAANSAGGDGSQKGSKLGLVVGALVLLAAVAIGVVLLTTGDGSSSNGDGGSIDGERNGRTEVADLTSTNDPQPSVDASEDPGAEVGEPDTLDAAEAEAQLQRFEERAAAALLATESLVDPVERTEALHAVSAEFPGTTAATVALARAKELQQPEQSTAATDDAGSTGVSVAQTLLATAEAATRDADGALLAPELALAALAGVTLPPGYVADAEYFEGYAALREKVSTQLRAEADSRLVPIDALLTAGDFEAAKAGYEELLAWLTEQPPAKSGAKSPAAPAVGKTDGNTEGGSGQDGQDGVAGRGDDAPATDDDNAEASELPQTPEELREQLGGSAGTTAWALPARVTLVRSRLATLPTWIEAHALAMRQADRALVARTLPAGKVERDLRGFDFAAAATAVEALAGQARSPEYGEALADLARDLRAAPSAFATLARAWSEGEWRRQSLALPGADRSVVEARGVISSGLVLGTGDGDPQTLPWSAFAADTDALQQLYESRLQREFVTAELTAVATLLRVAAVNEALVLADPVLDSERQSRLSPSEARQIADAFARATDWGARAGGEAEAAAAAEAHAGSLLSAALRALDEDDWTSAAHAFETLLEQETTSLLVMILSDGRPLEEPAHWPPTLPGVDEAAAMQAQVPVTPEDEAESTDPPPTNEDPR
>NZ_CP036287.1|WP_145065213.1|3084247_3085228_-|YggS-family-pyridoxal-phosphate-dependent-enzyme
MRRGRAGGLRTGPPAPITGPRPAPRRRVPPRPQRQGPGVAPRGDFTVLGGYPRRPATGGRQTRRDPLTTPRRPDRPAPDLALALAQNLERVRARIERARRTATRSGQARLLAVTKSVEPEVALALARLGQLDLGENRPEGLEAKRRLFDAELESGQSEGGRRVRWHFIGHLQRNKARRVARLADEIHAVDSVALARTLSRVCAEEGLRPRIYLQVRLTDEATKHGLDPSELPQAIEASDPSCLDLAGLMTMAPLEDDPQRRAESASRTFGRLAELAERHGDAPWIEGRALLSMGMSDDLEQAVDQGSDWLRIGSALFVESAQEARR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP036287_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP036287_3

4999934-5000113

Orphan

Consensus_repeat	Method
ATCGAGGTCCCCGTCCCCGTCCACATCGCCGAG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP036287_3

>merge|NZ_CP036287|3|4999934-5000113|PILER-CR
ATCGAGGTCCCCGTCCCCGTCCAGGTCGGCGAGGACGGCCCGCGAGATCGCAGCGATCGAGGGCACCGACATCTGCACCGGCGCGAGGAGGTCGCCGTCCCCGTCGTTGAGGGAGAGTCGGATCGACCCGGCCGATGTCTCGAACCGATCCAGGTCCCCGTCCCCGTCCACATCGCCGAG

>NZ_CP036287|3|1|4999934-5000113|PILER-CR
ATCGAGGTCCCCGTCCCCGTCCAGGTCGGCGAG	GACGGCCCGCGAGATCGCAGCGATCGAGGGCACCGACATCTGCACCGGCGC
GAGGAGGTCGCCGTCCCCGTCGTTGAGGGAGAG	TCGGATCGACCCGGCCGATGTCTCGAACCGATCCAGGTCCCC
GTCCCCGTCCACATCGCCGAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP036287.1\|WP_145067940.1\|5003336_5004254_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036287.1\|WP_145070981.1\|5012603_5014967_-\|ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|235966
NZ_CP036287.1\|WP_145067934.1\|5000406_5001846_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226584
NZ_CP036287.1\|WP_145067922.1\|4989994_4991350_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225181
NZ_CP036287.1\|WP_145067912.1\|4979911_4981852_+\|sulfatase-like-hydrolase/transferase	unknown	unknown	gnl\|CDD\|293767
NZ_CP036287.1\|WP_145067942.1\|5004487_5009062_-\|protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP036287.1\|WP_145067938.1\|5002580_5003192_+\|YceI-family-protein	unknown	unknown	gnl\|CDD\|179642
NZ_CP036287.1\|WP_145070979.1\|5009834_5010659_-\|SUMF1/EgtB/PvdO-family-nonheme-iron-enzyme	unknown	unknown	gnl\|CDD\|335469
NZ_CP036287.1\|WP_145067918.1\|4984782_4986543_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372673
NZ_CP036287.1\|WP_145067930.1\|4996682_4997570_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP036287.1\|WP_145067924.1\|4991555_4993616_-\|Zn-dependent-oligopeptidase	unknown	unknown	gnl\|CDD\|341050
NZ_CP036287.1\|WP_145067914.1\|4982095_4982626_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036287.1\|WP_145067944.1\|5009079_5009739_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274375
NZ_CP036287.1\|WP_145067928.1\|4994434_4996678_+\|carboxypeptidase-regulatory-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|379297
NZ_CP036287.1\|WP_145067948.1\|5016331_5017582_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036287.1\|WP_145067916.1\|4982622_4984710_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036287.1\|WP_145067926.1\|4993712_4994435_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NZ_CP036287.1\|WP_145067946.1\|5011330_5012329_-\|ribonucleotide-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|153108
NZ_CP036287.1\|WP_145067920.1\|4986759_4989981_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|214549
NZ_CP036287.1\|WP_145067936.1\|5001908_5002328_+\|YjbQ-family-protein	unknown	unknown	gnl\|CDD\|223509

Protein	Function_ID	Function_description	E-value
NZ_CP036287.1\|WP_145070981.1\|5012603_5014967_-\|ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|235966	PRK07207, PRK07207, ribonucleoside-diphosphate reductase subunit alpha.	0
NZ_CP036287.1\|WP_145067934.1\|5000406_5001846_-\|hypothetical-protein	gnl\|CDD\|226584	COG4099, COG4099, Predicted peptidase [General function prediction only].	2.24293e-34
NZ_CP036287.1\|WP_145067922.1\|4989994_4991350_-\|hypothetical-protein	gnl\|CDD\|225181	COG2272, PnbA, Carboxylesterase type B [Lipid metabolism].	0.00452628
NZ_CP036287.1\|WP_145067912.1\|4979911_4981852_+\|sulfatase-like-hydrolase/transferase	gnl\|CDD\|293767	cd16148, sulfatase_like, uncharacterized sulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.	4.91846e-71
NZ_CP036287.1\|WP_145067938.1\|5002580_5003192_+\|YceI-family-protein	gnl\|CDD\|179642	PRK03757, PRK03757, YceI family protein.	1.06657e-56
NZ_CP036287.1\|WP_145070979.1\|5009834_5010659_-\|SUMF1/EgtB/PvdO-family-nonheme-iron-enzyme	gnl\|CDD\|335469	pfam03781, FGE-sulfatase, Sulfatase-modifying factor enzyme 1. This domain is found in eukaryotic proteins required for post-translational sulfatase modification (SUMF1). These proteins are associated with the rare disorder multiple sulfatase deficiency (MSD). The protein product of the SUMF1 gene is FGE, formylglycine (FGly),-generating enzyme, which is a sulfatase. Sulfatases are enzymes essential for degradation and remodelling of sulfate esters, and formylglycine (FGly), the key catalytic in the active site, is unique to sulfatases. FGE is localized to the endoplasmic reticulum (ER) and interacts with and modifies the unfolded form of newly synthesized sulfatases. FGE is a single-domain monomer with a surprising paucity of secondary structure that adopts a unique fold which is stabilized by two Ca2+ ions. The effect of all mutations found in MSD patients is explained by the FGE structure, providing a molecular basis for MSD. A redox-active disulfide bond is present in the active site of FGE. An oxidized cysteine residue, possibly cysteine sulfenic acid, has been detected that may allow formulation of a structure-based mechanism for FGly formation from cysteine residues in all sulfatases. In Mycobacteria and Treponema denticola this enzyme functions as an iron(II)-dependent oxidoreductase.	1.03174e-30
NZ_CP036287.1\|WP_145067918.1\|4984782_4986543_+\|hypothetical-protein	gnl\|CDD\|372673	pfam13688, Reprolysin_5, Metallo-peptidase family M12.	4.48567e-16
NZ_CP036287.1\|WP_145067930.1\|4996682_4997570_+\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	0.000248186
NZ_CP036287.1\|WP_145067924.1\|4991555_4993616_-\|Zn-dependent-oligopeptidase	gnl\|CDD\|341050	cd06455, M3A_TOP, Peptidase M3 thimet oligopeptidase (TOP), also includes neurolysin. Peptidase M3 Thimet oligopeptidase (TOP; PZ-peptidase; endo-oligopeptidase A; endopeptidase 24.15; soluble metallo-endopeptidase; EC 3.4.24.15) family also includes neurolysin (endopeptidase 24.16, microsomal endopeptidase, mitochondrial oligopeptidase M, neurotensin endopeptidase, soluble angiotensin II-binding protein, thimet oligopeptidase II) which hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A. TOP and neurolysin are neuropeptidases expressed abundantly in the testis, but are also found in the liver, lung and kidney. They are involved in the metabolism of neuropeptides under 20 amino acid residues long and cleave most bioactive peptides at the same sites, but recognize different positions on some naturally occurring and synthetic peptides; they cleave at distinct sites on the 13-residue bioactive peptide neurotensin, which modulates central dopaminergic and cholinergic circuits. TOP has been shown to degrade peptides released by the proteasome, limiting the extent of antigen presentation by major histocompatibility complex class I molecules, and has been associated with amyloid protein precursor processing.	0
NZ_CP036287.1\|WP_145067942.1\|5004487_5009062_-\|protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	2.95169e-79
NZ_CP036287.1\|WP_145067944.1\|5009079_5009739_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274375	TIGR02984, Sig-70_plancto1, RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are apparently found only in the Planctomycetaceae family including the genuses Gemmata and Pirellula (in which seven sequences are found).	1.62966e-23
NZ_CP036287.1\|WP_145067928.1\|4994434_4996678_+\|carboxypeptidase-regulatory-like-domain-containing-protein	gnl\|CDD\|379297	pfam13620, CarboxypepD_reg, Carboxypeptidase regulatory-like domain.	2.27772e-07
NZ_CP036287.1\|WP_145067926.1\|4993712_4994435_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	5.13981e-29
NZ_CP036287.1\|WP_145067946.1\|5011330_5012329_-\|ribonucleotide-diphosphate-reductase-subunit-beta	gnl\|CDD\|153108	cd01049, RNRR2, Ribonucleotide Reductase, R2/beta subunit, ferritin-like diiron-binding domain. Ribonucleotide Reductase, R2/beta subunit (RNRR2) is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. The RNR protein catalyzes the conversion of ribonucleotides to deoxyribonucleotides and is found in all eukaryotes, many prokaryotes, several viruses, and few archaea. The catalytically active form of RNR is a proposed alpha2-beta2 tetramer. The homodimeric alpha subunit (R1) contains the active site and redox active cysteines as well as the allosteric binding sites. The beta subunit (R2) contains a diiron cluster that, in its reduced state, reacts with dioxygen to form a stable tyrosyl radical and a diiron(III) cluster. This essential tyrosyl radical is proposed to generate a thiyl radical, located on a cysteine residue in the R1 active site that initiates ribonucleotide reduction. The beta subunit is composed of 10-13 helices, the 8 longest helices form an alpha-helical bundle; some have 2 addition beta strands. Yeast is unique in that it assembles both homodimers and heterodimers of RNRR2. The yeast heterodimer, Y2Y4, contains R2 (Y2) and a R2 homolog (Y4) that lacks the diiron center and is proposed to only assist in cofactor assembly, and perhaps stabilize R1 (Y1) in its active conformation.	1.56414e-100
NZ_CP036287.1\|WP_145067920.1\|4986759_4989981_-\|hypothetical-protein	gnl\|CDD\|214549	smart00191, Int_alpha, Integrin alpha (beta-propellor repeats). Integrins are cell adhesion molecules that mediate cell-extracellular matrix and cell-cell interactions. They contain both alpha and beta subunits. Alpha integrins are proposed to contain a domain containing a 7-fold repeat that adopts a beta-propellor fold. Some of these domains contain an inserted von Willebrand factor type-A domain. Some repeats contain putative calcium-binding sites. The 7-fold repeat domain is homologous to a similar domain in phosphatidylinositol-glycan-specific phospholipase D.	6.00384e-06
NZ_CP036287.1\|WP_145067936.1\|5001908_5002328_+\|YjbQ-family-protein	gnl\|CDD\|223509	COG0432, COG0432, Uncharacterized conserved protein [Function unknown].	3.05505e-56

>NZ_CP036287.1|WP_145067930.1|4996682_4997570_+|hypothetical-protein
MNPLSILGLGALTGGLAAAGVVLVLRPSPVVESSSPDESVLALRAIEQRLGAMESAQAERDAAFASLEARVDMRLASAARQVVPVATAGPASADEPAAGLAPPAVAVDSEAAVDALMAQILAANFGDVETAELWKRAIDEGLIDELVARFEARAAADPDNPDAQVELGGAYIQKIQEVGNSPLAGVWATKADGAFDRALELDEDHWGARMSKAVSLSFWPPIFGKQAEAVNQFEVLIDKQKQMPLDPSHEQPYLLLGNLYWQRGDSAKALAIWEEGLGFFPGSKDLSGALANHHD
>NZ_CP036287.1|WP_145067928.1|4994434_4996678_+|carboxypeptidase-regulatory-like-domain-containing-protein
MARGASGDGDRRGGDVLERNVERLLRRAWRPVEVSPDFRASLERRFVERAAQRWAPVVERPRYSAVGWAILAAAAALALLLGAGALLDGAAAPGGVGSGNDLALSDPGSTLGDGQSAGSPAEAADEADEIGSPRDFLAGLLDSVGDRRRLPAIPGINADGADEATDAASGEAEDPARLSIELSLPQGGPQPSSVRAVLLRSAQLPDVVDPILLPAWGGDEGSEAPDTTRRRTFSELDAGRHTLHVFAGGYAPWRGEVDLRPGGLLEVDVQLELGGRARGEVLDAATGAPIEGALILSEEDLPLQVIDAGLDRERDREVPAVVARSDAAGAFELAPLSTGKHRLRATAPGHAPVWIEVEIGARAAEDLRFELPAGGTVFGRTADEFGRPRVGAVVVSSYFESPGGTRKGFYGAAITDERGEYRIDGLPAGIHVVLLFETSEPEAPSAMLPLVLPAGGQRRVDFVPHDNGVALSGIVVDALGAPLAGHVITLSRSHVLESDAAVGDDDGIASWSAVTTDGEGRFRFERVAPGEYALYGAPKAGSEMVLYDEVDLRAGLDRSVRMSVGSASLGGRVTAADDGSPVPDSTLLLLCDDDRGRLVFAGRQLTGADGRFAFDGVRPRDYRLLVVPARPDLAATLVEDVRVELGVERTTLELTLEPGGTIEVECRDLEGRPIADVDVDLIDAGGLEVFDDGRFRTGPDGLSVIESVADGRWTVRVQAPGFARAERTILAVAGQTRRVEVTLVLDE
>NZ_CP036287.1|WP_145067926.1|4993712_4994435_+|sigma-70-family-RNA-polymerase-sigma-factor
MDGPRRNSPLGAKDSRRQGHVGGVQPPAPTPGASPDSPAAAPDATHADDLRLRDAVVGGDAQAAEDLFRRHFDALHDFVHFRAGSDRGAVEDLVQETFLVALDRLDRYDGRSSLHTWMCGIAKNKLRELRRRRRPRPIADLLEEADDEIDAILSRIHHEELPESVLERAETAELVGATLSSLPPDYREALTAKYVDGLSVREIGARGGRSEKATESLLTRSRTAFGRVFSLLANRRGGLA
>NZ_CP036287.1|WP_145067924.1|4991555_4993616_-|Zn-dependent-oligopeptidase
MRRPLSRVFILSSLALAAACAGTPVGEGPEARAMASAADDLQPSMAAAFERAKASIDTIAALPDDRRTFENTLDAVDATIATLFREVRFTGFMKDVHPDPAVRAEGNEVDAALSNWFNELMLNEGLYNAVRAYADTEPALEGERARLLSEFLRDFRRAGMELDEAQRARVGELDRQLVEVGQEFQENIAGDETLVALTADELAGVPADVLASYARSSDLYLVDMAYPSVLPIFQRCTVPETRHKVSLAFSRRGGEANVRVIERMIALRHERAQLLGYPTTAHYETEVRMAKDPETVMAFYAELTPKLRRKSIEDVAEYTAAKREDTGDPEAVLNPWDRSFYHDYLMRTHYAVDQREVQQYFPIEAVLGGIFDLTQEIFGLRFVEVTELAAERGRPLWHPDVRLFDVFDSASAEKLGEFYIDLYPRPGKYSHAAQFPLTLRKVHPDGTVELPVVALVCNFTKPTADAPSLLTHGEVETFFHEFGHCMHSILSDVDLAWFAGTQVARDFVEAPSQMLENWIWNADVLNRFARHHETGEPLPAELLEGLIAAKNLGSGYSNEYQLYLGQMDMAFHMDPDGDVDTAAVAHEVYARSCLLPWVEGSLGYASFGHLNGYQAGYYGYLWSLVYAQDMFTPFADGDLLDPELGQRYRHTVLARGGTVDAIDLVREFLGREPNSDAFLEHLGLGE
>NZ_CP036287.1|WP_145067922.1|4989994_4991350_-|hypothetical-protein
MFNDQSRRPAEQLRGFLRPLVALSPIAALVGACFCALGSTAAAQNYDAQINYDQSAQPSDPDYEETLANLWYPAAKGLPALGFPVEPLPVMVSVRGGNTNNITVGTGNPDELTNLSNDFGFLHVDCNYPLVGPTEDYHVASAGLGLMIQWLRGNAAEYNINPEQIFIQSRSFGTIAMYPVALREDFAVPGSADPVLVQSSRPDYYIPRLGPSTLTCFSTQAGPWDSTMSVFFFPGQTFDQGTPEQRLEESAYWSLLNPHLYDRQRTPPMCVVYKAAHTDVCGQVTDVHSGLFGDVMLEAIEDFVELTGDREFGQRSSSIDISSMPDATGAIVAWAVKRLAADFDGLWLVPPTGMVGSTGGDISLTVFGAKAGATLAYYTGTTAGTFPMPGCPNLEGQITDFTLLGTAPASPAGVGTWTFPVDASSVGQTALFHVVDFGNCVMSNVSSHVYF
>NZ_CP036287.1|WP_145067920.1|4986759_4989981_-|hypothetical-protein
MILPIRSTLVAGLILAAPQAGLGQDLVQQHLFTFRGKALLDHAGSSVAVLGDLNGDGRAEVVVAAPRPITGTVGYVQVYDGATGAPYYRIDGPTLADGLSDRFGEALAVVPDINDDGIADLAVGAPRDDDNGAESGSVFVYSGLDGLELHQYVGLPGERLGAVLALADLDGDGRDDLVASTPGTQAAVGFSGAWLRSTAIAEAPSASEVLLVVSGPGSFGTSIAGLGDLTGDGSEEFAVGSPAFDALGGLLPDAGAIDIYSGSTGTLLYRIEGSQAGAGLGTSLARIPSVDGDGLDELAVGSPWFDGVAGEDCGRVQLYSGDWLRQSAQGGSPAGTPTLWVVQGTTALDRFGYRARNLGDMGGDGIADVGVGAPRTGNVTNGGAARVLSGIDGTELFAQGGGAGSLTGVALASGDVNGDGELDLVVGQPRDGGEGYGLAKVVSSKELRLTADRHSLSVNDGGTVHFDLQGTPSLIGHLYVLLGTASGTSPGLPTPAGVLPINFDGYTNYTLSQAPELGGFFGFFGAGTHAQASIFLPAGTSPSLVGVKLNYAWATLDMGTPGFPTTAVSNAVPLGFETDTCVAVGGLGDCNGNGQLDACDIADGTSIDCNQNGLPDECELLVAGADVDLDGILDVCQSVVYVDASATGAKNGTSWANAYTDLRAAMSLAPEYSQVWVAVGTYTPWPNDQNHGASFLLRDTVGVYGGFVGGETSLSQRDWVNFAPTLSGDVLFDDFAPGGGILDNSWNVVGAGTNAGPTAVLDGFRISGGNAVEVLGCDVFAVYFSSCRGGGLYSEGAPTIRHCVFESNFGGHHGGGAYTLRDTRFIDCEFVANVAIRGGGVYSDVGAKPTFQDCVFRQNNAQFGGGIFATGIASAGPLLIDCLLIGNNSAEGGAAAYAEVASINLVGSTVVHNRSQTTGGGVFSTFGSSVALRNSILWGNRGAGGVGGQAEQMQSAGGLPNIQWTTIEGWNGSLFGISSDGNNPLFVDIDGLDGIAGNADDNLRLAPGSPARDSGNSIIVPTDVFDVDGDGDKSEPLPLDLGGNPRVVNDPLAPDTGVAGTLGAVVDRGAYEG
>NZ_CP036287.1|WP_145067918.1|4984782_4986543_+|hypothetical-protein
MTIRPLIVGAAALVALPAYAVQDTAPAAIDLWRADPDETSPAALAALAEDSTVLRWRPIELIGAEALVPVSNARIALELFDGRRVEVDLERRAQPRPGSASFLGAIGAAGDHLALALVDGAAEGTLWLDEHLFAVTNLPDGQAVLVERTLTAPGTCALGPEHHVDTLPTQGAARRLRRAEDPSTDPGGPLTDTPDFNFVDVVTAYTPEARQAQGGTAQILALIDLAVLETNVAYDNCGADLVLRLAYSGEVVYTESGSMSTDLSRLRSKTDGYMDEVHSWRDVYGGDAVALIVSGGGACGVAYLMTNVSPGFQSSAFSVTARGCATGYYSYGHELGHNFGCAHDRDNAGSSSHSFGYGYRTPNNLYRTVMAYSPGSRKPIFSSPDHFWNGYVMGAAGTEDNAQALTLNAPTVAAWRDAVIEVADCNSNGIPDGIEIADGLVADIDGNEIPDTCQSLTVDKLELSLVLGGTQTLSFDAGPARAGDIYFVLGSLAGTDVGFPLGLVTVPLNQDVYFDLTLASPTGTLVQGGAGVLDGLGRATAAFVLPPGVGQFQLTLTPVNHAFVVVNDQLVPDLASNPAPAQFIVF
>NZ_CP036287.1|WP_145067916.1|4982622_4984710_+|hypothetical-protein
MIALARLRLAWAALALLAALVAPAQADLVISGSARYVDREFSFDSGFTGVEPELPVRFATVRVIEAASGAILAVSATDASGDFSIPIVGSGQMDVIVRVVARSEAFGAAVRVTNVANQVYSMATPTFAGWDLSTDLDIGTLVSPKVFAAGRFGNPFNLLDQFVVGVGAAQAIGAPSIPQDLQMTWPAGPVSFSSGTESSIAADDGYDDLVALHELAHLLYHLFVDEDQQGGSHSFGESDQDPRLSFTEGWATAFAALARDLAGFDDSGFYLDASGTGATGPASIQLRLRLEDGSPFIGSTEGEANEGAVACTLWDLVDGAETRGPVPGGDDDPVDGSFEFEGGLDGAQLLWRALEGTVAAAQDATVLDLWHGLFAPSDPGHGAELVEVVTAWKLGFAADAAEPDDGLAAARLLDVGGGWSVTRTLYRPPPGAYAPGDGDGDFHRFTLSQGQGFEVSTRYPGGNPDAGTFVDPLLRVRRPDGSLFGQDDDSGVGRNALVAGIADADGEWYAEVSTQHPFRRAGSYEVRVDLAGSDCNGNGIPDEQDVLAGTSLDLDGDGGPDECQPLSADLGSLPLLFGGTQTLSLDAGAAHAGQLYWILGSTTGTRPGIAVDGVLLPLNVDAYTGFTLANPGFAPLIGGLGSLDAEGKGTAQFALPSGVSLSLVGTVVNHAFFVVGGSQSLVFASNPIPITFTLF
>NZ_CP036287.1|WP_145067914.1|4982095_4982626_+|hypothetical-protein
MCAVAAVMLSSASLQSGSPAREGRIPSVPVANEPEAPLAVEIHLDPLQGGRARVRYEVSPLVQCLDASVELRPSSAARVVEHVAPPAGPRARRESVQGLALVEVDGPASLELVFRIALADPGGIDGRSTFSIERQVLWGELPVVDSTQLVYEAGEVTAQVPSILRPRAAVAGGGER
>NZ_CP036287.1|WP_145067912.1|4979911_4981852_+|sulfatase-like-hydrolase/transferase
MDRHGAAGPRGGSLCRGRAALDRGRGLRRALRSPGPRGQDGARLGALIHGQHLGHRRSHRPRRGRPGPGRAARLGSRGRCRADAARTQGAQGRPRGPARQGLGSRGEGRGRLAQAQPARPRGGSDRRVGRRTRSPRGALPDRARRADSDGLGRRRLRRRGRRGRVGRAAPGPLARPGVLPLVERARLRAAAPALLLLLGACAPSGGEQPSPPPRLVLFLVDTLRADRLTPYGHDRPTSPNLERLVARGAVFDQAWSPAPWTLPATASLLTGVDPDRHGAGLHGSWRDLASQVPDGLAADVPTLAERLGDEGWRCEAFVTNPFVGFGLERGFESFTLRQTEAAEVLDWTLERLDVPGDERPTFLLAHLIDCHDPLLIPDEFVLDARPPGDRLPVPDISNRTFSTLAMTPEHRAARLRLYDGAVRYVDAQLGRLLDSLEADGSIDDTYLVFTSDHGEEVFESAALARGAGYVQPETVRPLGHGHTLFEEVLRVPLVIAGPGVEARGLHVPGAVATHDLVPTLLELLGVDHDPAELDARSLVGTLRGEHADARAVVSRGIAFGRDRSALLRDGWSLVRGGEGEATVLLRVGDPEHLDRSAEEPDRLLELGADLDALNSLAQSRRGSATQIDPAQRARLRALGYLDRDQE
>NZ_CP036287.1|WP_145067934.1|5000406_5001846_-|hypothetical-protein
MTIAALALVLASCSPQDPAPALIPVPESVYLEGAVEVDGVRTPYLLLPPAELVEGRRYPLVLFLHGAGERGDDNRNQQHHFPERMAKAENRAKYPCFVLAPQCPEGQAWTTFTDGFRALEPGAPATPAMRGAMAALREVVGTQPIDTDRIHLTGLSLGGFGTFDLAARRPDWFASATPLCGGGLVENAPDMAGLPFSIWHGADDPMVAVGQSQRMVEALRAAGAEVDYHELPGVGHDVWNQAYGSEGCLDWIFAQVRDPKAQLAAAARLFAEACAPDERVAFLGDSITEAGNAEEGYVDLLRRALAEHRPEAQVIPAGISGNRVPDLLARYRKDVVDEGATLVFVYIGINDVWHQEWGGGTSIEDFEAGLRELVDGLEQSGATVVLATPSVIGERRAGTNRHDGKLDDYAARTRLVAAERGLVLCDLARRFADELALHNLDDAAQGVLTSDEVHLNPAGNRLVAVAAARALRRAAAARD
>NZ_CP036287.1|WP_145067936.1|5001908_5002328_+|YjbQ-family-protein
MKSHRQELTFEVPERRGFLNITPQVEAAVRASGVREGLCLVNAMHITASVFINDDEAGLLHDYERWLEQLAPHAPTSHYRHNDTGEDNGDAHLKRQVMGREVVVAITGGQLDFGTWERIFYGEFDGRRPKRVLIKVIGE
>NZ_CP036287.1|WP_145067938.1|5002580_5003192_+|YceI-family-protein
MLNRLLLAGGALVATAAALLIAPAPAVAVAPVNTEGATYDIDAGHSSIHFDVEHLGLSRAWGRFNEFEGSFTSGEKAADMSVELTVKTATVDTNNPKRDEHLRSADFFNAAQFPEMKFVSTAVKKKRDGQWDLEGNLTMLGTTAKVAAELTMVGSGEDPWGGTRAGYTATFTVDRTDFGMDAYEGTLGNEVNVRVDLEGVLRK
>NZ_CP036287.1|WP_145067940.1|5003336_5004254_+|hypothetical-protein
MPTFEQLLQGVPTGDALIWASILPFLLGLFLVALALRRTAPGGSTAWGASLALLGAWIAIHIAVWGPPPMPPVMAYDWLIVGVPLAALAALWTAANRDRRKLGLAIQVVAAVTLAGLTLWPRLRVAGWGPWENTWRSAVLGGAILVAWLGALRGAARRPARESLGLQLATASCAAIAVGMSGTQNMAQAAGGVAACLAGALLASMRQADGAGRLALGSAPIAAAAVGGLLLNGHLFAYVELRVFLLCLAPLLLAPAGALLWPNKRGLIADALRVLVLAAPALLGAALAVMTFQAEAATDGSAGYY
>NZ_CP036287.1|WP_145067942.1|5004487_5009062_-|protein-kinase
MPTDDIDEPDDAELIFASWAVAAEAGEAPAFEEVLAEHPALADDLTRYHADWKLFAPLLGRAVPGLVRDGAGIVLSPLSGAGDDDRDSGQPPSDELLDRLGIHAPNSGRYRFRAVIGRGGGGVVLKVWDTKLNRPLAMKVVLGRGEESPEGDTPRVDGRTLTRFVDEARIASQLNHPGIVPVHELGADESGRAFFTMKLVKGEDLATVFEHVRSGAHGWSQPRALGVLLRVCESLAFAHEKGVIHRDLKPANVMVGRHGEVYVMDWGLARVLGEPDVRDVRPNATGRPHASAVDSLRRPELDTPLDSPLLTMDGDVIGTPAYMSPEQARGEREAIGPRSDVYGVGAMLYELIAGQVPFVPAGARVSPYTVLMRVLEGPPRALAEVAPRAPLELVAICEKAMARDAAERYPTIQALAEDLRAFLERRVVAAFESGTWAESRKWLLRNRTLAAAIGLSLVAVAVGLTLTTLQKHRADALVELAAERQSRLREQQYVALVNSAGLALERGFGSQEVRRLLDAAPQELRGWEWDFLDAAIEDYRRSFGGARPARQIEYSPDGSLIASRTDDGIQCWDVDSGNLLANFEVPVLSDGEFAFSSDSSTLAVAAKDGRVLVWSVRDDRGPLWLDLAIGPASEPETSATDRKERQGPTRCSFRPDGRELLVWDSHGVRRWDAITGQSLGALGLDAGSERVAGCGYLERADSFSPTAVIEGKPELREGGYCVRFRAQDLDFSSPIAVGEAEAWNIDRVQFAGDNSRIVVLAGGRSAQVLSSGAQVWREVDLVEGERSAIDSLLSDDAELAVTLAGNQELFVRDLTSEAAARRLFAVEKPVALEAVSCNGRLVAVSDESQGVVIVEVDTDTQLRRLEGPLNDLSFSPGGTELVGSGLSGLMVEWDVCDARLSTIGGYERPVKAFAFTPDGREIVAISDSGGEGNLMGEVWRLVDGNCRLRFEVDGTQHGITWMSEAALVLSPDGRFSAVNGAYGRTLVFDLGDGAPVAVLNWIDDPPIQGDGSMVEEMYPVAFDGGSSRLATLRPSHGVGEVWDLSSKQMLRRLQYDFECDIGTYCAEGVGALVGIEWSERSGPALIDPLYGRAAEIGERLEGSEGPPWDGSVLAAHVDGRRSLAVVHSSRGVEVWDVGAGVRLIGFSQPSPLARSDGAIFDASGRWLLVFEHELGEAALVDLESRTIVPARVPEHEQWPVLALTADGKRVVTEPEYSVVKMIDLRTSQVVQSFQVKAFEWWGFQGPRSIQFSPDGSRLAIQSETGELRILDSQWYGGRYSERKDFEESRAIAVEWILARRANGSAWREILALLKTVDLPREVSDAASDEVSTRLNEIVREAACLVQALSEELFFQPDVITAIENDSALAVEVREEALRIASSVGGLSSVGLSWVAGERLSNPNGSPEDYDVARRAMATLKARDAFLDPADRWAWPAADYRCGAFDEAMEGLLALRASASEPCPRIELFLAMSAARLGLGTEAVDALDRARRAARNHQDGDDESLLRLIEEAESVVASSVPQSSR
>NZ_CP036287.1|WP_145067944.1|5009079_5009739_-|sigma-70-family-RNA-polymerase-sigma-factor
MTDPDDLLARSLSPGDLPTPKASLELLALARAGDRNALEDLVARYQDRLRRIVRIQLGESFLRRDHDSMDIVQSTFRAALPRIADLYPRNHAGILNWLAMIATNQIRDAYAARTTRKRDVRREVPLAESACGRLGAGDERPDEQAMLAEVRELLDDEVTRLPEDQRRVVVLRDYVGEDWDRIAAELGREQGAARQLHQRAWIRLRRALRPRLQPRERDA
>NZ_CP036287.1|WP_145070979.1|5009834_5010659_-|SUMF1/EgtB/PvdO-family-nonheme-iron-enzyme
MPEGPTVPIWAELLDAKPSRAVVKDADLRRRITETGLAWRVRDRTTGVELLLVPPGTYERGASRGDDLAGMEEKPRHTVTITAPFYLGRYEVQKHEWDHLVDGAELSNRPGLPKEGLGFDDVVAYLRRANQADDTESSPLRLPTEAEWEYACRAGTDGPVYGKSLSSVAWYRDNAGDRARVVGTRKANALGFHDMLGNVKEWCSDHYDPAEYERIAAAPDLGVDPAGSSNPSNGHVLRGGAYSRPMSEARASARQRRYSDPVIRPYGLRVARHP
>NZ_CP036287.1|WP_145067946.1|5011330_5012329_-|ribonucleotide-diphosphate-reductase-subunit-beta
MLLDPGMDLTLRPMRYPVFYEMYRNAIKNTWTVEEVDFSTDLVDLQHRLMPAERHMINRLVAFFATGDSIVANNLVLNLYKHINAPEARMYLSRQLYEEALHVQFYLTLLDTYIPDLKEREEAFQAVTNIPSIKKKAEFCFKWMDTVQSMEACRTPEDRRKFLLNLICFATCIEGLFFFAAFAYVYFMRSRGLLNGLAAGTNWVFRDESCHMAYALEVVETVRKEEPELFDDELRNSVVQMLEEAVECETAFAEDLLNQGVSGLSMRDMRQYLEFIADQRLGNLGMAKRFEAKNPFAFMDLQDVQELSNFFERRVSAYQVAVSGDVGFDEEF
>NZ_CP036287.1|WP_145070981.1|5012603_5014967_-|ribonucleoside-diphosphate-reductase-subunit-alpha
MRVRKRNGGSEPVDVNKIVRAVQRCGAGLDAVDPLRVATRTISGLYDGATTSELDRLSIQTAASLIAEEPQYSKLAARLLGTYIDKEVANQDIMSFSQSIKAGVEAGLISERVAEFVQENQRKLNDAIDPSRVALFEYFGLRTVYDRYLLKDPHSRDVLETPQYFFMRVACGLAQDPAEAIEFYHLISSLVYLPSSPTLFNSGSQRTQLSSCYLLDSPEDDLTAIYRRYNDVAQLSKFAGGIGLAYHRIRSKGSLIRGTNGHSNGIVPWLKTLDSSVAAVNQGGRRKGAACVYLESWHADIEDFLELRDNTGDDARRTHNLNLANWVPDLFMKRVEAGEDWSLFDPKVVPHFTDIYGEEFERAYEQAEAEGLASRKVPARELYGRMMRTLAQTGNGWMTFKDASNRKCNQTGAERTDGKPSVVHLSNLCTEIIEVTSQGETAVCNLGSINIGRFVVGGEIDYVRLRQVARIAMRYLDRVIDINYYPTAEAKSSNQRWRPVGLGLMGLQDVFFKLGLPFDSERARALSRRVQEEIYFAALDMSCELAEELGAHPAFDETRAAVGKFQWELWDGVEVEDPARWDALRERIKTHGLRNSLMLAIAPTATIASIAGCYECIEPQISNLFKRETLSGDFLQINNYLVLELKKLGKWTPEMRQRIKNAEGSIQSLEELPAELRAVFRTAWEVPQRSLIDMAAERGAFIDQSQSLNLFMETPTIGKLSSMYLYAWKQGLKTTYYLRSRPATRIRQTDSSVSAQPGEADSDVKDYSDNDAVVCSLENPESCEACQ
>NZ_CP036287.1|WP_145067948.1|5016331_5017582_-|hypothetical-protein
MQTWADVTTAIHDRLRRSARADRLLVVLRLDQLPADPAQGGAELIETWRWFQNQPGSGAAISVDRCEGGRDEALGRLRALSAPHQVRIPGDLFGFGDLDLNHWRGAGWRPAVVVDARSDAVDRSETLAGDRSAEVAVVAAPDLAVANPTATVRAGVVHPAGAEAAEGSEPRPAPPEVTWRGVGTREDLDAFLGSTVRWAEIPIRRGGQGDVVLAGEDGFQPSLDEVLGVLAQCNKGARLRLDSDPRLRARVLRILVQSGFSNQDLRLAAEPLSGASIGFQELADACPGALLECPLDFLGPVLAIDPLAARALVESLTSQGVGRFLLARGGGDRLAVSAALRSWGQRYDVGNIEDLGGLLEVFREGPSGLTTDFGLATRPRLRQAVDAAMGAAPPVARQLVRRSQAGGSRLPRSPRI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP036287_1	1.1\|2186789\|58\|NZ_CP036287\|CRISPRCasFinder	2186789-2186846	58	NZ_CP036287.1	1735272-1735329	0	1.0
NZ_CP036287_1	1.1\|2186789\|58\|NZ_CP036287\|CRISPRCasFinder	2186789-2186846	58	NZ_CP036287.1	728906-728963	0	1.0
NZ_CP036287_1	1.1\|2186789\|58\|NZ_CP036287\|CRISPRCasFinder	2186789-2186846	58	NZ_CP036287.1	1666316-1666373	0	1.0
NZ_CP036287_1	1.1\|2186789\|58\|NZ_CP036287\|CRISPRCasFinder	2186789-2186846	58	NZ_CP036287.1	4550949-4551006	0	1.0
NZ_CP036287_1	1.1\|2186789\|58\|NZ_CP036287\|CRISPRCasFinder	2186789-2186846	58	NZ_CP036287.1	6743841-6743898	0	1.0
NZ_CP036287_1	1.1\|2186789\|58\|NZ_CP036287\|CRISPRCasFinder	2186789-2186846	58	NZ_CP036287.1	1604673-1604730	1	0.983
NZ_CP036287_1	1.1\|2186789\|58\|NZ_CP036287\|CRISPRCasFinder	2186789-2186846	58	NZ_CP036287.1	3460133-3460190	1	0.983
NZ_CP036287_1	1.1\|2186789\|58\|NZ_CP036287\|CRISPRCasFinder	2186789-2186846	58	NZ_CP036287.1	2925393-2925450	2	0.966

1. spacer 1.1|2186789|58|NZ_CP036287|CRISPRCasFinder matches to position: 1735272-1735329, mismatch: 0, identity: 1.0

aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttctgatccaggaca	CRISPR spacer
aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttctgatccaggaca	Protospacer
**********************************************************

2. spacer 1.1|2186789|58|NZ_CP036287|CRISPRCasFinder matches to position: 728906-728963, mismatch: 0, identity: 1.0

aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttctgatccaggaca	CRISPR spacer
aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttctgatccaggaca	Protospacer
**********************************************************

3. spacer 1.1|2186789|58|NZ_CP036287|CRISPRCasFinder matches to position: 1666316-1666373, mismatch: 0, identity: 1.0

aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttctgatccaggaca	CRISPR spacer
aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttctgatccaggaca	Protospacer
**********************************************************

4. spacer 1.1|2186789|58|NZ_CP036287|CRISPRCasFinder matches to position: 4550949-4551006, mismatch: 0, identity: 1.0

aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttctgatccaggaca	CRISPR spacer
aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttctgatccaggaca	Protospacer
**********************************************************

5. spacer 1.1|2186789|58|NZ_CP036287|CRISPRCasFinder matches to position: 6743841-6743898, mismatch: 0, identity: 1.0

aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttctgatccaggaca	CRISPR spacer
aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttctgatccaggaca	Protospacer
**********************************************************

6. spacer 1.1|2186789|58|NZ_CP036287|CRISPRCasFinder matches to position: 1604673-1604730, mismatch: 1, identity: 0.983

aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttctgatccaggaca	CRISPR spacer
aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttcggatccaggaca	Protospacer
********************************************** ***********

7. spacer 1.1|2186789|58|NZ_CP036287|CRISPRCasFinder matches to position: 3460133-3460190, mismatch: 1, identity: 0.983

aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttctgatccaggaca	CRISPR spacer
aacgacgccagcggcgatcggagcccgggaagtggcgccgaatttctgatccaggaca	Protospacer
**********************************.***********************

8. spacer 1.1|2186789|58|NZ_CP036287|CRISPRCasFinder matches to position: 2925393-2925450, mismatch: 2, identity: 0.966

aacgacgccagcggcgatcggagcccgggaagtgacgccgaatttctgatccaggaca	CRISPR spacer
aacgacgccagcggcgatcggaacccgggaagtaacgccgaatttctgatccaggaca	Protospacer
**********************.**********.************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1883898-1883932	8	0.771
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP030273	Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence	103812-103846	8	0.771
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	CP047033	Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence	97498-97532	8	0.771
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP047039	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence	97458-97492	8	0.771
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1793679-1793713	8	0.771
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1793681-1793715	8	0.771
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP015213	Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence	16964-16998	8	0.771
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP051470	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence	107198-107232	8	0.771
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NC_011960	Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence	36168-36202	8	0.771
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP015290	Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence	91566-91600	8	0.771
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_LR134454	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence	219098-219132	8	0.771
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1822573-1822607	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1845541-1845575	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1882512-1882546	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	2048994-2049028	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1530379-1530413	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1812943-1812977	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	420178-420212	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	788201-788235	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1890819-1890853	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1600453-1600487	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1829895-1829929	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1829989-1830023	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1824766-1824800	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1893482-1893516	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1764291-1764325	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1902298-1902332	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1893449-1893483	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1799771-1799805	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1877270-1877304	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1892192-1892226	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1793204-1793238	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1800083-1800117	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1877270-1877304	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1892291-1892325	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1799771-1799805	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1793853-1793887	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1798974-1799008	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1877270-1877304	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1877270-1877304	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1877270-1877304	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1892287-1892321	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1954148-1954182	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1892276-1892310	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1793229-1793263	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1808396-1808430	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1789032-1789066	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1850139-1850173	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1880048-1880082	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1874585-1874619	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1892276-1892310	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1793229-1793263	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1800082-1800116	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1827191-1827225	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1893272-1893306	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1793229-1793263	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1793229-1793263	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1892287-1892321	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1877275-1877309	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1892298-1892332	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1892099-1892133	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	817967-818001	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	826303-826337	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	15293-15327	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	607779-607813	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	487169-487203	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	582480-582514	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1279088-1279122	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	125219-125253	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	125219-125253	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1702950-1702984	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1773164-1773198	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1701972-1702006	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1702943-1702977	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1702264-1702298	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1702932-1702966	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	55921-55955	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	202683-202717	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	JX182371	Streptomyces phage SV1, complete genome	32411-32445	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	MH617550	Microviridae sp. isolate ctcd890, complete genome	2300-2334	9	0.743
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1026111-1026145	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1100360-1100394	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	777557-777591	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1019303-1019337	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	7966-8000	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1108111-1108145	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	822965-822999	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1031742-1031776	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	933792-933826	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1028443-1028477	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1140653-1140687	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1826117-1826151	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	960933-960967	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1108100-1108134	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1140620-1140654	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1139449-1139483	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	991884-991918	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1139462-1139496	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	991907-991941	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1139462-1139496	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	935874-935908	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1139451-1139485	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	991907-991941	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1030902-1030936	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1011576-1011610	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1059523-1059557	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1105679-1105713	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1139451-1139485	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	991907-991941	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1140619-1140653	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	991907-991941	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	991907-991941	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1139462-1139496	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1139473-1139507	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1139451-1139485	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1611607-1611641	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	240226-240260	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1394644-1394678	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	941319-941353	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	58881-58915	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1118386-1118420	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP025431	Paracoccus zhejiangensis strain J6 plasmid pPZ01, complete sequence	100924-100958	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1118394-1118428	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	MF377440	Mycobacterium phage Bella96, complete genome	6385-6419	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	122592-122626	10	0.714
NZ_CP036287_2	2.1\|3068123\|35\|NZ_CP036287\|CRISPRCasFinder	3068123-3068157	35	NZ_AP014803	Rhodovulum sulfidophilum plasmid Plasmid3 DNA, complete genome, strain: DSM 2351	10201-10235	11	0.686

1. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 8, identity: 0.771

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cggcggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * * *** ******************* ***

2. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP030273 (Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence) position: , mismatch: 8, identity: 0.771

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cgacccggcccgccgcgccgcccaggcccgcgccg	Protospacer
 * **  *****************.*******

3. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to CP047033 (Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence) position: , mismatch: 8, identity: 0.771

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cgacccggcccgccgcgccgcccaggcccgcgccg	Protospacer
 * **  *****************.*******

4. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP047039 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence) position: , mismatch: 8, identity: 0.771

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cgacccggcccgccgcgccgcccaggcccgcgccg	Protospacer
 * **  *****************.*******

5. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.771

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cggcggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * * *** ******************* ***

6. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.771

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cggcggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * * *** ******************* ***

7. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP015213 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence) position: , mismatch: 8, identity: 0.771

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cgacccggcccgccgcgccgcccaggcccgcgccg	Protospacer
 * **  *****************.*******

8. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP051470 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence) position: , mismatch: 8, identity: 0.771

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cgacccggcccgccgcgccgcccaggcccgcgccg	Protospacer
 * **  *****************.*******

9. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NC_011960 (Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence) position: , mismatch: 8, identity: 0.771

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cgacccggcccgccgcgccgcccaggcccgcgccc	Protospacer
 * **  *****************.*******  .

10. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP015290 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence) position: , mismatch: 8, identity: 0.771

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cgacccggcccgccgcgccgcccaggcccgcgccg	Protospacer
 * **  *****************.*******

11. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_LR134454 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence) position: , mismatch: 8, identity: 0.771

agtccg---cgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
---ccggcccgcccgccgcgccgccgaaccccgcgctg	Protospacer
   ***   **************** ** ******

12. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

13. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

14. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

15. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

16. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

17. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

18. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

19. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

20. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

21. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

22. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

23. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

24. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

25. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

26. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

27. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

28. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

29. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

30. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

31. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

32. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

33. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

34. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

35. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

36. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

37. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

38. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

39. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

40. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

41. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

42. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

43. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

44. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

45. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

46. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

47. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

48. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

49. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

50. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

51. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

52. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

53. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

54. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

55. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

56. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

57. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

58. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

59. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

60. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

61. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

62. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

63. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

64. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

65. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

66. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

67. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

68. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

69. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

70. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tggtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 * . *** ******************* ***

71. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cggcggcgaccgccgcgccgcccaagccggccccg	Protospacer
 * * *** ******************* **

72. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cggcggcgaccgccgcgccgcccaagccggccccg	Protospacer
 * * *** ******************* **

73. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cggcggcgaccgccgcgccgcccaagccggccccg	Protospacer
 * * *** ******************* **

74. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cggcggcgaccgccgcgccgcccaagccggccccg	Protospacer
 * * *** ******************* **

75. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cggcggcgaccgccgcgccgcccaagccggccccg	Protospacer
 * * *** ******************* **

76. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cggcggcgaccgccgcgccgcccaagccggccccg	Protospacer
 * * *** ******************* **

77. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cgacccggcccgccgccccgcccaggcccgcgccg	Protospacer
 * **  ********* *******.*******

78. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt---	CRISPR spacer
cgaccgcgcctgccgcgccgccgaagc---cgcattca	Protospacer
 * *******.*********** ****   ** .*

79. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to JX182371 (Streptomyces phage SV1, complete genome) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt-	CRISPR spacer
ccgccgcgcccgccgcgccgcccggg-ccgcgctcc	Protospacer
   ********************..* *****  .

80. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to MH617550 (Microviridae sp. isolate ctcd890, complete genome) position: , mismatch: 9, identity: 0.743

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ggaaagcgcccggcgcgccgcccaggcccgtgagg	Protospacer
.*   ******* ***********.*****.*.*

81. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

82. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

83. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

84. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

85. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

86. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

87. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

88. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

89. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

90. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

91. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

92. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tagtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 . . *** ******************* ***

93. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

94. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

95. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

96. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

97. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

98. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

99. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

100. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

101. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

102. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

103. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

104. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

105. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

106. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

107. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

108. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

109. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

110. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

111. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

112. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

113. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

114. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

115. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

116. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

117. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
tagtggcgaccgccgcgccgcccaagccggcgccg	Protospacer
 . . *** ******************* ***

118. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

119. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

120. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttcctgcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .*.************ ******** ****..

121. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

122. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP025431 (Paracoccus zhejiangensis strain J6 plasmid pPZ01, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
aagtcgcgcccgccgcgcccccaaagcccgtcatc	Protospacer
*. .*************** ** *******. . .

123. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ttccggcgcccgccgcgacgcccaaggccgcaacg	Protospacer
  .* ************ ******** ****..

124. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to MF377440 (Mycobacterium phage Bella96, complete genome) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
ccccggcgcccgccgcggcgccgaagcccgcaaag	Protospacer
  .* ************ **** ********...

125. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 10, identity: 0.714

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
cgcccgcgcccaccgcgccgcccaggccacccacc	Protospacer
 *.********.************.***  * . .

126. spacer 2.1|3068123|35|NZ_CP036287|CRISPRCasFinder matches to NZ_AP014803 (Rhodovulum sulfidophilum plasmid Plasmid3 DNA, complete genome, strain: DSM 2351) position: , mismatch: 11, identity: 0.686

agtccgcgcccgccgcgccgcccaagcccgcgggt	CRISPR spacer
gacccgcgcccgccgcgccggccatgcctatgccg	Protospacer
...***************** *** ***...*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

206694 : 288222

Lactococcus_phage(16.67%)

integrase,transposase,protease

attL 212479:212504|attR 239980:240005

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_145061410.1\|206694_208323_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_145061412.1\|208319_209093_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	5.8e-30	34.9
WP_145061414.1\|210207_213192_-	tetratricopeptide repeat protein	A0A2K9L5Y0	Tupanvirus	6.7e-18	28.2
212479:212504	attL	NA	NA	NA	NA
WP_145061417.1\|213199_213781_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_145061419.1\|213731_217226_+	hypothetical protein	NA	NA	NA	NA
WP_145061421.1\|217421_220850_+	hypothetical protein	NA	NA	NA	NA
WP_145061423.1\|221026_222577_+	DUF4331 family protein	NA	NA	NA	NA
WP_145061425.1\|222665_223952_+	hypothetical protein	NA	NA	NA	NA
WP_145061427.1\|223944_224697_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_145061429.1\|224693_225329_+	hypothetical protein	NA	NA	NA	NA
WP_145061431.1\|225544_225904_-	hypothetical protein	NA	NA	NA	NA
WP_145061433.1\|225985_226363_-	hypothetical protein	NA	NA	NA	NA
WP_145061435.1\|226468_227017_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_145061437.1\|227133_227688_-	hypothetical protein	NA	NA	NA	NA
WP_145061439.1\|227782_228682_-	hypothetical protein	NA	NA	NA	NA
WP_145061441.1\|228751_229030_-	hypothetical protein	NA	NA	NA	NA
WP_145061443.1\|229058_229667_-	hypothetical protein	NA	NA	NA	NA
WP_145061445.1\|229792_230026_-	DUF4926 domain-containing protein	NA	NA	NA	NA
WP_145061447.1\|230022_230334_-	hypothetical protein	NA	NA	NA	NA
WP_145061449.1\|230626_231640_-\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	1.4e-55	45.1
WP_145061451.1\|231763_232474_+	hypothetical protein	NA	NA	NA	NA
WP_145061453.1\|232240_233848_-	hypothetical protein	NA	NA	NA	NA
WP_145061455.1\|235942_237646_-	hypothetical protein	NA	NA	NA	NA
WP_145061457.1\|237642_238539_-	hypothetical protein	NA	NA	NA	NA
WP_145061459.1\|238683_239304_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_145061461.1\|239309_241787_+	protein kinase	A0A146JFA3	Tokyovirus	2.4e-13	29.0
239980:240005	attR	NA	NA	NA	NA
WP_145061466.1\|241977_245106_+	hypothetical protein	NA	NA	NA	NA
WP_145061468.1\|245247_245460_-	hypothetical protein	NA	NA	NA	NA
WP_145061470.1\|245607_246816_-	cysteine desulfurase-like protein	NA	NA	NA	NA
WP_145061472.1\|246866_247415_+	hypothetical protein	NA	NA	NA	NA
WP_145061474.1\|247445_249077_-	hypothetical protein	E5ESI2	Bathycoccus_sp._RCC1105_virus	7.9e-29	32.3
WP_145061476.1\|249319_252340_+	hypothetical protein	NA	NA	NA	NA
WP_145061478.1\|252632_255638_+	hypothetical protein	NA	NA	NA	NA
WP_145168244.1\|255729_256836_-	hypothetical protein	NA	NA	NA	NA
WP_145061482.1\|257567_260855_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_145061484.1\|261150_262563_-	hypothetical protein	NA	NA	NA	NA
WP_145061486.1\|262619_264062_-	hypothetical protein	NA	NA	NA	NA
WP_145061488.1\|264241_265927_+	M3 family oligoendopeptidase	NA	NA	NA	NA
WP_145061490.1\|266158_266896_+	hypothetical protein	NA	NA	NA	NA
WP_145061492.1\|267083_267908_+	hypothetical protein	NA	NA	NA	NA
WP_145061494.1\|267949_268522_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_145061496.1\|268550_269066_-	hypothetical protein	NA	NA	NA	NA
WP_145061498.1\|269176_269725_-	pyridoxamine 5-phosphate oxidase	NA	NA	NA	NA
WP_145061500.1\|269734_270109_-	DsrE family protein	NA	NA	NA	NA
WP_145061502.1\|270252_270909_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_145061504.1\|270953_272120_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_145061506.1\|272206_272770_-	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_145061508.1\|273069_274464_+	hypothetical protein	NA	NA	NA	NA
WP_145061510.1\|274575_278100_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_145061512.1\|278309_280016_+	hypothetical protein	NA	NA	NA	NA
WP_145070692.1\|280082_281492_-	cobyric acid synthase	NA	NA	NA	NA
WP_145061514.1\|281544_282129_+\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_145061515.1\|282125_283028_+	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	1.1e-37	37.0
WP_145061516.1\|283132_283573_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_145061517.1\|283644_284076_+	DoxX family membrane protein	NA	NA	NA	NA
WP_145061518.1\|284095_284863_+	dioxygenase	NA	NA	NA	NA
WP_145061519.1\|284949_286911_+	hypothetical protein	NA	NA	NA	NA
WP_145070694.1\|286944_287244_-\|transposase	transposase	NA	NA	NA	NA
WP_145061520.1\|287244_287841_-\|transposase	transposase	NA	NA	NA	NA
WP_145061521.1\|287877_288222_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

1745650 : 1765670

Acidithiobacillus_phage(33.33%)

transposase,integrase

attL 1740237:1740253|attR 1748159:1748175

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1740237:1740253	attL	NA	NA	NA	NA
WP_145070761.1\|1745650_1746034_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_145063573.1\|1746763_1749766_+	hypothetical protein	NA	NA	NA	NA
1748159:1748175	attR	NA	NA	NA	NA
WP_145063574.1\|1749765_1750518_+	hypothetical protein	NA	NA	NA	NA
WP_145063575.1\|1752960_1753419_+	excisionase family DNA-binding protein	K4ICM4	Acidithiobacillus_phage	1.6e-27	49.7
WP_145063576.1\|1753815_1754658_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_145063577.1\|1754657_1754999_-\|transposase	transposase	NA	NA	NA	NA
WP_145063578.1\|1755090_1755741_-\|transposase	transposase	NA	NA	NA	NA
WP_145063580.1\|1755787_1756561_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.9e-28	34.0
WP_145063582.1\|1756557_1758186_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_145063584.1\|1758466_1759147_+	hypothetical protein	NA	NA	NA	NA
WP_145063586.1\|1759153_1759471_+	hypothetical protein	NA	NA	NA	NA
WP_145063588.1\|1759910_1760786_+	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_145063590.1\|1761239_1762793_-	hypothetical protein	NA	NA	NA	NA
WP_145061396.1\|1763341_1764091_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	2.1e-37	34.2
WP_145061394.1\|1764074_1765670_-\|transposase	IS21 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

1777018 : 1798867

Enterobacteria_phage(50.0%)

transposase,integrase

attL 1765772:1765794|attR 1787173:1787195

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1765772:1765794	attL	NA	NA	NA	NA
WP_145063603.1\|1777018_1777900_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_145063606.1\|1778014_1779601_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_145063612.1\|1779632_1780010_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_145063617.1\|1780003_1780348_-	hypothetical protein	NA	NA	NA	NA
WP_145063622.1\|1780653_1781253_-	hypothetical protein	NA	NA	NA	NA
WP_145063625.1\|1782035_1782545_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_145063628.1\|1782538_1782805_-\|transposase	transposase	NA	NA	NA	NA
WP_145168302.1\|1782888_1783086_-	hypothetical protein	NA	NA	NA	NA
WP_145063635.1\|1783148_1785053_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_145063640.1\|1785638_1786673_-	hypothetical protein	NA	NA	NA	NA
WP_145061396.1\|1787205_1787955_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	2.1e-37	34.2
1787173:1787195	attR	NA	NA	NA	NA
WP_145168304.1\|1787938_1789534_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_145063645.1\|1790003_1790984_-	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_145063650.1\|1790884_1791490_-	transcriptional regulator	NA	NA	NA	NA
WP_145063654.1\|1791901_1792978_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_145063656.1\|1793697_1794114_+	hypothetical protein	NA	NA	NA	NA
WP_145063661.1\|1794342_1794783_+	hypothetical protein	NA	NA	NA	NA
WP_145063666.1\|1794825_1796052_+	restriction endonuclease	NA	NA	NA	NA
WP_145063668.1\|1796195_1796462_+	hypothetical protein	NA	NA	NA	NA
WP_145061753.1\|1796468_1797242_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	3.4e-30	34.9
WP_145061410.1\|1797238_1798867_-\|transposase	IS21 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

5243741 : 5324650

Tupanvirus(25.0%)

integrase,tRNA,transposase,tail

attL 5231513:5231529|attR 5261175:5261191

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5231513:5231529	attL	NA	NA	NA	NA
WP_145068268.1\|5243741_5244311_+\|transposase	transposase	NA	NA	NA	NA
WP_145068270.1\|5244344_5244788_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_145068272.1\|5244837_5245680_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_145068274.1\|5252005_5253373_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_145068276.1\|5253783_5254815_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_145068278.1\|5254811_5255726_-	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_145068281.1\|5255738_5257028_-	UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase	NA	NA	NA	NA
WP_145068283.1\|5257024_5258062_-	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_145068285.1\|5258259_5260839_-	BamA/TamA family outer membrane protein	NA	NA	NA	NA
WP_145068287.1\|5260956_5262339_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.1e-82	38.1
5261175:5261191	attR	NA	NA	NA	NA
WP_145068289.1\|5262687_5263149_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_145068291.1\|5263164_5263374_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_145068293.1\|5263370_5264000_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_145068295.1\|5264032_5264674_-\|tRNA	peptidyl-tRNA hydrolase	NA	NA	NA	NA
WP_145068297.1\|5264921_5265545_-	50S ribosomal protein L25	NA	NA	NA	NA
WP_145068299.1\|5265661_5266630_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	7.0e-41	35.3
WP_145068301.1\|5267089_5268391_-	NTP transferase domain-containing protein	A0A2K9L277	Tupanvirus	6.1e-24	35.3
WP_145068303.1\|5268923_5270423_+	hypothetical protein	NA	NA	NA	NA
WP_145168469.1\|5270726_5271125_-	hypothetical protein	NA	NA	NA	NA
WP_145068307.1\|5272123_5272939_+	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_145068309.1\|5273035_5274943_-	hypothetical protein	NA	NA	NA	NA
WP_145068311.1\|5275189_5275960_+	hypothetical protein	NA	NA	NA	NA
WP_145068313.1\|5276016_5279331_-	protein kinase	A0A0G2Y7N1	Acanthamoeba_polyphaga_mimivirus	8.9e-11	26.8
WP_145068315.1\|5279497_5281510_-	GAF domain-containing protein	NA	NA	NA	NA
WP_145068317.1\|5281558_5282899_+	AmmeMemoRadiSam system protein B	NA	NA	NA	NA
WP_145068319.1\|5282957_5283341_+	DUF1565 domain-containing protein	NA	NA	NA	NA
WP_145068321.1\|5283447_5284707_+	hypothetical protein	NA	NA	NA	NA
WP_145068323.1\|5284750_5285509_+	hypothetical protein	NA	NA	NA	NA
WP_145068325.1\|5285532_5286354_-	enoyl-CoA hydratase	NA	NA	NA	NA
WP_145068327.1\|5286560_5288165_-	AAA domain-containing protein	NA	NA	NA	NA
WP_145068329.1\|5288180_5289422_+	beta-propeller fold lactonase family protein	NA	NA	NA	NA
WP_145068331.1\|5289477_5290719_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_145068334.1\|5290568_5291591_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_145068336.1\|5291587_5292433_-	hypothetical protein	NA	NA	NA	NA
WP_145068338.1\|5292815_5294102_+	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
WP_145068340.1\|5294110_5295424_+	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
WP_145068342.1\|5295642_5297301_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_145068345.1\|5297476_5300377_-	VCBS repeat-containing protein	NA	NA	NA	NA
WP_145068347.1\|5300404_5301244_-	TSUP family transporter	NA	NA	NA	NA
WP_145068349.1\|5301240_5301756_-	adenylyltransferase/cytidyltransferase family protein	A0A0K0KVL9	Prochlorococcus_phage	5.0e-14	33.1
WP_145068351.1\|5301752_5302778_-	sugar kinase	NA	NA	NA	NA
WP_145068353.1\|5302963_5304628_-	radical SAM protein	NA	NA	NA	NA
WP_145068355.1\|5304886_5306452_-	DUF4157 domain-containing protein	NA	NA	NA	NA
WP_145068357.1\|5307291_5307669_-	type VI secretion protein	NA	NA	NA	NA
WP_145068359.1\|5307706_5311066_-	hypothetical protein	NA	NA	NA	NA
WP_145068361.1\|5311075_5312743_-	hypothetical protein	NA	NA	NA	NA
WP_145068363.1\|5312739_5313657_-	hypothetical protein	NA	NA	NA	NA
WP_145068365.1\|5313649_5315359_-	hypothetical protein	NA	NA	NA	NA
WP_145068367.1\|5315355_5318238_-	hypothetical protein	NA	NA	NA	NA
WP_145068369.1\|5318237_5318699_-	GPW/gp25 family protein	A0A088FV58	Escherichia_phage	7.7e-06	39.0
WP_145068371.1\|5318711_5320514_-	hypothetical protein	NA	NA	NA	NA
WP_145068373.1\|5320510_5321179_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_145068375.1\|5321385_5321988_-\|tail	phage tail protein	NA	NA	NA	NA
WP_145068377.1\|5321914_5322358_-\|tail	phage tail protein	A0A059XP77	uncultured_phage	6.9e-20	43.0
WP_145068379.1\|5322397_5324650_-\|tail	phage tail sheath family protein	J9PVC2	Bacillus_phage	1.7e-37	35.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP036287

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection