CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP023307	Lactobacillus plantarum strain LLY-606 plasmid p.LLY60601, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP023306	Lactobacillus plantarum strain LLY-606 chromosome, complete genome	1 crisprs	WYL,csa3,DinG,cas3,DEDDh	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP023306_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023306_1

2711266-2711351

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP023306_1

>merge|NZ_CP023306|1|2711266-2711351|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGTTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>NZ_CP023306|1|1|2711266-2711351|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGTTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023306.1\|WP_142262958.1\|2715041_2716037_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|376439
NZ_CP023306.1\|WP_063723955.1\|2705942_2706671_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP023306.1\|WP_142262957.1\|2714046_2715045_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|376439
NZ_CP023306.1\|WP_053267558.1\|2705444_2705810_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP023306.1\|WP_142262951.1\|2706829_2707396_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP023306.1\|WP_142262950.1\|2702008_2704591_-\|glycoside-hydrolase-family-25	unknown	unknown	gnl\|CDD\|119382
NZ_CP023306.1\|WP_003642338.1\|2700248_2701661_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NZ_CP023306.1\|WP_044432116.1\|2718229_2718736_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP023306.1\|WP_142262952.1\|2707522_2708560_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187538
NZ_CP023306.1\|WP_142262955.1\|2712088_2713018_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP023306.1\|WP_142262954.1\|2711368_2711968_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP023306.1\|WP_054398747.1\|2708702_2709656_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP023306.1\|WP_142262949.1\|2699294_2700209_+\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187542
NZ_CP023306.1\|WP_142262956.1\|2713255_2714050_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP023306.1\|WP_044432120.1\|2720187_2721975_+\|elongation-factor-4	unknown	unknown	gnl\|CDD\|235462
NZ_CP023306.1\|WP_142262959.1\|2724331_2725156_-\|NAD(+)-diphosphatase	unknown	unknown	gnl\|CDD\|225373
NZ_CP023306.1\|WP_044432118.1\|2719528_2720191_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP023306.1\|WP_142262953.1\|2709772_2711251_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP023306.1\|WP_044432114.1\|2717466_2718213_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP023306.1\|WP_045353105.1\|2704876_2705161_+\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097

Protein	Function_ID	Function_description	E-value
NZ_CP023306.1\|WP_142262958.1\|2715041_2716037_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.3061e-78
NZ_CP023306.1\|WP_063723955.1\|2705942_2706671_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.10174e-90
NZ_CP023306.1\|WP_142262957.1\|2714046_2715045_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.80112e-80
NZ_CP023306.1\|WP_053267558.1\|2705444_2705810_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	9.56644e-32
NZ_CP023306.1\|WP_142262951.1\|2706829_2707396_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	0.000296007
NZ_CP023306.1\|WP_142262950.1\|2702008_2704591_-\|glycoside-hydrolase-family-25	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	1.79314e-70
NZ_CP023306.1\|WP_003642338.1\|2700248_2701661_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NZ_CP023306.1\|WP_044432116.1\|2718229_2718736_-\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.39904e-54
NZ_CP023306.1\|WP_142262952.1\|2707522_2708560_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.45628e-94
NZ_CP023306.1\|WP_142262955.1\|2712088_2713018_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.40543e-55
NZ_CP023306.1\|WP_142262954.1\|2711368_2711968_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.53026e-09
NZ_CP023306.1\|WP_054398747.1\|2708702_2709656_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	1.63387e-131
NZ_CP023306.1\|WP_142262949.1\|2699294_2700209_+\|NAD(P)H-binding-protein	gnl\|CDD\|187542	cd05231, NmrA_TMR_like_1_SDR_a, NmrA (a transcriptional regulator) and triphenylmethane reductase (TMR) like proteins, subgroup 1, atypical (a) SDRs. Atypical SDRs related to NMRa, TMR, and HSCARG (an NADPH sensor). This subgroup resembles the SDRs and has a partially conserved characteristic [ST]GXXGXXG NAD-binding motif, but lacks the conserved active site residues. NmrA is a negative transcriptional regulator of various fungi, involved in the post-translational modulation of the GATA-type transcription factor AreA. NmrA lacks the canonical GXXGXXG NAD-binding motif and has altered residues at the catalytic triad, including a Met instead of the critical Tyr residue. NmrA may bind nucleotides but appears to lack any dehydrogenase activity. HSCARG has been identified as a putative NADP-sensing molecule, and redistributes and restructures in response to NADPH/NADP ratios. Like NmrA, it lacks most of the active site residues of the SDR family, but has an NAD(P)-binding motif similar to the extended SDR family, GXXGXXG. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Atypical SDRs are distinct from classical SDRs. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.11869e-29
NZ_CP023306.1\|WP_142262956.1\|2713255_2714050_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	1.19434e-113
NZ_CP023306.1\|WP_044432120.1\|2720187_2721975_+\|elongation-factor-4	gnl\|CDD\|235462	PRK05433, PRK05433, GTP-binding protein LepA; Provisional.	0
NZ_CP023306.1\|WP_142262959.1\|2724331_2725156_-\|NAD(+)-diphosphatase	gnl\|CDD\|225373	COG2816, NPY1, NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair].	4.73113e-55
NZ_CP023306.1\|WP_044432118.1\|2719528_2720191_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.76891e-12
NZ_CP023306.1\|WP_142262953.1\|2709772_2711251_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	4.72794e-72
NZ_CP023306.1\|WP_044432114.1\|2717466_2718213_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.74872e-92
NZ_CP023306.1\|WP_045353105.1\|2704876_2705161_+\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.15697e-21

>NZ_CP023306.1|WP_142262953.1|2709772_2711251_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVCGAMAPLLDSTMINIAINNLVTSFHSSVTMVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGSGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAGTYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPALLLTNKLKAAK
>NZ_CP023306.1|WP_054398747.1|2708702_2709656_-|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGINFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQAAGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP023306.1|WP_142262952.1|2707522_2708560_+|NAD-dependent-epimerase/dehydratase-family-protein
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGSITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP023306.1|WP_142262951.1|2706829_2707396_-|TetR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLSTYFAPAIAARFQDVLQHVPANQKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNTNMTNYYQATMANGTLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESSTTIHELLATLQTATMQALTQAQK
>NZ_CP023306.1|WP_063723955.1|2705942_2706671_+|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALAANFENAMIDTVDVTNYHQFETAIRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP023306.1|WP_053267558.1|2705444_2705810_-|helix-turn-helix-transcriptional-regulator
MLKERVNAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP023306.1|WP_045353105.1|2704876_2705161_+|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVSYDGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NZ_CP023306.1|WP_142262950.1|2702008_2704591_-|glycoside-hydrolase-family-25
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNNTNVHADATNATTTSSSAASTASSASVATSSAASDATTKATSVSSSAATQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKSASSAATSTSAKATSQATSVTSSTATTTQVSRTASSTAASAASSTATVKAVTPASSTVSSAATTATKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEVTTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSVKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTTTSSKSTATASAKTVAQSGTYKFAKTTAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYSAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>NZ_CP023306.1|WP_003642338.1|2700248_2701661_+|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL
>NZ_CP023306.1|WP_142262949.1|2699294_2700209_+|NAD(P)H-binding-protein
MKIAMLGSLGNINRIVVPKLVQAGHDVTVISTSPKRQASIEAVGAHAAIGTMTDVDFLSTTFSGKDVVYLMLSGGIGDDPFEGAMAQAKIWKQAIENAGVTNVVNLSSIGADADEVAGSLHAYNLIEHELRQLDGVNLAFVRPTGFYANLFGNLATIKAEHKIYSSTPAASAQKYVAPEDIASVVYPLIDHTPAGITVQYAFSDTFTGDQFVADLRDALNMPDLQWVQISDEQYQANLTNHGVPVKIAASLVQTSRYQREPEGLYADLNASDTSAGQVKLADFVRTFVVAYNSEDGYQSHTIAD
>NZ_CP023306.1|WP_142262954.1|2711368_2711968_+|TetR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVNLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDTTLHLLVDDLLVPAYQHALG
>NZ_CP023306.1|WP_142262955.1|2712088_2713018_-|ABC-transporter-substrate-binding-protein
MTKRWQIVKLGLVLGLTGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRVVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKKQLKGVPLIDYSLPYEAVTKAKPDLILMGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNSHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP023306.1|WP_142262956.1|2713255_2714050_+|ATP-binding-cassette-domain-containing-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQNLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPV
>NZ_CP023306.1|WP_142262957.1|2714046_2715045_+|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTITHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAVIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLSPGLVLGLLLTLLLAPQINLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTIAFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP023306.1|WP_142262958.1|2715041_2716037_+|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTGRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAALLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NZ_CP023306.1|WP_044432114.1|2717466_2718213_-|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKGHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP023306.1|WP_044432116.1|2718229_2718736_-|acetyltransferase
MQTIQPIVDANQRRIQALNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIELADDVLIGPGVMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP023306.1|WP_044432118.1|2719528_2720191_+|TetR/AcrR-family-transcriptional-regulator
MANIYTPSQKAAKRQAIMTAAINLFAHRSYPEITMQQIAEAVGSSKGATFRYFTTKEDLFMTILLEDYQQYFTQLTTDLAQQPPLSADDFIAWMTTQTRQLIEEHSVLIRLNAIRGPILEGKANMQETITQRAALYRASQRLGQQLVIQTDHLLDQSQFSHLFIIQSGIISGLMNMAALTSFNHHKLSVDYPDFEIRLIPEAQQQIRYYLTQYLKEFSHK
>NZ_CP023306.1|WP_044432120.1|2720187_2721975_+|elongation-factor-4
MKQSHTRNFAIIAHIDHGKSTLADQIMALTQTVSAREQHAKLLDDMTVEQAHGVTVKARTVRNYYQADDGQEYEYNLIDTPGHVDFNYEVAKSLAATEGAILLVDATQGVQAQTIANYRIAKQRQLALIPVLNKVDLPSADIDAALAQLNDLDSAFTPEQVLQISAKTGQDVPAVLEAIKQRLPAPQGDLHQPLKALVFDSLYDPYQGVIAYVRLIDGQLKSQQALRLMQGQQDFNGKAIGVFAPQMHPQESLSAGDVGYVVTGIKDPRKVRVGDTLTSVATPTQRPLAGYQPAKSMVFAGLYPKNNDYPTLKEAVQKLNLNDPSFTYVEERSEALGVGFRCGFLGTFHLQIIRERLHDEYGVDVLTTAPNVTYHVTLTNGQQVIVNNPVQFPAFSLIKEVTEPFMKAEITMPADNLNAVLKLAEQHKGTLIDLANSGDLIVASLKIPLSEIAYHFFSELKSVSHGFASLSTAFMANEVSDLVKVEVDINYAPVDALTFIVHREDAPNMTQQLVANLKTTVPRQLYPTPVQARVEGKVIARVDVPPLRKNAAVNGERHSTSKKAALLRRQSANKRRASKNMIKLPQSVFNAILSL
>NZ_CP023306.1|WP_142262959.1|2724331_2725156_-|NAD(+)-diphosphatase
MFQDIQPHVLKNQNDQQRAPRSGDYILIGRQQQVLLMNGTLPKYEDIDADYAFSPDQYQYLLAVDQAAFFWVDVDAVANDNYTVGTTRGFRDLTPAWLAFSSATAAHLAWWYDTKRFCGHCGQPLHPGATERSLVCAACGQTIYPTIMPAIIVGVTNGDKILMTKFLSGYNHFSLISGYTEIGETFEDTIRREVFEEVGLEVHNIRYFGSQPWAPSHSLLAGYFADLNENVAIELETDELSKAQWFQRDQIPHNDTNTSLTWTMIEAFRHHQEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

333341 : 417337

Bacillus_virus(16.67%)

protease,tRNA,bacteriocin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033608274.1\|333341_333905_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_011100974.1\|334098_334767_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_142262708.1\|334916_336422_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|336685_337054_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|337158_337668_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_013355174.1\|337698_338895_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003646440.1\|339004_339475_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|339493_339949_+	hypothetical protein	NA	NA	NA	NA
WP_003643766.1\|340052_340625_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003646441.1\|340789_341710_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_015825107.1\|341846_342746_+	oxidoreductase	NA	NA	NA	NA
WP_142262709.1\|343186_345067_+	hypothetical protein	NA	NA	NA	NA
WP_003646442.1\|345238_345685_-	ribonuclease H	NA	NA	NA	NA
WP_003641940.1\|345922_347449_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_142262710.1\|347449_348421_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_024971425.1\|348498_349830_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|350295_351813_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003643774.1\|351827_353657_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|353671_354394_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_033608292.1\|354980_358664_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_065080269.1\|360691_360952_+	hypothetical protein	NA	NA	NA	NA
WP_057136882.1\|361129_361360_+	hypothetical protein	NA	NA	NA	NA
WP_057136831.1\|361471_361750_+	hypothetical protein	NA	NA	NA	NA
WP_114788253.1\|361814_361931_+	hypothetical protein	NA	NA	NA	NA
WP_057136833.1\|362054_362972_+	hypothetical protein	NA	NA	NA	NA
WP_142262711.1\|363000_363279_+	hypothetical protein	NA	NA	NA	NA
WP_057136835.1\|363670_363916_+	hypothetical protein	NA	NA	NA	NA
WP_003643792.1\|364490_364910_+	hypothetical protein	NA	NA	NA	NA
WP_063204023.1\|365191_365665_+	hypothetical protein	NA	NA	NA	NA
WP_015379760.1\|366000_366618_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_063733242.1\|366621_367776_-	MFS transporter	NA	NA	NA	NA
WP_142262712.1\|367779_368571_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_003641965.1\|368641_369514_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|369673_370489_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011100994.1\|371014_372391_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|372435_373620_+	cation:proton antiporter	NA	NA	NA	NA
WP_003641969.1\|374004_374208_+	hypothetical protein	NA	NA	NA	NA
WP_003643803.1\|374442_374595_-	hypothetical protein	NA	NA	NA	NA
WP_003641971.1\|374619_375288_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641972.1\|375284_375458_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641973.1\|375488_375656_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641974.1\|376517_376718_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641975.1\|376845_377013_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641976.1\|377130_378330_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003641977.1\|378360_379107_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641978.1\|379460_379649_+	hypothetical protein	NA	NA	NA	NA
WP_003641979.1\|379984_380131_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_021356664.1\|380321_381650_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_063204018.1\|382510_383254_+	response regulator transcription factor	NA	NA	NA	NA
WP_021356666.1\|383547_384321_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_021356667.1\|384419_384578_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|384602_384773_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_063721087.1\|385039_387190_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_142262713.1\|387205_388564_+\|bacteriocin	bacteriocin secretion accessory protein	NA	NA	NA	NA
WP_142262714.1\|388653_389343_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063721086.1\|389409_390078_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_053566440.1\|390164_390845_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_053566441.1\|390938_391625_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_076633895.1\|391785_392073_+	hypothetical protein	NA	NA	NA	NA
WP_003646479.1\|392084_392378_+	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	9.9e-07	48.3
WP_053566442.1\|392667_394977_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_142262715.1\|395235_396012_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003643815.1\|396451_397468_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003641997.1\|397875_398586_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003641998.1\|398658_400020_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641999.1\|400026_400215_+	hypothetical protein	NA	NA	NA	NA
WP_003642000.1\|400204_400627_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003643816.1\|400849_402205_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_027821494.1\|402222_403659_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	1.3e-30	25.5
WP_003642003.1\|403739_404636_+	ROK family protein	NA	NA	NA	NA
WP_003642004.1\|404785_405532_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_142262716.1\|405644_406658_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_011101008.1\|407012_408245_+	hypothetical protein	NA	NA	NA	NA
WP_053566445.1\|408249_409044_+	hypothetical protein	NA	NA	NA	NA
WP_011101010.1\|409213_410131_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003642009.1\|410176_411451_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642010.1\|411443_412403_+	hypothetical protein	NA	NA	NA	NA
WP_142262717.1\|412424_413129_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642012.1\|413128_413971_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_015825136.1\|414574_414964_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_142262718.1\|415285_417337_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.6e-90	35.9

DBSCAN-SWA_2

574141 : 582765

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644909.1\|574141_575839_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640956.1\|575860_576169_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|576184_576784_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|576798_577050_+	YaaL family protein	NA	NA	NA	NA
WP_011101140.1\|577447_578113_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640965.1\|578109_578439_+	hypothetical protein	NA	NA	NA	NA
WP_003640966.1\|578455_579475_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640967.1\|579499_579847_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003643942.1\|579945_580842_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	9.9e-82	55.7
WP_003640969.1\|580845_581631_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355240.1\|581769_582765_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5

DBSCAN-SWA_3

1236223 : 1248189

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643099.1\|1236223_1237171_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_003643097.1\|1237514_1238129_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_063720948.1\|1238131_1240570_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.8
WP_003643095.1\|1240657_1241218_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_003643094.1\|1241288_1241729_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_142262790.1\|1242073_1242541_+	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	3.0e-82	98.7
WP_053566592.1\|1242515_1243490_+	hypothetical protein	A0A2P0ZL95	Lactobacillus_phage	5.0e-31	90.7
WP_047673279.1\|1243593_1243803_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003640226.1\|1245915_1248189_-	HAD-IC family P-type ATPase	M1HX51	Paramecium_bursaria_Chlorella_virus	1.3e-37	23.5

DBSCAN-SWA_4

1732928 : 1817758

Lactobacillus_phage(71.43%)

holin,protease,integrase,capsid,transposase,terminase,portal,head,tail,tRNA

attL 1758503:1758520|attR 1824697:1824714

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640716.1\|1732928_1733852_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003640717.1\|1734329_1734851_-	shikimate kinase	NA	NA	NA	NA
WP_142262826.1\|1734853_1735951_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_013355606.1\|1735953_1737252_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_003645964.1\|1737265_1737793_-	amino acid biosynthesis protein	NA	NA	NA	NA
WP_013355607.1\|1737801_1738971_-	chorismate synthase	NA	NA	NA	NA
WP_015825652.1\|1738963_1740418_-	MFS transporter	NA	NA	NA	NA
WP_003640723.1\|1741066_1741420_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_024002734.1\|1741442_1744019_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640725.1\|1744033_1744339_-	hypothetical protein	NA	NA	NA	NA
WP_142262827.1\|1744328_1744628_-	DUF448 domain-containing protein	NA	NA	NA	NA
WP_024002732.1\|1744672_1745890_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_063722222.1\|1745910_1746387_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640729.1\|1746682_1750996_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640732.1\|1751489_1753199_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640733.1\|1753238_1754516_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640734.1\|1754553_1755339_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_015825653.1\|1755354_1756134_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_003640736.1\|1756253_1756817_-	ribosome recycling factor	NA	NA	NA	NA
WP_003640737.1\|1756818_1757541_-	UMP kinase	NA	NA	NA	NA
WP_003644498.1\|1757740_1758619_-	elongation factor Ts	NA	NA	NA	NA
1758503:1758520	attL	NA	NA	NA	NA
WP_003640739.1\|1758721_1759525_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|1759749_1760472_+	HAD family hydrolase	NA	NA	NA	NA
WP_142262828.1\|1760695_1762363_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	6.1e-93	41.5
WP_142262829.1\|1762533_1763532_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	3.0e-47	34.9
WP_003640742.1\|1763616_1763922_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003644499.1\|1763905_1764664_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003645630.1\|1764775_1765411_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640745.1\|1765467_1765704_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|1765801_1766041_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640747.1\|1766192_1766825_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_003644502.1\|1767379_1768009_+	hypothetical protein	NA	NA	NA	NA
WP_021356901.1\|1768058_1769228_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_024272621.1\|1769275_1769656_-	hypothetical protein	NA	NA	NA	NA
WP_003644503.1\|1769819_1770212_+	hypothetical protein	NA	NA	NA	NA
WP_003640752.1\|1770657_1771599_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	2.4e-78	49.0
WP_031275254.1\|1772350_1772923_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_142262830.1\|1773074_1774250_-	LytR family transcriptional regulator	NA	NA	NA	NA
WP_003644506.1\|1774230_1775022_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.7e-30	36.8
WP_003644507.1\|1775040_1776783_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_063487841.1\|1777261_1778473_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_142262831.1\|1779214_1779748_-\|holin	holin	E9LUS0	Lactobacillus_phage	1.9e-40	97.9
WP_142262832.1\|1779759_1780023_-\|holin	holin	E9LUR9	Lactobacillus_phage	6.3e-37	97.7
WP_142262833.1\|1780022_1781204_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	5.1e-195	88.0
WP_142262834.1\|1781215_1781575_-	hypothetical protein	E9LUR7	Lactobacillus_phage	1.4e-42	74.8
WP_114648165.1\|1781723_1781975_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	9.3e-30	95.8
WP_142262835.1\|1781967_1784541_-\|tail	phage tail protein	A0A2K9VCB6	Lactobacillus_phage	8.0e-294	55.8
WP_142262836.1\|1784557_1786972_-	hypothetical protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	92.2
WP_142262837.1\|1787036_1788812_-\|tail	phage tail protein	A0A2P0ZLH2	Lactobacillus_phage	0.0e+00	97.5
WP_142262838.1\|1788888_1793628_-	peptidase M23	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	72.5
WP_003644519.1\|1793659_1793851_-	hypothetical protein	NA	NA	NA	NA
WP_003644520.1\|1793889_1794264_-	hypothetical protein	A0A2P0ZLH4	Lactobacillus_phage	3.2e-58	96.0
WP_063494099.1\|1794340_1794994_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	3.3e-111	94.0
WP_103420072.1\|1795010_1795391_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	4.5e-60	91.3
WP_142262839.1\|1795390_1795798_-	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	2.0e-66	94.7
WP_063494096.1\|1795800_1796148_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	9.2e-44	73.0
WP_061876148.1\|1796137_1796470_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	1.4e-44	83.6
WP_142262840.1\|1796542_1797775_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	6.7e-206	90.7
WP_142263025.1\|1797774_1798533_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	2.5e-126	94.0
WP_142262841.1\|1798510_1799704_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	2.0e-223	98.2
WP_016058325.1\|1799706_1799901_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	2.5e-27	100.0
WP_142262842.1\|1799890_1801789_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	92.4
WP_016511011.1\|1801798_1802254_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	3.0e-79	96.7
WP_072539991.1\|1802442_1802694_-	hypothetical protein	NA	NA	NA	NA
WP_063494092.1\|1802714_1802981_-	hypothetical protein	NA	NA	NA	NA
WP_142263026.1\|1802986_1803457_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	1.0e-82	91.7
WP_142262843.1\|1803621_1803936_-	hypothetical protein	NA	NA	NA	NA
WP_114648180.1\|1804752_1805178_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	2.3e-60	78.0
WP_142262844.1\|1805452_1805761_-	hypothetical protein	E9LUN7	Lactobacillus_phage	6.6e-46	91.2
WP_114648182.1\|1805917_1806793_-	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	6.3e-49	41.2
WP_142262845.1\|1806786_1807590_-	replisome organizer	E9LUM6	Lactobacillus_phage	6.4e-40	56.9
WP_142262846.1\|1808449_1808650_-	hypothetical protein	E9LUT7	Lactobacillus_phage	5.8e-27	90.9
WP_114648186.1\|1808652_1808901_-	tagatose-bisphosphate aldolase	E9LUT6	Lactobacillus_phage	3.2e-35	83.0
WP_114648187.1\|1809066_1809357_+	hypothetical protein	NA	NA	NA	NA
WP_114648188.1\|1809442_1809706_+	SinR family protein	A0A0M3LS55	Mannheimia_phage	1.8e-12	43.5
WP_114648189.1\|1809949_1810210_-	hypothetical protein	NA	NA	NA	NA
WP_057704943.1\|1810343_1810553_-	hypothetical protein	NA	NA	NA	NA
WP_142262847.1\|1810836_1811181_+	hypothetical protein	NA	NA	NA	NA
WP_114648191.1\|1811177_1811378_-	hypothetical protein	NA	NA	NA	NA
WP_114648192.1\|1811390_1811600_-	hypothetical protein	NA	NA	NA	NA
WP_142262848.1\|1811620_1812328_-	phage regulatory protein	D2IYT0	Enterococcus_phage	3.6e-63	58.3
WP_063845781.1\|1812334_1812538_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_114648194.1\|1812794_1813214_+	helix-turn-helix transcriptional regulator	A0A0M4QX29	Bacillus_phage	3.1e-30	48.6
WP_142262849.1\|1813225_1813660_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	3.0e-07	35.2
WP_142262850.1\|1813734_1814469_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	1.4e-41	54.5
WP_114648197.1\|1814471_1814690_+	hypothetical protein	NA	NA	NA	NA
WP_114648198.1\|1814853_1815084_+	hypothetical protein	NA	NA	NA	NA
WP_142262851.1\|1815276_1815591_+	hypothetical protein	NA	NA	NA	NA
WP_142262852.1\|1815787_1816363_-	hypothetical protein	NA	NA	NA	NA
WP_044431056.1\|1816594_1817758_+\|integrase	site-specific integrase	E9LUK6	Lactobacillus_phage	5.1e-62	37.1
1824697:1824714	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2112251 : 2176929

Lactobacillus_phage(36.36%)

holin,protease,integrase,capsid,transposase,terminase,portal,head,tail

attL 2159506:2159527|attR 2174263:2174284

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025015693.1\|2112251_2112626_-\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	2.2e-19	67.9
WP_016511341.1\|2112612_2112909_-	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	4.4e-39	77.6
WP_102170888.1\|2112909_2114043_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	2.4e-32	77.4
WP_003642832.1\|2114203_2114638_-	hypothetical protein	NA	NA	NA	NA
WP_142262872.1\|2114640_2115090_-	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	1.0e-23	39.9
WP_142262873.1\|2115096_2120496_-	hypothetical protein	Q6SE68	Lactobacillus_prophage	1.4e-143	59.7
WP_046947688.1\|2120510_2120873_-	hypothetical protein	V5UQS8	Oenococcus_phage	1.9e-44	71.2
WP_142262874.1\|2120886_2126718_-\|tail	phage tail protein	V5URV5	Oenococcus_phage	7.3e-218	40.4
WP_031275283.1\|2126733_2126997_-	hypothetical protein	V9QKH3	Oenococcus_phage	2.3e-23	65.4
WP_003642826.1\|2127104_2127503_-	hypothetical protein	V9QJA0	Oenococcus_phage	3.0e-46	74.8
WP_099447638.1\|2127602_2127986_-\|tail	phage tail protein	V5USQ9	Oenococcus_phage	1.8e-37	58.4
WP_003642824.1\|2128087_2128453_-	hypothetical protein	V5UQS4	Oenococcus_phage	3.0e-29	53.4
WP_119463096.1\|2128452_2129004_-	HK97 gp10 family phage protein	V5URV0	Oenococcus_phage	9.7e-64	61.7
WP_003642822.1\|2129005_2129353_-	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
WP_024971556.1\|2129352_2129685_-	hypothetical protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
WP_044431356.1\|2129696_2129873_-	hypothetical protein	NA	NA	NA	NA
WP_003642819.1\|2129885_2130908_-	hypothetical protein	V5US24	Oenococcus_phage	3.7e-117	62.5
WP_069710578.1\|2130927_2131278_-	hypothetical protein	V5UTH9	Oenococcus_phage	1.3e-29	63.8
WP_142262875.1\|2131292_2131970_-	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	9.3e-16	32.1
WP_003642816.1\|2132142_2132349_-	hypothetical protein	NA	NA	NA	NA
WP_003642815.1\|2132400_2132679_-	hypothetical protein	NA	NA	NA	NA
WP_024971553.1\|2132653_2134339_-	hypothetical protein	V5US81	Oenococcus_phage	3.1e-121	59.1
WP_021356226.1\|2134485_2134782_-\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	5.6e-10	39.2
WP_142262876.1\|2134711_2136220_-\|portal	phage portal protein	V5US18	Oenococcus_phage	9.0e-136	51.6
WP_063964073.1\|2136231_2137470_-\|terminase	PBSX family phage terminase large subunit	M1PG09	Streptococcus_phage	8.4e-140	61.5
WP_013355739.1\|2137459_2137987_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	4.5e-58	75.7
WP_074161525.1\|2138435_2139035_-	hypothetical protein	NA	NA	NA	NA
WP_114674219.1\|2139320_2139530_+	KTSC domain-containing protein	NA	NA	NA	NA
WP_114674220.1\|2139526_2139694_-	BC1881 family protein	NA	NA	NA	NA
WP_128531304.1\|2139917_2140379_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	8.2e-40	57.0
WP_123808449.1\|2140601_2140913_-	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	3.8e-49	92.2
WP_064578080.1\|2140915_2141290_-	hypothetical protein	NA	NA	NA	NA
WP_119463101.1\|2141286_2141805_-	hypothetical protein	O03915	Lactobacillus_phage	3.8e-54	67.8
WP_119463102.1\|2141809_2142532_-	oxidoreductase	A0A141E1D3	Streptococcus_phage	5.5e-51	46.4
WP_003642800.1\|2142528_2142816_-	hypothetical protein	NA	NA	NA	NA
WP_046811046.1\|2142812_2143721_-	DnaD domain protein	NA	NA	NA	NA
WP_080373216.1\|2143799_2144672_-	hypothetical protein	A0A0P0IZH9	Lactobacillus_phage	1.9e-74	50.8
WP_003642797.1\|2144583_2145483_-	recombinase RecT	E9LUM3	Lactobacillus_phage	3.2e-64	53.7
WP_072533949.1\|2145479_2145866_-	hypothetical protein	NA	NA	NA	NA
WP_072533950.1\|2145998_2146169_-	hypothetical protein	NA	NA	NA	NA
WP_142262877.1\|2146226_2146472_-	hypothetical protein	NA	NA	NA	NA
WP_123808459.1\|2146487_2147000_-	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	4.0e-27	42.9
WP_003642793.1\|2147067_2147373_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_011101086.1\|2147713_2147914_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101085.1\|2148060_2148297_+	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-09	30.7
WP_003642787.1\|2148334_2148649_+	hypothetical protein	NA	NA	NA	NA
WP_011101083.1\|2148721_2148952_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101082.1\|2149124_2149487_+	helix-turn-helix domain-containing protein	A0A0U4KKM4	Exiguobacterium_phage	2.6e-09	32.0
WP_033608843.1\|2149498_2149912_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	1.5e-05	32.1
WP_021356377.1\|2149937_2151284_+	DUF4041 domain-containing protein	A0A1B0Y697	Lactobacillus_phage	3.5e-83	53.2
WP_033608844.1\|2151333_2151894_+	DUF5067 domain-containing protein	Q6SEF8	Lactobacillus_prophage	4.6e-45	65.9
WP_021356375.1\|2151948_2152284_+	hypothetical protein	A0A1B0Y4P2	Lactobacillus_phage	9.2e-25	52.2
WP_033608845.1\|2152405_2153125_+	hypothetical protein	NA	NA	NA	NA
WP_142262878.1\|2153809_2154889_+	hypothetical protein	NA	NA	NA	NA
WP_142262879.1\|2156136_2157231_+	hypothetical protein	NA	NA	NA	NA
WP_142262880.1\|2157520_2158642_+\|integrase	tyrosine-type recombinase/integrase	D6PSS4	Lactobacillus_phage	3.7e-46	32.1
WP_003642774.1\|2158992_2159199_-	hypothetical protein	NA	NA	NA	NA
2159506:2159527	attL	NA	NA	NA	NA
WP_142262881.1\|2159648_2160590_+	hypothetical protein	NA	NA	NA	NA
WP_142262882.1\|2160663_2161038_-	hypothetical protein	NA	NA	NA	NA
WP_142262883.1\|2161187_2161463_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_142262884.1\|2161877_2163458_-\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	5.7e-40	26.5
WP_142262885.1\|2163447_2164554_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	6.1e-49	33.3
WP_022638528.1\|2164554_2164755_-	hypothetical protein	NA	NA	NA	NA
WP_142262886.1\|2164708_2166412_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	1.4e-121	40.5
WP_142262887.1\|2166408_2166882_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_142262888.1\|2167570_2167960_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	6.1e-20	45.2
WP_142262889.1\|2167952_2168294_-\|head	phage head closure protein	NA	NA	NA	NA
WP_142262890.1\|2168280_2168592_-	hypothetical protein	NA	NA	NA	NA
WP_142262891.1\|2168615_2169035_-	hypothetical protein	NA	NA	NA	NA
WP_142262892.1\|2169179_2170574_-	virulence protein	A0A1W6JQD6	Staphylococcus_phage	5.7e-68	41.1
WP_142262893.1\|2170573_2171374_-	DNA replication protein	NA	NA	NA	NA
WP_142262894.1\|2171370_2171589_-	hypothetical protein	NA	NA	NA	NA
WP_041153405.1\|2171721_2171829_-	hypothetical protein	NA	NA	NA	NA
WP_142262895.1\|2171871_2172054_-	DNA-binding protein	NA	NA	NA	NA
WP_142262896.1\|2172022_2172871_+	helix-turn-helix domain-containing protein	Q20DG0	Lactobacillus_phage	9.5e-10	41.9
WP_142262897.1\|2172928_2174086_+\|integrase	tyrosine-type recombinase/integrase	Q938N9	Temperate_phage	1.3e-54	35.1
WP_003642773.1\|2174575_2174809_+	hypothetical protein	NA	NA	NA	NA
2174263:2174284	attR	NA	NA	NA	NA
WP_003642772.1\|2174833_2175106_+	hypothetical protein	NA	NA	NA	NA
WP_142262898.1\|2175264_2176929_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	2.7e-93	41.3

DBSCAN-SWA_6

2375679 : 2384193

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|2375679_2376258_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_003645866.1\|2376250_2377276_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-59	41.0
WP_142262910.1\|2377272_2378727_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	6.6e-51	34.2
WP_142262911.1\|2378711_2380931_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_011101895.1\|2380923_2381604_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2381603_2381858_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_142262912.1\|2381859_2382591_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	3.5e-37	36.9
WP_142262913.1\|2382593_2383724_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642585.1\|2383707_2384193_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage