CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP041242	Lysobacter alkalisoli strain SJ-36 chromosome, complete genome	2 crisprs	cas3,csa3,Cas9_archaeal,DEDDh,DinG,RT,WYL	0	10	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041242_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041242_1

238982-239336

Orphan

Consensus_repeat	Method
GATGCTGCCGTTGACGGTTTCCAGG	CRISPRCasFinder
GATGCTGCCGTTGACGGTTTCC	PILER-CR

6 spacers

The CRISPR arrays of NZ_CP041242_1

>merge|NZ_CP041242|1|238982-239336|CRISPRCasFinder,PILER-CR
GAGGTCGCCGGTGACGGTTTCGATGTCGCCGCCGACACGCGCGGCGACCAGGCCGATGGCGCCATTCACGGTTTCGATGCCTTCGGCGATGCGGCCGTCACGGCCGACGAAGATGCTGCCGTTGACGGTTTCCAGGTCACCGTCGACCTCGACCTGCTCCTCCAGCCTGATGCTGCCGTTGACGGTTTCCAGGCTGCCGGTACGGGCCGAGTTTCCAGCCTTGATGCTGCCGTTGACGGTTTCGGCGTTGCGGACCCGGGCACCGGCGCCGATCCGGATGCTGCCGTTGACCGTTTCCAGTGAGCCGTATTCCTGCCCGGCCTCGGCGGTGATGCTGCCGTTGACCTTGCTGATG

>NZ_CP041242|1|1|238982-239336|CRISPRCasFinder
GAGGTCGCCGGTGACGGTTTCGATG	TCGCCGCCGACACGCGCGGCGACCAGGCC
GATGGCGCCATTCACGGTTTCGATG	CCTTCGGCGATGCGGCCGTCACGGCCGACGAA
GATGCTGCCGTTGACGGTTTCCAGG	TCACCGTCGACCTCGACCTGCTCCTCCAGCCT
GATGCTGCCGTTGACGGTTTCCAGG	CTGCCGGTACGGGCCGAGTTTCCAGCCTT
GATGCTGCCGTTGACGGTTTCGGCG	TTGCGGACCCGGGCACCGGCGCCGATCCG
GATGCTGCCGTTGACCGTTTCCAGT	GAGCCGTATTCCTGCCCGGCCTCGGCGGT
GATGCTGCCGTTGACCTTGCTGATG

>NZ_CP041242|1|1|239093-239279|PILER-CR
GATGCTGCCGTTGACGGTTTCC	AGGTCACCGTCGACCTCGACCTGCTCCTCCAGCCT
GATGCTGCCGTTGACGGTTTCC	AGGCTGCCGGTACGGGCCGAGTTTCCAGCCTT
GATGCTGCCGTTGACGGTTTCG	GCGTTGCGGACCCGGGCACCGGCGCCGATCCG
GATGCTGCCGTTGACCGTTTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041242.1\|WP_141622196.1\|242468_243845_+\|PDZ-domain-containing-protein	unknown	unknown	gnl\|CDD\|223864
NZ_CP041242.1\|WP_141622194.1\|239586_241128_+\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	unknown	unknown	gnl\|CDD\|235463
NZ_CP041242.1\|WP_141622190.1\|234585_235638_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|183677
NZ_CP041242.1\|WP_141622184.1\|218035_218710_-\|orotate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234771
NZ_CP041242.1\|WP_141622188.1\|222687_224133_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|223810
NZ_CP041242.1\|WP_167284871.1\|245559_246909_+\|porin	unknown	unknown	gnl\|CDD\|367457
NZ_CP041242.1\|WP_141622187.1\|221477_222629_-\|anhydro-N-acetylmuramic-acid-kinase	unknown	unknown	gnl\|CDD\|236579
NZ_CP041242.1\|WP_141622198.1\|244609_245281_-\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|366759
NZ_CP041242.1\|WP_141622186.1\|219645_221085_+\|AmpG-family-muropeptide-MFS-transporter	unknown	unknown	gnl\|CDD\|341039
NZ_CP041242.1\|WP_141622192.1\|236581_238300_-\|M28-family-peptidase	unknown	unknown	gnl\|CDD\|349910
NZ_CP041242.1\|WP_141622203.1\|258853_259078_-\|twin-transmembrane-helix-small-protein	unknown	unknown	gnl\|CDD\|378564
NZ_CP041242.1\|WP_141624969.1\|232041_233877_-\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173790
NZ_CP041242.1\|WP_141622200.1\|255335_256949_+\|cytochrome-c-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|238833
NZ_CP041242.1\|WP_141622191.1\|235669_236416_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370779
NZ_CP041242.1\|WP_141622195.1\|241127_242342_+\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|227278
NZ_CP041242.1\|WP_141622185.1\|218833_219649_+\|exodeoxyribonuclease-III	unknown	unknown	gnl\|CDD\|197336
NZ_CP041242.1\|WP_141622197.1\|243889_244414_-\|CHRD-domain-containing-protein	unknown	unknown	gnl\|CDD\|377837
NZ_CP041242.1\|WP_141622189.1\|224321_225545_+\|tyrosine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235645
NZ_CP041242.1\|WP_141622202.1\|257811_258690_+\|cytochrome-c-oxidase-subunit-3	unknown	unknown	gnl\|CDD\|238834
NZ_CP041242.1\|WP_141622201.1\|257158_257785_+\|cytochrome-c-oxidase-assembly-protein	unknown	unknown	gnl\|CDD\|235341

Protein	Function_ID	Function_description	E-value
NZ_CP041242.1\|WP_141622196.1\|242468_243845_+\|PDZ-domain-containing-protein	gnl\|CDD\|223864	COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane].	1.0805e-116
NZ_CP041242.1\|WP_141622194.1\|239586_241128_+\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	gnl\|CDD\|235463	PRK05434, PRK05434, 2,3-bisphosphoglycerate-independent phosphoglycerate mutase.	0
NZ_CP041242.1\|WP_141622190.1\|234585_235638_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|183677	PRK12680, PRK12680, LysR family transcriptional regulator.	1.42695e-106
NZ_CP041242.1\|WP_141622184.1\|218035_218710_-\|orotate-phosphoribosyltransferase	gnl\|CDD\|234771	PRK00455, pyrE, orotate phosphoribosyltransferase; Validated.	9.22727e-73
NZ_CP041242.1\|WP_141622188.1\|222687_224133_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|223810	COG0739, NlpD, Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane].	1.17073e-46
NZ_CP041242.1\|WP_167284871.1\|245559_246909_+\|porin	gnl\|CDD\|367457	pfam03349, Toluene_X, Outer membrane protein transport protein (OMPP1/FadL/TodX). This family includes TodX from Pseudomonas putida F1 and TbuX from Ralstonia pickettii PKO1. These are membrane proteins of uncertain function that are involved in toluene catabolism. Related proteins involved in the degradation of similar aromatic hydrocarbons are also in this family, such as CymD. This family also includes FadL involved in translocation of long-chain fatty acids across the outer membrane. It is also a receptor for the bacteriophage T2.	7.5184e-105
NZ_CP041242.1\|WP_141622187.1\|221477_222629_-\|anhydro-N-acetylmuramic-acid-kinase	gnl\|CDD\|236579	PRK09585, anmK, anhydro-N-acetylmuramic acid kinase; Reviewed.	0
NZ_CP041242.1\|WP_141622198.1\|244609_245281_-\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|366759	pfam01694, Rhomboid, Rhomboid family. This family contains integral membrane proteins that are related to Drosophila rhomboid protein. Members of this family are found in bacteria and eukaryotes. Rhomboid promotes the cleavage of the membrane-anchored TGF-alpha-like growth factor Spitz, allowing it to activate the Drosophila EGF receptor. Analysis has shown that Rhomboid-1 is an intramembrane serine protease (EC:3.4.21.105). Parasite-encoded rhomboid enzymes are also important for invasion of host cells by Toxoplasma and the malaria parasite.	6.47073e-23
NZ_CP041242.1\|WP_141622186.1\|219645_221085_+\|AmpG-family-muropeptide-MFS-transporter	gnl\|CDD\|341039	cd17486, MFS_AmpG_like, AmpG and similar transporters of the Major Facilitator Superfamily. AmpG acts as an inner membrane permease in the beta-lactamase induction system and in peptidoglycan recycling. It transports meuropeptide from the periplasm into the cytosol in gram-negative bacteria, which is essential for the induction of the ampC encoding beta-lactamase. The AmpG family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.32814e-107
NZ_CP041242.1\|WP_141622192.1\|236581_238300_-\|M28-family-peptidase	gnl\|CDD\|349910	cd05660, M28_like_PA, M28 Zn-peptidase containing a protease-associated (PA) domain insert. Peptidase family M28 (also called aminopeptidase Y family), uncharacterized subfamily. The M28 family contains aminopeptidases as well as carboxypeptidases. They have co-catalytic zinc ions; each zinc ion is tetrahedrally co-ordinated, with three amino acid ligands plus activated water; one aspartate residue binds both metal ions. This subfamily is composed of uncharacterized proteins containing a protease-associated (PA) domain insert which may participate in substrate binding and/or promote conformational changes, influencing the stability and accessibility of the site to substrate.	4.19109e-104
NZ_CP041242.1\|WP_141622203.1\|258853_259078_-\|twin-transmembrane-helix-small-protein	gnl\|CDD\|378564	pfam11137, DUF2909, Protein of unknown function (DUF2909). This is a family of proteins conserved in Proteobacteria of unknown function.	3.21335e-16
NZ_CP041242.1\|WP_141624969.1\|232041_233877_-\|S8-family-serine-peptidase	gnl\|CDD\|173790	cd04077, Peptidases_S8_PCSK9_ProteinaseK_like, Peptidase S8 family domain in ProteinaseK-like proteins. The peptidase S8 or Subtilase clan of proteases have a Asp/His/Ser catalytic triad that is not homologous to trypsin. This CD contains several members of this clan including: PCSK9 (Proprotein convertase subtilisin/kexin type 9), Proteinase_K, Proteinase_T, and other subtilisin-like serine proteases. PCSK9 posttranslationally regulates hepatic low-density lipoprotein receptors (LDLRs) by binding to LDLRs on the cell surface, leading to their degradation. The binding site of PCSK9 has been localized to the epidermal growth factor-like repeat A (EGF-A) domain of the LDLR. Characterized Proteinases K are secreted endopeptidases with a high degree of sequence conservation. Proteinases K are not substrate-specific and function in a wide variety of species in different pathways. It can hydrolyze keratin and other proteins with subtilisin-like specificity. The number of calcium-binding motifs found in these differ. Proteinase T is a novel proteinase from the fungus Tritirachium album Limber. The amino acid sequence of proteinase T as deduced from the nucleotide sequence is about 56% identical to that of proteinase K.	7.83713e-135
NZ_CP041242.1\|WP_141622200.1\|255335_256949_+\|cytochrome-c-oxidase-subunit-I	gnl\|CDD\|238833	cd01663, Cyt_c_Oxidase_I, Cytochrome C oxidase subunit I. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, may play a role in assembly or oxygen delivery to the active site. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit I contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme (heme a3) and a copper ion (CuB). It also contains a low-spin heme (heme a), believed to participate in the transfer of electrons to the binuclear center. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from cytochrome c on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electrons are transferred from cytochrome c (the electron donor) to heme a via the CuA binuclear site in subunit II, and directly from heme a to the binuclear center.	0
NZ_CP041242.1\|WP_141622191.1\|235669_236416_-\|hypothetical-protein	gnl\|CDD\|370779	pfam10014, 2OG-Fe_Oxy_2, 2OG-Fe dioxygenase. This family contains 2-oxoglutarate (2OG) and Fe-dependent dioxygenases. It includes L-isoleucine dioxygenase (IDO).	8.13295e-83
NZ_CP041242.1\|WP_141622195.1\|241127_242342_+\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|227278	COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning].	1.16681e-79
NZ_CP041242.1\|WP_141622185.1\|218833_219649_+\|exodeoxyribonuclease-III	gnl\|CDD\|197336	cd10281, Nape_like_AP-endo, Neisseria meningitides Nape-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases. This subfamily includes Neisseria meningitides Nape and related proteins. These are Escherichia coli exonuclease III (ExoIII)-like AP endonucleases and belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. AP endonucleases participate in the DNA base excision repair (BER) pathway. AP sites are one of the most common lesions in cellular DNA. During BER the damaged DNA is first recognized by DNA glycosylase. AP endonucleases then catalyze the hydrolytic cleavage of the phosphodiester bond 5' to the AP site, and this is followed by the coordinated actions of DNA polymerase, deoxyribose phosphatase, and DNA ligase. If left unrepaired, AP sites block DNA replication, and have both mutagenic and cytotoxic effects. AP endonucleases can carry out a variety of excision and incision reactions on DNA, including 3'-5' exonuclease, 3'-deoxyribose phosphodiesterase, 3'-phosphatase, and occasionally, nonspecific DNase activities. Different AP endonuclease enzymes catalyze the different reactions with different efficiences. Many organisms have two AP endonucleases, usually one is the dominant AP endonuclease, the other has weak AP endonuclease activity; for example, Neisseria meningitides Nape and NExo. Nape, found in this subfamily, is the dominant AP endonuclease. It exhibits strong AP endonuclease activity, and also exhibits 3'-5'exonuclease and 3'-deoxyribose phosphodiesterase activities.	6.64437e-139
NZ_CP041242.1\|WP_141622197.1\|243889_244414_-\|CHRD-domain-containing-protein	gnl\|CDD\|377837	pfam07452, CHRD, CHRD domain. CHRD (after SWISS-PROT abbreviation for chordin) is a novel domain identified in chordin, an inhibitor of bone morphogenetic proteins. This family includes bacterial homologs. It is anticipated to have an immunoglobulin-like beta-barrel structure based on limited similarity to superoxide dismutases but, as yet, no clear functional prediction can be made. Its most conserved feature is a GE[I/L]RCG[V/I/L] motif towards its C-terminal end Most bacterial proteins in this family have only one CHRD domain, whereas it is found repeated in many eukaryotic proteins such as human chordin and Drosophila SOG..	3.34751e-19
NZ_CP041242.1\|WP_141622189.1\|224321_225545_+\|tyrosine--tRNA-ligase	gnl\|CDD\|235645	PRK05912, PRK05912, tyrosyl-tRNA synthetase; Validated.	0
NZ_CP041242.1\|WP_141622202.1\|257811_258690_+\|cytochrome-c-oxidase-subunit-3	gnl\|CDD\|238834	cd01665, Cyt_c_Oxidase_III, Cytochrome c oxidase subunit III. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. CcO catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, is believed to play a role in assembly of the multimer complex. Rhodobacter CcO subunit III stabilizes the integrity of the binuclear center in subunit I. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit III contains bound phospholipids in several crystal structures and is proposed to contain a "lipid pool." These phospholipids are believed to intrinsic constituents similar to cofactors of the enzyme.	6.02133e-95
NZ_CP041242.1\|WP_141622201.1\|257158_257785_+\|cytochrome-c-oxidase-assembly-protein	gnl\|CDD\|235341	PRK05089, PRK05089, cytochrome C oxidase assembly protein; Provisional.	1.39542e-77

>NZ_CP041242.1|WP_141622192.1|236581_238300_-|M28-family-peptidase
MSRTPLSAATSLVAAALVLSACSPTPPETSTDIATAADSSPHAFSADINVADFAERVKTLASDEFEGRAPGSIGESRTLAYLKGQFEAMGLQPGHDGSWFQTVPMVETTADEAQTTLTLDVKGESRALAFGDDMVIGTRSGQPEVKIDASDLVFVGYGVNAPERDWNDYEGIDVTGKTVVMFVNDPGFHANDESLFDGKRMTYYGRWTYKYEEAARQGAAAAIIIHDDAGASYGWGVVKNSWSGAQFDLKAEDDPEPRLAAQGWITGDVARSLLADLDHDLDALYTAANKPGFRPIPLDARMSLELKSTIAEKESKNVVAMLPGSSRPDEAVVYMAHWDHLGNHADSATGGEDHIYNGAVDNATGVAGIMEIAEAFAAQEPAPERSLLFIAVTLEESGLLGSKYYVAHPSIPLANTVGVINLDAMPVIGPSRDMSVVGLGNSELEDILKTHADAQGRVLVPEGAVEAGYYFRSDHFNFAKAGVPALYAKGGDDLVDGGVEAGQAAQRDYRDNRYHKPADEFSADWNMDGVMQDLEALYGVGRDLAGSDRWPRWYEGNAFRAAQDKLIEVRSR
>NZ_CP041242.1|WP_141622191.1|235669_236416_-|hypothetical-protein
MTSSTDPGTRHADRLRQQGFDFIESGAMRDWLAATGPLDDWPRFAASWGDLAPDTYLAKLGRHRRRRHAVFSLDGIGHPAPAIRREPHQPHYQSLDYNPLQGDIERWFEPIEAAAGDSRSLHTVLRCCQQFFGALSPQVPRWHAEVHQFRIEARADAPGQPTPEGMHRDGVDHVLVLLIERQNIASGTTRIHALDGRELGHFTLTAPFDAALVDDHRVLHGVTAVEPLDPAQPAHRDVLVVTLRAAAV
>NZ_CP041242.1|WP_141622190.1|234585_235638_+|LysR-family-transcriptional-regulator
MTLKELRCLLAIVDAELNISAAAQLMHATQPSLSRHLKLLEEELGFRLFFRHGRSLTGVTPAGHEVIRIARRIVNDAASIRSYAANIRGEGSGELLLTTPQTYARHVLPPVLAELVKRYPRLNVRIQTLGEGDSAERQLQGGSDIVLVSTAGERVPPGVAIPLFCWKRVVLVPRAHRFAGLRRPLTLEEMACEALVTYDSSRRQDSSLRRALAQAGLEARFACSAQDADLIKVYVRAGLGVGLLGELAVEQADRENFAVLEAAPALPECVAWALLPPGCVARDYTLDLIKLLAPQLDLGEIRQALDGTARPAWPRPRPWWGLDAWPAPETVAKVTMRGTDGARIPPACLS
>NZ_CP041242.1|WP_141624969.1|232041_233877_-|S8-family-serine-peptidase
MLGMGIASAADAELRIAKQPVEGRYIVVLKEDAAALSGEVQTATGRSKPSVATVAREFAASRGKGKSRANVVHTYNKVLRGFVVEADDDALAALLADDRVAYVEEDGVVEAWATQNNATWGLDRIDQRDLPLNSTYVYDTTASNVHAYIIDTGIRSSHNDFGGRVGSGYTAINDGNGTNDCHGHGTHVAGTVGGTTWGVAKQVSLYPVRVLGCNGSGTNSGVIAGMDWVASNHTKPAVANMSLGGGASTSTDDAVTRMRNAGVTVVVAAGNDNSSACNYSPARSTSAITVGSTTSSDARSSFSNYGSCLDIFAPGSSITSAWSSSNTATNTISGTSMASPHVAGVAALYLAGNPGATPSQVTSAIINSSTPNKVTSPGSGSPNRLLYSRFDGTDPDPDPDPTPGELQNGVPVTISGASGSETRYTFTVPSGASGLTIATSGGSGDADLYVRYGSAPTTGSYDCRPYLNGNNETCSFNNPQAGTWHVMVRGYTAYSGVSLVASYESSSGAPCTGCTKYSGSLSGSGNSQVQPNGTYYQAAAGTHQGWLKGPSNADFDLELYRWNGSSWSRVARSIGSTSEEHISYNGTSGYYYWRILSYSGSGSYDFWLKTP
>NZ_CP041242.1|WP_141622189.1|224321_225545_+|tyrosine--tRNA-ligase
MSIQEALELIGRGADEILKQEELEARLGASMKAGGRPLRIKAGFDPTAPDLHIGHTVLLNKMRQFQDLGHTVIFLIGDFTGMIGDPTGKNVTRKPLTREDVLANARTYADQVFKVLDREKTEVRFNSEWFGEMGAADMIRLAAQHTVARMLERDDFAKRYAAQQPIAIHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRGLQEAHGQPPQIVLTMPLLEGLDGVQKMSKSLGNYIGIDEPAIDIVTKTMKIDDALMWRWIELLSFDIGVSEAATLKRDIEAGQLNPRDLKLRLARELAARFHDAAAAEQAVVGWNAAVRGEGDIAQLPLNDVAVPAEGLRIAALLTAAGLTPSNSEANRKLKERAVRIDGAVLEDAQRVFTPGFEGVLAVGKRNFARVRLVAA
>NZ_CP041242.1|WP_141622188.1|222687_224133_-|peptidoglycan-DD-metalloendopeptidase-family-protein
MTVPGSGQGRRERLKALREAALHRPVLARHLSDGFNGRWSRRQWVTASLFASMGLLVAAIVPGFDTDVTAPTHVPRQSMALALPPLPVRSEEEARGDSWHVVTVQPGQTLGQLFEEQGVPASLLQRILEQPSAKQALGRLRPGTELAFDLPVDGNGLRTFRFDRDDTARIELAINGDAIVENVIERPVETRTVVATGEISSSLYAAARKAGLSPAAIAVMTDQIFQYDIDFNTDIKRGDRFSVVMEENWREGERIGRGQILAATFTTGNKTHSGFRFEREGKAEYYTADGRPLKKSFIRMPIPYARLTSGFGARRHPVLGKVRQHKGVDYAAKTGTPIMAAGDARVQFVGWQGGYGRTVVLDHGRGYTTLYAHMSRFGNYKVGQRVPQGSVIGYVGTSGLSTGPHLHYEFRVNGVHRNPLSVTMPPPEPLRGQALAAFRAQTAPALARIQQVERLVYADAGGDTDAGNVAAAKPAGDGKKG
>NZ_CP041242.1|WP_141622187.1|221477_222629_-|anhydro-N-acetylmuramic-acid-kinase
MPDLPPGLFIGLISGTSADGIDAALVRFGPDARCELLAGSTHAWPDALRARLVEIGQGAKVDSLDEIATLDVQVGEAFAGAALRLLAEAGVAAGDITAIGSHGQTVRHRPAGAAYDGQHPFTWQIGDGHVIAERTGIATVSDFRRRDVAAGGHGAPLLPALHNALLRSPDEDRAVLNLGGIANLTLLPAASDGDVRGFDTGPANCLLDAWCLRHTGRAFDAGGVFAASGQIDETLLARLLDEPWFDAPAPKSTGREQFHLDWVQPRLGGDERVADVQATLLELSACTIADALLASQPTTQRVLACGGGVHNPRLLERIGARLPGVQVESTAAHGIDPDRMEAMGFAWLARQTLAGLPGNLPSVSGACGPRVLGVVHPASARPG
>NZ_CP041242.1|WP_141622186.1|219645_221085_+|AmpG-family-muropeptide-MFS-transporter
MSDLPGSPPSDTPAVPPAKADPVKPARPGWRDVLARLSEPKVLVMLLLGFSSGIPLYLVGNTLGFWMRENAIELSTIGFLSWVGIAYSLKFLWAPLIDKLDAPLFGRWLGRRRGWMLLSQIVVAVALIGMALVQPREGELVLAGIALDQLLVFGALALVVAFASATQDIVIDAWRIESADSNEQQGLLTSSATLGYRGALLVTDALILIMAAHIGWVVSYQLMAVLMAVGVFATLMAREPPASVQATLQSHPALFTPQGLFDALVGPFVAFFRQHGSWALLMLLVISLYRLPDFLMGPMANPFYADLGMDKEAVGSVRGTIGLVATIVGIAAAGLSAVRFGFMPTLIAGAVLGPGSNLAFSWLAMQGPSVSAFTIAMVIDNFCSGYAGVALIGYMSSLTNIGYTATQYALLSSFYALLGKVLKGFSGVAVEQLEVGRSLMEAYSLFFAGTALVGVPGVLLCILLAMRRPRAAGGGGAAA
>NZ_CP041242.1|WP_141622185.1|218833_219649_+|exodeoxyribonuclease-III
MKIISFNANGIRSAANKGFFDWFHAQDADVLCVQETKAQESQLVDACFRPDGHHCFYRDAITKKGYSGVAIHSRREPDEVRTALGWAPFDDEGRYIEARYGNLSVVSFYIPSGSSGELRQGFKFEVMDWLKPILDEWLASGRDYVLCGDWNIVRSALDIRNWKSNQKNSGCLPPEREWLNAQIGDDSGSDGTPSREGGWVDAYRALHPQGQDYTWWSNRGAARANNVGWRIDYQLVTPALAKRLKACSIAREPRFSDHAPFTVEFDGGLAR
>NZ_CP041242.1|WP_141622184.1|218035_218710_-|orotate-phosphoribosyltransferase
MSYKSRFLQLALDARALRFGEFTLKSGRLSPYFFNAGLFNTGTALAGLATCYADAIDAEGLAGSIKDFDLLFGPAYKGIPLATALACEYARRGRDLPVAFNRKEAKAHGEGGSLIGAPLGGRRVLVVDDVITAGTAIREALSIIRGAGGTPAGIVIALDRQEAVDPTVSRRSAAETVADEQGIPVVSVASLADLLAFTSADGTLADQQSRLLAYRDTYGSRTRG
>NZ_CP041242.1|WP_141622194.1|239586_241128_+|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase
MPENPASAIRPVVLLILDGWGHRDDPADNALAAAHLPNWDALLAAAPHTLIHTEGRHVGLPDGQMGNSEVGHMNLGAGRIVYQDLTRIDAAIEDGSFEKNAELLAACAAAKAGGGTLHLMGLLSPGGVHSHELHLLAMIELARREGVPKVAVHGFLDGRDTPPRSAAASIRALQAACEAAGNARIASLGGRYYAMDRDKRWDRVRKAWDAIVEATGQYRAPDAAAALAEAYARDENDEFVTPTVIGDGAPVHDGDAVVFMNFRADRARQLSAAFVAPGFDGFDVRRPALSRFVCLSEYDASLPAPVAFPPEDLRNTLGEVLEKNGMAQLRIAETEKYAHVTFFFSGGRELPYAGEERILIPSPQVATYDLQPEMSCPELTAKLVDAIRSSRFDIVICNIANPDMVGHTGVFEAAVKAAEAVDTAIGSIRAAVHEAGGALLVTADHGNLEMMRDPETGQPHTAHTVGPVPFAYDGPRKATLRSGGALRDVAPTILDLLGLPKPDEMSGQSLLEG
>NZ_CP041242.1|WP_141622195.1|241127_242342_+|peptidoglycan-DD-metalloendopeptidase-family-protein
MRRPCAMVLVAIALACATQLAGVLPAAAQNSRETERKLQQIKRELQSVAAERRKIEGERGAANRELRAADEKVAASSRRLREIELQLADEQASLESLHARRADMQQAMQGQREELAVLLRAAHAQGGEAPLKVLLSQDSVAEAQRVLTWHRYLQQDRVARVRELTAGLEELDAVERDITARQQQLQASREALDKQLVQLQADRRQRAELVAGLDSRYRDRRAREQALGRDAKGLEQLLTRLRAAAARAEAERRAAAERAARADGRPAPTPATVALGGPQVGGVGWPLTGALLAGYGARMPDGRKSDGLLLGANAGTAVKAVADGQVVYAEWMTGYGLLLIVDHGSGYMSLYAHNDALLKEAGDRIRRGDTVATVGNSGGHGRPALYFELRRNGQPVNPSVWLKR
>NZ_CP041242.1|WP_141622196.1|242468_243845_+|PDZ-domain-containing-protein
MKVRFPIPLAALLLVIAQCLGAVHAQDTEAPPTIEEQEAEDGVSDEAASEADAGEAASSAIPLDEIRRYVAVYSAIKQAYVEPVKDGDLMQSAIRGLLFDLDPHSVYFEKSRAEDFDEQSRGAYEGIGVELMRLPDGTLQVIAPIDDTPAQRAGLRSGDLITAIDGKSFKPDEGDTSAPLRGPAGSELTLTIVREGRDKPFDVTLQREVIRITSVRGNMLEPGYGYVRISAFQASTAADFEKQLGELKEQAGGRLRGLVIDLRSNPGGLLTSAVQIADDLLEEGVIVSTRGRLAISDAEFSATPGDRLDGAPVVVLVDAGSASASEVLAGALRDNGRARVVGSRTFGKGSVQTLLPLDNGDSVKLTTARYYTPSGRSIQAAGIVPDVLLHPDAGATNGGRARYVEATLPGHLSGSDEEVADEDRPSEVLEGDRHIDSALAELKKNVAVSPVPAQPARR
>NZ_CP041242.1|WP_141622197.1|243889_244414_-|CHRD-domain-containing-protein
MKHVTCCLPILLAGALYGLPVQAQTVHTDLRGYEEVPTLSTSASGAFRAHIDVKGQQIHFELSYDGLTGEVRQAHIHLGMRGVNGGVMVFLCQTAANPDPTGLSPMCPASGTVSGTITSAGVLGPAGQGVPAGGFDDLVAAIRASAAYVNVHTSAYPAGELRGQLGDPRNPRGF
>NZ_CP041242.1|WP_141622198.1|244609_245281_-|rhomboid-family-intramembrane-serine-protease
MFIAVPSRKKQPLRWATPLLLASLWLCFAWVTLQPASDQHHLLLEWGALSGGLAASSGGGWQRLFTALFLHADWVHLLGNLVFLLIFGLPAERSMGAWRLLLVFFLGGAVANLAATIAIHTPDGLIIGASGAVSALIGAYLALFPNAKLGVVLPLGLYLQFVRVPAPLLIGIWAVMQILFTWFGPAFGAVAWSAHLAGFAFGGVFALVSRAGIARRMRRRSGY
>NZ_CP041242.1|WP_167284871.1|245559_246909_+|porin
MQHVHRITRLSALALGITGALALGQAHASGFQLKENSVKSMGSAFAGAGVRTDDASVVVNNPATMTQFSGTTVQADVTVIDLNYKAGDLEGYDVLGRPLTGGDGGQAGDVTPVPAFSVVHKFDNGTAIGAMISAPFGLKTEYDRDWVGRYYAATSDVKIVDLTLSGAVDITDHFSVGIGAIFSHADVTLSKAVDFGTILMGQGVPLPFAQPQAADGFAKVQGDDTSFGWLIGANLRPTDKLAIGLSYRSEIDYELTGSVDWTVPGNVRATFDAVGAAALFQDGGVNAKLTTPSIMALDVRYQATDALSIGASYTETDWSSLREVRINFDGPDADSVEDFNWGDTRFWSVGVDYKLNEAWTLRAGYAYDETPTTFATRTPRLPDEDRRWYSLGATWTLSDALEVNFAYTYIDPDTPKIGLITPPQEGGHRLFGDFKGDAHLFGVSGQYRF
>NZ_CP041242.1|WP_141622200.1|255335_256949_+|cytochrome-c-oxidase-subunit-I
MAVTQVDHHHDDHAHKQGFIERWFFSTNHKDIGTLYLVFSFIMFIIGAAMSVVIRTELAQPGLQHVSPEFFNTMTTMHALVMIFGGVMPAFVGLANWMIPLQIGAPDMALPRMNNWSFWILPFAFTLLLMTLFMEGGGPASGWTLYPPLSLQGGNSVAFVIFAIHMMGISSIMGAINVIATILNMRAPGIDLLKMPIFCWTWLITAFLLIAVMPVLAGAVTMLLTDKFFMTSFFNAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIVSEIIPTFSRKPLFGYQAMVYATASIAFLSFIVWAHHMFTVGMPLGGEIYFMFATMLIAVPTGVKVFNWVTTMWRGSISFEAPMLWAISFVILFTIGGFSGLMLAIVPADFQYHDTYFVVAHFHYVLVTGALFAIIAAVYYWWPKWTGRMYNEGMAKFHFWWTMIFVNLLFFPQHFLGLAGMPRRIPDYNVVFADWNLISSIGAFGMFVTPFMMGFILWRSLKAGARAEARAWGSAKGLEWTVPSPAPHHTFSTPPKIKDGDLAHGDVTH
>NZ_CP041242.1|WP_141622201.1|257158_257785_+|cytochrome-c-oxidase-assembly-protein
MSASGSTGRMTVIMVGVGLCAFAFSFALVPLYRIACEKVFGIRLERSAVEGQVAALPVEERWVTVEFDGGVNSKLPWSFRPNQTTMRVQVGQPYDTTYYAHNDSDRIIVGSAVPSVAPARASGYFNKTECFCFTAQTLHAGETRDMPVRFIIDPALPADVSTVTLSYTFFKNDVLTERLALSNNDVPTTQQLAASPHGNAASAPRSAP
>NZ_CP041242.1|WP_141622202.1|257811_258690_+|cytochrome-c-oxidase-subunit-3
MAQAHSPDANVYFVPHSSRWPFLGSIALFVTMIGLASWMNDAGWGGPVFLFGAALMIGVLFGWFGDVIRESIGGHYNKQVDTSFRMGMVWFIFSEVMFFAAFFGALFYARQFALPWLGGEGDGMMTHSLLWESFSNAWPTSGPGAVGGSFETIPAWGLPLLNTLILLTSGVTVTIAHHAIKANHRGQLLLFLGLTVLLGCVFLFFQAEEYIHAYRDLNLTLGSGIYGSTFFMLTGFHGLHVTLGTIMLAVIWFRCLKGHFSKDDHFAFEAVAWYWHFVDVVWLGLFLFVYVL
>NZ_CP041242.1|WP_141622203.1|258853_259078_-|twin-transmembrane-helix-small-protein
MSDSLKTLLVIAFLIVILWNLGAGLYYMLVDKGGSKRTVNALTRRIALSIALILLVVLANYMGWIQFHGVGRNP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP041242_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041242_2

3586440-3586547

Orphan

Consensus_repeat	Method
GGCGTTCGTGCGGGCGCGAACCAATGGTTCGCAAACGCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041242_2

>merge|NZ_CP041242|2|3586440-3586547|CRISPRCasFinder
GGCGTTCGTGCGGGCGCGAACCAATGGTTCGCAAACGCCCTCCCCCCGGCCCTCGCGCATAGCGCTCGGGCGTTCGCGCGGGCGCGAACCAATGGTTCGCAAACGCCC

>NZ_CP041242|2|2|3586440-3586547|CRISPRCasFinder
GGCGTTCGTGCGGGCGCGAACCAATGGTTCGCAAACGCCC	TCCCCCCGGCCCTCGCGCATAGCGCTCG
GGCGTTCGCGCGGGCGCGAACCAATGGTTCGCAAACGCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041242.1\|WP_141624728.1\|3585223_3585703_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041242.1\|WP_141624734.1\|3590310_3590748_-\|rhodanese-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|238089
NZ_CP041242.1\|WP_141624730.1\|3586551_3587289_-\|3-oxoacyl-ACP-reductase-FabG	unknown	unknown	gnl\|CDD\|235546
NZ_CP041242.1\|WP_141624725.1\|3582635_3583361_+\|SURF1-family-protein	unknown	unknown	gnl\|CDD\|225883
NZ_CP041242.1\|WP_141624721.1\|3578076_3579129_+\|ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|213620
NZ_CP041242.1\|WP_141624729.1\|3585809_3586310_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041242.1\|WP_141624735.1\|3590904_3591309_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041242.1\|WP_141624732.1\|3588447_3589572_-\|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|234629
NZ_CP041242.1\|WP_141624722.1\|3579290_3581297_+\|cytochrome-o-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|131890
NZ_CP041242.1\|WP_141624726.1\|3583357_3584677_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP041242.1\|WP_141624733.1\|3589586_3590123_-\|protein-export-chaperone-SecB	unknown	unknown	gnl\|CDD\|180234
NZ_CP041242.1\|WP_141624731.1\|3587470_3588406_+\|oxygen-dependent-coproporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|235413
NZ_CP041242.1\|WP_141624727.1\|3584666_3585206_+\|response-regulator	unknown	unknown	gnl\|CDD\|226933
NZ_CP041242.1\|WP_141624723.1\|3581289_3581925_+\|cytochrome-o-ubiquinol-oxidase-subunit-III	unknown	unknown	gnl\|CDD\|131889
NZ_CP041242.1\|WP_141624739.1\|3595452_3596730_-\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|236440
NZ_CP041242.1\|WP_141624720.1\|3576512_3577850_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP041242.1\|WP_141624724.1\|3581921_3582308_+\|cytochrome-o-ubiquinol-oxidase-subunit-IV	unknown	unknown	gnl\|CDD\|131894
NZ_CP041242.1\|WP_141624736.1\|3592083_3592845_+\|uroporphyrinogen-III-synthase	unknown	unknown	gnl\|CDD\|181558
NZ_CP041242.1\|WP_141624738.1\|3594000_3595251_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|225613
NZ_CP041242.1\|WP_141624737.1\|3592924_3594004_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225507

Protein	Function_ID	Function_description	E-value
NZ_CP041242.1\|WP_141624734.1\|3590310_3590748_-\|rhodanese-like-domain-containing-protein	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	4.85997e-26
NZ_CP041242.1\|WP_141624730.1\|3586551_3587289_-\|3-oxoacyl-ACP-reductase-FabG	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	3.48914e-103
NZ_CP041242.1\|WP_141624725.1\|3582635_3583361_+\|SURF1-family-protein	gnl\|CDD\|225883	COG3346, COG3346, Uncharacterized conserved protein [Function unknown].	3.05918e-73
NZ_CP041242.1\|WP_141624721.1\|3578076_3579129_+\|ubiquinol-oxidase-subunit-II	gnl\|CDD\|213620	TIGR01433, precursor_Cytochrome_o_subunit_2_Oxidase, cytochrome o ubiquinol oxidase subunit II. This enzyme catalyzes the oxidation of ubiquinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. Subunit II is responsible for binding and oxidation of the ubiquinone substrate. This sequence is closely related to QoxA, which oxidizes quinol in gram positive bacteria but which is in complex with subunits which utilize cytochromes a in the reduction of molecular oxygen. Slightly more distantly related is subunit II of cytochrome c oxidase which uses cyt. c as the oxidant. [Energy metabolism, Electron transport].	9.12025e-118
NZ_CP041242.1\|WP_141624739.1\|3595452_3596730_-\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|236440	PRK09268, PRK09268, acetyl-CoA C-acetyltransferase.	0
NZ_CP041242.1\|WP_141624736.1\|3592083_3592845_+\|uroporphyrinogen-III-synthase	gnl\|CDD\|181558	PRK08811, PRK08811, uroporphyrinogen-III synthase; Validated.	1.36985e-64
NZ_CP041242.1\|WP_141624732.1\|3588447_3589572_-\|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|234629	PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase.	2.14182e-175
NZ_CP041242.1\|WP_141624722.1\|3579290_3581297_+\|cytochrome-o-ubiquinol-oxidase-subunit-I	gnl\|CDD\|131890	TIGR02843, Cytochrome_bo3_ubiquinol_oxidase_subunit_1, cytochrome o ubiquinol oxidase, subunit I. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	0
NZ_CP041242.1\|WP_141624726.1\|3583357_3584677_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	3.1793e-32
NZ_CP041242.1\|WP_141624733.1\|3589586_3590123_-\|protein-export-chaperone-SecB	gnl\|CDD\|180234	PRK05751, PRK05751, preprotein translocase subunit SecB; Validated.	1.68663e-67
NZ_CP041242.1\|WP_141624731.1\|3587470_3588406_+\|oxygen-dependent-coproporphyrinogen-oxidase	gnl\|CDD\|235413	PRK05330, PRK05330, oxygen-dependent coproporphyrinogen oxidase.	0
NZ_CP041242.1\|WP_141624727.1\|3584666_3585206_+\|response-regulator	gnl\|CDD\|226933	COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription].	3.11585e-80
NZ_CP041242.1\|WP_141624723.1\|3581289_3581925_+\|cytochrome-o-ubiquinol-oxidase-subunit-III	gnl\|CDD\|131889	TIGR02842, Cytochrome_bo3_ubiquinol_oxidase_subunit_3, cytochrome o ubiquinol oxidase, subunit III. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	1.16638e-99
NZ_CP041242.1\|WP_141624720.1\|3576512_3577850_-\|MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.21787e-86
NZ_CP041242.1\|WP_141624724.1\|3581921_3582308_+\|cytochrome-o-ubiquinol-oxidase-subunit-IV	gnl\|CDD\|131894	TIGR02847, Cytochrome_bo3_ubiquinol_oxidase_subunit_4, cytochrome o ubiquinol oxidase subunit IV. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	6.69877e-33
NZ_CP041242.1\|WP_141624738.1\|3594000_3595251_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|225613	COG3071, HemY, Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism].	2.87974e-58
NZ_CP041242.1\|WP_141624737.1\|3592924_3594004_+\|hypothetical-protein	gnl\|CDD\|225507	COG2959, HemX, Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism].	6.88852e-19

>NZ_CP041242.1|WP_141624729.1|3585809_3586310_-|hypothetical-protein
MSKTIGLTAAFVLSLSFFAPVASANGLKLQTPVAFAEDNDISNAIKTECEIGRQLAEFVKEYAPEPVELVAEAPDTGSGRVLRLEIVDAMSMGNAFLGHQKYTKVHGALFVDGEKVAGFKARRNSMGGAFAGFKGSCSVLGRTVKAIGRDIGGWLADPVDGSHLGD
>NZ_CP041242.1|WP_141624728.1|3585223_3585703_-|hypothetical-protein
MIRIRHVFPLRRAVIAATVLLLSACSTSSMLVGQARPPIDVSQVRIYHAPPAVPYEQIAVIETASGPVTYGEQNKLNAVLDKLRREAAKFGANGVLLQGTANGYGGTSVGVGTGVGRFGGRSYTSGGVGVSVSPRPKYATGIAIHVPNPPPPMEPDAEQ
>NZ_CP041242.1|WP_141624727.1|3584666_3585206_+|response-regulator
MNNEPRRLLIVEDDAAFARTLARSFERRGYVVRGAENVEEAVAVAAEHAPGHAVVDLKLAAGDSGLACVKALHRHDPAMRIVVLTGYASIATAVEAIKLGACHYLVKPSNTDDIEAAFGRTEASTAIEPAHRQTSLKTLEWERIHEVLAETGFNISETARRLGMHRRTLARKLEKRQVK
>NZ_CP041242.1|WP_141624726.1|3583357_3584677_+|HAMP-domain-containing-histidine-kinase
MKKPPRGPAMPERQRSAPPQLRAQHPLVQLRWIAVVGQIVTILFAQHVLDIALPLPSMFAVVAALAAFNLVSMLRWRPRADVRSGALFRALLVDILTLTALLYLAGGISNPFVFLYLLQVGLAAVLLRPWASWTVVAITTACVLALALWPGPVTIPVDLAGGLHSPYVWGLLICFALNAVLLVVFITRINASLRARDAHLATLRQRAAEEEHIVRMGLLASGAAHELGTPLATLSVILGDWRRMPPFTERTDLRDELGEMQIQVDRCKSIVTGILLSAGKARGESPEPTTLATFLDGLVTEWRATRPVRGFEYTKDIGSDIAIISDTGLKQMIGNVLDNALEASPDWVALEATREDDALVLRVCDRGPGFAPAMLAEFGRPYQSSKGRPGGGLGLFLSVNVARAFGGNVAARNREAGGAEVTVILPLASLTLEEVDDEQ
>NZ_CP041242.1|WP_141624725.1|3582635_3583361_+|SURF1-family-protein
MSIPTHHNISPLSVAFAVALAIAFAGFTALGVWQVKRLAWKLDLIERVESRVHAPPVAAPGPAEWAHVDAASHEYLHVVLEGRFLPGLDAKVQAVTELGAGFWLLAPFETADGGIVLINRGFVPPDRVGETAPPADTRMTGLLRISEPGGAFLRDNDPANDRWYSRDVQAIATARGLREVAPYFVDAGRNPDADVGAPVGGLTVVRFRNHHLVYALTWFALALMSAAAFVYLLRDARRGRR
>NZ_CP041242.1|WP_141624724.1|3581921_3582308_+|cytochrome-o-ubiquinol-oxidase-subunit-IV
MSDAHHDAHVADHHDEDGGLHFSVKGYMTGFLLSVVLTAIPFWLVMGQVVSSSNLTGFVVLAFAAVQMVVHMIYFLHLDAKSQGGWNMLALIFTAVLVVIMLAGSLWVMHHLNTNMMPMAPHEMRVQP
>NZ_CP041242.1|WP_141624723.1|3581289_3581925_+|cytochrome-o-ubiquinol-oxidase-subunit-III
MSDTHAIAMTDAQGRPVFLDTAGRHHPENGTLLGFWLYLMSDCLIFAVLFAIYGVLGRSYAAGPSGADLFDLNLVAINTGLLLLSSITYGFSMVAMQAKKKKAVLAWLAVTGLLGLGFLGVELYEFAHLIHEGAGPQRSAFLSSFFALVGTHGLHVTFGVVWLVVLMLQVGKLGLTTANRRRLLCLSMFWHFLDVVWIGVFTFVYLMGVLP
>NZ_CP041242.1|WP_141624722.1|3579290_3581297_+|cytochrome-o-ubiquinol-oxidase-subunit-I
MSNPASPTHPFFGRLSLEAIPYHDPILLGTFAGVAVVGIAVLALLTRYRLWGYLWHEWFTSIDHKKIGIMYCVLGLVMFLRGFADAIMMRLQQAMAFGDSVGYLPPHHYDQIFTAHGVIMIFFVAMPFVTGFMNYVVPLQIGARDVAFPFLNNFSFWMTAGGAALVMLSLFVGEFAMTGWLAYPPLSGIDFSPGVGVDYYIWGLQVAGVGTTLSGINLIATIVKMRAPGMTLMRMPVFTWTALCSNVLIVASFPVLTATLALLTLDRYIGTNFFTSDLGGNAMMYVNLIWIWGHPEVYILILPAFGIFSEVVSTFCGKRLFGYASMVYATVVITILSYLVWLHHFFTMGSGASVNSFFGIATMIISIPTGAKVFNWLFTMYRGRIRFELPMLWTVGFMVTFVIGGMTGVMLAIPAADFVLHNSLFLIAHFHNVIIGGVLFGMFAGINFWWPKAFGFRLDPFWGKLSFWFWLVGFVLAFAPLYVLGLMGVTRRVSHFDDPSLQVWFLIAAAGAFLIAIGIVCMLVQFAVSILRRKQLRDESGDPWEGRTLEWSTSSPPPAYNFAFTPVVHDNDAWHDMKQRGFQRPTTGFIPVHMPRNTAAGVVLAGLSTLLGFALIWHIWWLVIASFAATLIVAIVHTFNYKRDYHIPAEEITAAEDARTAQLANLHV
>NZ_CP041242.1|WP_141624721.1|3578076_3579129_+|ubiquinol-oxidase-subunit-II
MPTLRSLGRPLLAALAALSLPGCNTILLNAPGDVARQQGDLIVVSTVLMLLIIVPVIALTLFFAWRYRASNTKATYKPDWDHSVQLELLIWAAPLVIIIALGAITWISTHTLDPYRPLERIAEGQPVPEGVEPLEIQVVALDWKWLFLYPEQNIATVNEIAAPVDRPVRFLITGTTVMNSFYIPAMAGMIYAMPGMETKLHAVMNEPGEYVGFSANYSGEGFNGMRFRFRGMSEDDFEQWVAQARASGQALDRDGFLELEKPSEREPVRHYAGVAPGLYHAILNRCVDANHICMDEMMAIDAGGGLGRDAIDALIPRLRGDLRGGPVVAAAVCRADDLIPPLAPLARTAP
>NZ_CP041242.1|WP_141624720.1|3576512_3577850_-|MFS-transporter
MQTSSSVPASDPNDRHATVSVHGENKHAVAPGDIAVGVVIGRASEYFDFFVYGIASALVFPRVFFPFLEPLQATLWSFAIFALAFIARPLGTVLFMWIQRRWDRSTKLTAALFLLGTATAGIAFLPGYERIGALSIGLLALFRVLQGVALGGSWDGLPSLLALNAPEERRGHYAMLGQLGAPAGFIIAAALFAYLLGNLNTDDFFGWGWRYPFFAAFALNVVALFARLRLVVTHEYVHELDRNDLEPVPVGELLRAKGPNVAIGGFAALASYALFHVVTIFPISWILLFTDEPVGQFLLLQVAGAFLAAGGVVASGWIADRYGRIRTLSGFAAAIAVFSGFAPTLLTGGTVGKYAFVLLGFILLGLCYGQAAGAVTVNFGARYRYTGAALTADMAWLIGAAFAPLVALWLCAKFGLAFVGAYLLSGAVCTVLALLANRKLKLLRN
>NZ_CP041242.1|WP_141624730.1|3586551_3587289_-|3-oxoacyl-ACP-reductase-FabG
MNAPTLQRRALVTGGSGDIGAAISRRLAADGCHVIVHANRNREAAEAVVADIVASGGSAGTVAFDVADGEAGRAAIESLLAAGPIQVVVNNAGIHDDAPLAGMSDAQWKRVIDVSLHGFFHVTQPLLLPMARTRWGRIVSVSSVAAVLGNRGQCNYAAAKAALHGATRSLAREMASRGITANVVAPGVIEGRMAEAAFPPEQLKQIVPAGRAGRPEEVAALVGFLCSDAAGYINGQVIGVNGGMG
>NZ_CP041242.1|WP_141624731.1|3587470_3588406_+|oxygen-dependent-coproporphyrinogen-oxidase
MDNFSRVRAYLSGLQDRICQSIEAADGEGRFIEDAWERTPSGDSPAGLGGGGRTRILRDGAVFEQAGIGFSDVSGTRLPPSATAARPELAGASWRAVGVSLVFHPRNPYVPTTHANVRHFHAVRDGETVAWWFGGGFDLTPFYPFDQDVLHWHRTARALCEPFGGQSRYDAHRKWCDEYFFLKHRDETRGVGGLFFDDLHGDFEREFDYLRAVGNGFLDAYLPIVEHRRDTPHGERERQFQLYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPLVRWEYGYQPEAGSDEARLADYLRPRDWLTELG
>NZ_CP041242.1|WP_141624732.1|3588447_3589572_-|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase
MTAVDDPGAGKAPIAVLGAGSWGTALASLAARHGHPTVLWGRDAGIVEAINDRHENSRYLPGHPLPDNLRATTDMAEAVHGVGMILVVVPSHAFTEVVRALQPLRPDGVGVSWATKGFEPGSGRFLHEVAGEVFGPGVPLAVVTGPSFAKEVVAGLPTALTVHSDDADFAQQVAETLHGPAFRAYTGDDMVGAELGGAMKNVLAVATGVADGMQLGLNARAGLITRGLNEMLRLNQAIGGKAETLMGLAGLGDLVLTCTGDLSRNRRLGLALGRGQSIEDAVREIGQVVESVQTADEVMRQAERHGIELPISSAVQSVLHGEITPRTVSASCSRASRSRNIRSACSAEPRKSESSKSESETGARAAPVSLLTPK
>NZ_CP041242.1|WP_141624733.1|3589586_3590123_-|protein-export-chaperone-SecB
MSEEQNNGAAAPAEGAQPAAPTFSVEKIYAKDVSFEAPGAPAVFNEQAQPQLQMNMNQSVQRLGDNAYEVVLGLTLTCAVGEKSIYLAEVKQAGVFGLAGFDGPTLDGLLGSHCPSVLYPYARQLISDLIQAGGFPPFYLQPVNFDALYAEGLRQRQAQAAQQQNGDGLADAEPAGNA
>NZ_CP041242.1|WP_141624734.1|3590310_3590748_-|rhodanese-like-domain-containing-protein
MSAEELLAFLGRHPYLSLALVGLTMALLYTEIGRLMRGYKALRPAELTGLINREDALVVDLSPSNDFDKGHIAGSKSVAPSQFDPESKLLANVKNLPVVMVCRNGMASAGAAKRLKKAGFEQVYWLDGGIAAWQQADLPLVKGRG
>NZ_CP041242.1|WP_141624735.1|3590904_3591309_-|hypothetical-protein
MACLAALVVALAACASAGPKADALNQSQYAWSGAVRWGDFEGAWGLLDPEYREQHPITELEMERYNQIQVSYYRDNGGVRDLDAGTAARDVEMGVINRHTQAERTARYKETWRWDEAAKRWWLTSGMPDFWKGQ
>NZ_CP041242.1|WP_141624736.1|3592083_3592845_+|uroporphyrinogen-III-synthase
MPVSAAPPRWYLVSLRPQGGHEALRRAAARRGGALVALSSCRLVFRDDDASRQALDMALASGLAVFTSPAAVHAADALRPLREVADVRWIAVGAGTAAALRRAGAADVAHPARMDSEGLLALPALQRIAGTTIGLVTAPGGRGMLLPALQARGARVLRADVYAREPVPLPVHAIARLRTADAPLAVALSSGEALSRVLARLPADAAMKLRGARVLAASERLATIAREAGFDDVVIAAGPRPSQLAAAAGFDRD
>NZ_CP041242.1|WP_141624737.1|3592924_3594004_+|hypothetical-protein
MSDSNTPSTAQAPPRPPRRRAARWPWLLLIVFAALAVGGWHGWQWWQGHEARERAAVAQADHRIEALNERIDSLRSDQRAHGQRLQQADATNRVLRDELLGIGQRAALLEESVTRLADPGRDSTRSLRLEEVEMLLVFGQLRLELAGDLTGAQRGYALADAVLAAIQDPAYVNLRQALIQERAALDAIEADPRVAALSRIDAFNRKLQDAPPASTPAPQAAGAPWWKRAFSNVFDIQPRDRVIAELPSDRADASAGLQLELTLARAAAERRDEAGFRAALARAQDWLLRLWPPSPSLDAHRAELDGIAAMPLSLSVPTLGSTLQQLQQLRSTQAIAMPAGTRPAASASPTTPDAPTERP
>NZ_CP041242.1|WP_141624738.1|3594000_3595251_+|tetratricopeptide-repeat-protein
MNLFRSLLFWIVLALLGALVAQLMAQDPGLVMVSFGDWTYRKSLSYTLVLVLAVAALLWLAWRLLRAPFVMLRRRRRKAARARLIDGLQAVHLGHWSRAEKLLAEAADNRETGPIARIAAAHASTGRGDAEAARAHLVPLAESHPAAFAVATAELALADARPADALEALDAAAAQPLPPRGLALRAETLAALGRAGDAYGLLGALRQQQALPSSRLQVLEARWAEAGLREAADANVLADRWEALPKALRSDPAAVAAYAERAATLRWEDAAARSIEQALDTRWSDDLADLYGRLPIGRLDARLENAARWLQAHPASPGLLLTLARLHRTRGQWTQAEGFLHRALAQGGNAEAWEELGNGFAQAGDDARARQCYANALRVGRGEAPVEIPGRDLKQKIFDQAAIEERDEHGLPRLRG
>NZ_CP041242.1|WP_141624739.1|3595452_3596730_-|acetyl-CoA-C-acetyltransferase
MRQARPVAVLGGVRIPFCRQNTAYADVGNLGMSVRTLGALVEKFGLHGQQLGEVAMGAVIKHSSDWNLGREAALSSGLSSLTPGITLQRACGTSLDSIITVANKIAVGQIEAGIGGGSDTTSDVPIVYGRRLRRRLLEANAARDFKGKLAAFKGFSLRELKPEFPGVAEPRTGKSMGEHCEDMAKQWSISRDSQDEWALSSHQKLAAAYERGFFDDLVVSFRGVSRDNILRADSTLEKLATLKPAFDRTSGRGTLTAANSTPLTDGAAACLLASEEWAEKHGHEVLCHLRDAHVAAVDFVHGEGLLMAPTVAVPEMLARNGLTLQDFDFYEIHEAFAAQVLCTLRAWESEEYCKSRLGLDAAMGRIDPAKINPNGSSLATGHPFAATGARIVAAAAKELKARGGGRCLISICTAGGMGVVAILER

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	251175-251203	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	271558-271586	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	254289-254317	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	315657-315685	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	407726-407754	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1982125-1982153	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	255234-255262	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	866371-866399	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1244311-1244339	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	255548-255576	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	262583-262611	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	252331-252359	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	144066-144094	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	251414-251442	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	268357-268385	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	248613-248641	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	252579-252607	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	255565-255593	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	268357-268385	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	270023-270051	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	254316-254344	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	268356-268384	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	315725-315753	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	247183-247211	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	270023-270051	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	254316-254344	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	268357-268385	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	270023-270051	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	247186-247214	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	270023-270051	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	254316-254344	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	254316-254344	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	254316-254344	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	268357-268385	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	268357-268385	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	247186-247214	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	262566-262594	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	262538-262566	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	259168-259196	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	257295-257323	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	252827-252855	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	268357-268385	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	247186-247214	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	270023-270051	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	335258-335286	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	268351-268379	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	247186-247214	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	247186-247214	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	268357-268385	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	254316-254344	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	268357-268385	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	268357-268385	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	374797-374825	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1821074-1821102	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	380093-380121	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1686352-1686380	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	161569-161597	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	58018-58046	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	136170-136198	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	828594-828622	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1842319-1842347	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1824367-1824395	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1824367-1824395	3	0.897
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	265873-265901	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP042479	Citrobacter freundii strain C50 plasmid pC50_001, complete sequence	92073-92101	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	CP049311	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence	84583-84611	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP026208	Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence	176028-176056	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP010360	Enterobacter roggenkampii strain 35734 plasmid p35734-141.404kb, complete sequence	42688-42716	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	CP049307	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence	273613-273641	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	249268-249296	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	265873-265901	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	259097-259125	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	259086-259114	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP011635	Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence	136348-136376	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	265885-265913	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	265906-265934	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	265872-265900	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP027144	Enterobacter hormaechei subsp. hoffmannii strain AR_0365 plasmid unnamed1, complete sequence	118966-118994	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	KY320277	Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence	86450-86478	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP044111	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2	20084-20112	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP044111	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2	488785-488813	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_KY494864	Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence	427306-427334	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_KT935446	Klebsiella pneumoniae strain Kp2964 plasmid 2964TF, complete sequence	61529-61557	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP010380	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence	306249-306277	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	KP899803	Salmonella enterica strain 8025 plasmid p8025, complete sequence	103299-103327	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	CP009869	Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence	305973-306001	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP012168	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence	59156-59184	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP032179	Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence	199873-199901	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP029142	Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence	132017-132045	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP017294	Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence	207972-208000	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP031575	Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence	160302-160330	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP031135	Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence	233288-233316	4	0.862
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	274518-274546	5	0.828
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	274490-274518	5	0.828
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	274323-274351	5	0.828
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	785418-785446	5	0.828
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	274310-274338	5	0.828
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1728011-1728039	5	0.828
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1744716-1744744	5	0.828
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1708961-1708989	5	0.828
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP009975	Pseudomonas putida S12 plasmid pTTS12, complete sequence	516422-516450	5	0.828
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	702201-702229	5	0.828
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	562618-562646	5	0.828
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	326864-326892	5	0.828
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	344863-344891	5	0.828
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	351370-351401	5	0.844
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	316575-316606	5	0.844
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	218080-218108	5	0.828
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP039640	Azospirillum sp. TSH100 plasmid p1, complete sequence	52327-52355	5	0.828
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	630339-630367	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	481700-481728	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1662675-1662703	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP047896	Sphingomonas sp. C33 plasmid pC33, complete sequence	55623-55651	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP015742	Shinella sp. HZN7 plasmid pShin-06, complete sequence	113544-113572	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	481758-481786	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	481709-481737	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	481591-481619	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP015169	Acetobacter ascendens strain LMG 1591 plasmid unnamed1, complete sequence	90808-90836	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021512	Acetobacter pasteurianus subsp. pasteurianus strain SRCM101342 plasmid pAP1342-3, complete sequence	187630-187658	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	218201-218229	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	503688-503716	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1309384-1309412	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	458633-458661	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	MH976512	Gordonia phage Geodirt, complete genome	48273-48301	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP013345	Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence	287151-287179	6	0.793
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP013635	Rhizobium sp. N324 plasmid pRspN324e, complete sequence	189527-189555	6	0.793
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	101171-101202	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	887409-887440	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	MN369761	Mycobacterium phage Malthus, complete genome	40799-40830	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	MK224497	Mycobacterium phage Henu3, complete genome	17176-17207	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	KJ944841	Mycobacterium phage Cheetobro, complete genome	40803-40834	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	MN945904	Mycobacterium phage Eponine, complete genome	41649-41680	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	AP018469	Mycobacterium phage Y10 DNA, complete genome, note: sample1	40964-40995	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	KY087992	Mycobacterium phage Mitti, complete genome	40978-41009	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	MF140402	Mycobacterium phage Chancellor, complete genome	40806-40837	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	AP018470	Mycobacterium phage Y2 DNA, complete genome	40964-40995	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	KT361920	Mycobacterium phage Slarp, complete genome	40806-40837	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NC_022063	Mycobacterium phage Phelemich, complete genome	13967-13998	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	MT310882	Mycobacterium phage JF1, complete genome	40964-40995	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	KF024727	Mycobacterium phage Reprobate, complete genome	13964-13995	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	AP018471	Mycobacterium phage Y10 DNA, complete genome, note: sample2	40964-40995	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	KX621007	Mycobacterium phage Taquito, complete genome	41041-41072	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	MH051258	Mycobacterium phage SamScheppers, complete genome	41278-41309	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	MF140435	Mycobacterium phage Wintermute, complete genome	41036-41067	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NC_027365	Mycobacterium virus Fionnbarth, complete genome	41047-41078	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NC_020894	Streptomyces hygroscopicus subsp. jinggangensis TL01 plasmid pSHJGH1, complete sequence	64843-64874	6	0.812
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NC_017766	Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG1, complete sequence	64844-64875	6	0.812
NZ_CP041242_1	1.4\|239175\|29\|NZ_CP041242\|CRISPRCasFinder	239175-239203	29	MT521993	Gordonia phage RedWattleHog, complete genome	125790-125818	6	0.793
NZ_CP041242_1	1.4\|239175\|29\|NZ_CP041242\|CRISPRCasFinder	239175-239203	29	MN586040	Gordonia phage Stormageddon, complete genome	126737-126765	6	0.793
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP033220	Parasedimentitalea marina strain W43 plasmid pW43A, complete sequence	24458-24486	6	0.793
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP033220	Parasedimentitalea marina strain W43 plasmid pW43A, complete sequence	106137-106165	6	0.793
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP044073	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed2, complete sequence	86862-86890	6	0.793
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NC_015146	Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence	117430-117458	6	0.793
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2390089-2390117	6	0.793
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1237218-1237246	6	0.793
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	460026-460054	6	0.793
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	485313-485341	6	0.793
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NC_008545	Burkholderia cenocepacia HI2424 plasmid unnamed1, complete sequence	20655-20683	6	0.793
NZ_CP041242_1	1.6\|239283\|29\|NZ_CP041242\|CRISPRCasFinder	239283-239311	29	NZ_CP024986	Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence	60563-60591	6	0.793
NZ_CP041242_1	1.6\|239283\|29\|NZ_CP041242\|CRISPRCasFinder	239283-239311	29	NC_024970	Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence	180486-180514	6	0.793
NZ_CP041242_1	1.6\|239283\|29\|NZ_CP041242\|CRISPRCasFinder	239283-239311	29	NZ_KJ396772	Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence	180486-180514	6	0.793
NZ_CP041242_1	1.6\|239283\|29\|NZ_CP041242\|CRISPRCasFinder	239283-239311	29	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2395533-2395561	6	0.793
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	218080-218111	6	0.812
NZ_CP041242_2	2.1\|3586480\|28\|NZ_CP041242\|CRISPRCasFinder	3586480-3586507	28	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	442361-442388	6	0.786
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1598327-1598355	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	639346-639374	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	491942-491970	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	171498-171526	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	481415-481443	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	485052-485080	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	502645-502673	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	485114-485142	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	502645-502673	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	485114-485142	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	502645-502673	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	502649-502677	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	485114-485142	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	485114-485142	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	485114-485142	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	483625-483653	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	502645-502673	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	485116-485144	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	138089-138117	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1073523-1073551	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	854999-855027	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	718012-718040	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1691407-1691435	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1589368-1589396	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1589368-1589396	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5710794-5710822	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	289806-289834	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NC_022995	Burkholderia sp. M701 plasmid pM7012 DNA, complete sequence	387049-387077	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP019603	Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence	550920-550948	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	169176-169204	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	171950-171978	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	236713-236741	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1419203-1419231	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1535700-1535728	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1123998-1124026	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	378944-378972	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	784100-784128	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	166540-166568	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	169176-169204	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NC_011216	Burkholderia phage KS10, complete genome	19582-19610	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	1582778-1582806	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1127990-1128018	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	1555320-1555348	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	329653-329681	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	154384-154412	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	139157-139185	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	679217-679245	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	43929-43957	7	0.759
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	1566055-1566083	7	0.759
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP048816	Caulobacter rhizosphaerae strain KCTC 52515 plasmid unnamed	182746-182777	7	0.781
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP016820	Rhodococcus sp. p52 plasmid pDF02, complete sequence	35062-35093	7	0.781
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	180120-180151	7	0.781
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	554346-554377	7	0.781
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1258722-1258753	7	0.781
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NC_030917	Gordonia phage OneUp, complete genome	1551-1582	7	0.781
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_CP040761	Paracoccus sp. 2251 plasmid unnamed5, complete sequence	212811-212842	7	0.781
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	990608-990639	7	0.781
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NC_015952	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence	16751-16782	7	0.781
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	GU393987	Caulobacter phage Cd1 genomic sequence	20749-20780	7	0.781
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	MK524485	Mycobacterium phage MissDaisy, complete genome	39711-39742	7	0.781
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	MH926058	Mycobacterium phage Reptar3000, complete genome	39423-39454	7	0.781
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	MK524488	Mycobacterium phage Patt, complete genome	39435-39466	7	0.781
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_LR134467	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence	88979-89007	7	0.759
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1691612-1691640	7	0.759
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP015530	Rhodococcus sp. WB1 plasmid pWB1, complete sequence	215042-215070	7	0.759
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	121652-121680	7	0.759
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	770400-770428	7	0.759
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	238462-238490	7	0.759
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP026654	Streptomyces dengpaensis strain XZHG99 plasmid unnamed2, complete sequence	28131-28159	7	0.759
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	1576-1604	7	0.759
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	810151-810179	7	0.759
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	485313-485344	7	0.781
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_CP039640	Azospirillum sp. TSH100 plasmid p1, complete sequence	52327-52358	7	0.781
NZ_CP041242_2	2.1\|3586480\|28\|NZ_CP041242\|CRISPRCasFinder	3586480-3586507	28	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	295610-295637	7	0.75
NZ_CP041242_2	2.1\|3586480\|28\|NZ_CP041242\|CRISPRCasFinder	3586480-3586507	28	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1578134-1578161	7	0.75
NZ_CP041242_2	2.1\|3586480\|28\|NZ_CP041242\|CRISPRCasFinder	3586480-3586507	28	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1053801-1053828	7	0.75
NZ_CP041242_2	2.1\|3586480\|28\|NZ_CP041242\|CRISPRCasFinder	3586480-3586507	28	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	554256-554283	7	0.75
NZ_CP041242_1	1.1\|239007\|29\|NZ_CP041242\|CRISPRCasFinder	239007-239035	29	NZ_CP030829	Neorhizobium sp. NCHU2750 plasmid pNCHU2750b, complete sequence	366439-366467	8	0.724
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	184445-184476	8	0.75
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP015006	Aminobacter aminovorans strain KCTC 2477 plasmid pAA01, complete sequence	118913-118944	8	0.75
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	703287-703318	8	0.75
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1109784-1109815	8	0.75
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	806875-806906	8	0.75
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_CP029834	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence	44363-44394	8	0.75
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	323773-323804	8	0.75
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	192691-192722	8	0.75
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	364248-364279	8	0.75
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_CP049751	Rhodococcus fascians A21d2 plasmid unnamed2, complete sequence	9489-9520	8	0.75
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	154204-154232	8	0.724
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NC_013449	Streptomyces sp. W9 plasmid pCQ3, complete sequence	39760-39788	8	0.724
NZ_CP041242_1	1.5\|239229\|29\|NZ_CP041242\|CRISPRCasFinder	239229-239257	29	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	436048-436076	8	0.724
NZ_CP041242_1	1.6\|239283\|29\|NZ_CP041242\|CRISPRCasFinder	239283-239311	29	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	88278-88306	8	0.724
NZ_CP041242_1	1.6\|239283\|29\|NZ_CP041242\|CRISPRCasFinder	239283-239311	29	NZ_CP023976	Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence	205346-205374	8	0.724
NZ_CP041242_1	1.7\|239115\|35\|NZ_CP041242\|PILER-CR	239115-239149	35	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1258719-1258753	8	0.771
NZ_CP041242_1	1.7\|239115\|35\|NZ_CP041242\|PILER-CR	239115-239149	35	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	554346-554380	8	0.771
NZ_CP041242_1	1.7\|239115\|35\|NZ_CP041242\|PILER-CR	239115-239149	35	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	192691-192725	8	0.771
NZ_CP041242_1	1.7\|239115\|35\|NZ_CP041242\|PILER-CR	239115-239149	35	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	887409-887443	8	0.771
NZ_CP041242_1	1.7\|239115\|35\|NZ_CP041242\|PILER-CR	239115-239149	35	NC_030917	Gordonia phage OneUp, complete genome	1551-1585	8	0.771
NZ_CP041242_1	1.8\|239172\|32\|NZ_CP041242\|PILER-CR	239172-239203	32	MT521993	Gordonia phage RedWattleHog, complete genome	125790-125821	8	0.75
NZ_CP041242_1	1.8\|239172\|32\|NZ_CP041242\|PILER-CR	239172-239203	32	MN586040	Gordonia phage Stormageddon, complete genome	126737-126768	8	0.75
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_CP033220	Parasedimentitalea marina strain W43 plasmid pW43A, complete sequence	24458-24489	8	0.75
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_CP033220	Parasedimentitalea marina strain W43 plasmid pW43A, complete sequence	106137-106168	8	0.75
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	1320559-1320590	8	0.75
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NC_015146	Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence	117427-117458	8	0.75
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_CP026654	Streptomyces dengpaensis strain XZHG99 plasmid unnamed2, complete sequence	28128-28159	8	0.75
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1008014-1008045	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1626212-1626243	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1662134-1662165	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1009713-1009744	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1692171-1692202	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1867783-1867814	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1343279-1343310	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	791189-791220	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1622899-1622930	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	235299-235330	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	610358-610389	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1701660-1701691	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	112215-112246	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_AP014659	Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6a, complete sequence	67846-67877	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1409272-1409303	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1633376-1633407	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1660816-1660847	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1628195-1628226	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1706388-1706419	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1411017-1411048	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1581604-1581635	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1627668-1627699	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1713140-1713171	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1706355-1706386	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1690161-1690192	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1705149-1705180	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1690161-1690192	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1705185-1705216	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1690161-1690192	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1690161-1690192	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1690161-1690192	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1705185-1705216	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	339628-339659	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1705174-1705205	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1617214-1617245	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1597861-1597892	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1652856-1652887	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1690897-1690928	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1687476-1687507	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1705174-1705205	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1706175-1706206	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1705185-1705216	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1690164-1690195	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	308746-308777	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1705196-1705227	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1704997-1705028	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	308746-308777	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NC_010311	Streptomyces sp. HK1 plasmid pSHK1, complete sequence	136347-136378	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	CP054927	Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence	204555-204586	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	533733-533764	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	501296-501327	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	575307-575338	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	607401-607432	9	0.719
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_CP015585	Roseomonas gilardii strain U14-5 plasmid 1, complete sequence	239792-239823	9	0.719
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_CP016354	Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence	97234-97265	9	0.719
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_CP015204	Rhodococcus sp. 008 plasmid pR8C1, complete sequence	18649-18680	9	0.719
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	71058-71089	9	0.719
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_AP014707	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_3p, complete sequence	77982-78013	9	0.719
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_CP047177	Rathayibacter sp. VKM Ac-2759 plasmid unnamed1, complete sequence	440-471	9	0.719
NZ_CP041242_1	1.7\|239115\|35\|NZ_CP041242\|PILER-CR	239115-239149	35	NZ_CP016354	Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence	97234-97268	9	0.743
NZ_CP041242_1	1.7\|239115\|35\|NZ_CP041242\|PILER-CR	239115-239149	35	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	323770-323804	9	0.743
NZ_CP041242_1	1.7\|239115\|35\|NZ_CP041242\|PILER-CR	239115-239149	35	NZ_CP029834	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence	44363-44397	9	0.743
NZ_CP041242_1	1.7\|239115\|35\|NZ_CP041242\|PILER-CR	239115-239149	35	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	364248-364282	9	0.743
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	770397-770428	9	0.719
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	238462-238493	9	0.719
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_CP034813	Paracoccus sp. Arc7-R13 plasmid unnamed2, complete sequence	172634-172665	9	0.719
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	1573-1604	9	0.719
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	810148-810179	9	0.719
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NZ_CP029174	Methylobacterium sp. DM1 plasmid pLVM1, complete sequence	94923-94954	10	0.688
NZ_CP041242_1	1.2\|239061\|32\|NZ_CP041242\|CRISPRCasFinder	239061-239092	32	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	353036-353067	10	0.688
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	504905-504936	10	0.688
NZ_CP041242_1	1.3\|239118\|32\|NZ_CP041242\|CRISPRCasFinder	239118-239149	32	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	542496-542527	10	0.688
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_LR134467	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence	88979-89010	10	0.688
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_CP015530	Rhodococcus sp. WB1 plasmid pWB1, complete sequence	215042-215073	10	0.688
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	154204-154235	11	0.656
NZ_CP041242_1	1.9\|239226\|32\|NZ_CP041242\|PILER-CR	239226-239257	32	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	436045-436076	11	0.656

1. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

2. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

3. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

4. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

5. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

6. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

7. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

8. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

9. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

10. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

11. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

12. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

13. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

14. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

15. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

16. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

17. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

18. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

19. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

20. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

21. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

22. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

23. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

24. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

25. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

26. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

27. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

28. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

29. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

30. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

31. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

32. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

33. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

34. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

35. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

36. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

37. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

38. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

39. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

40. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

41. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

42. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

43. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

44. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

45. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

46. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

47. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

48. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

49. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

50. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

51. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

52. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

53. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

54. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

55. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

56. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

57. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

58. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

59. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

60. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

61. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

62. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

63. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.897

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgcgcggcgaccagttc	Protospacer
*** ********************** .*

64. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgtgcggcgaccagttc	Protospacer
*** **********.*********** .*

65. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP042479 (Citrobacter freundii strain C50 plasmid pC50_001, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

66. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to CP049311 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

67. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP026208 (Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

68. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP010360 (Enterobacter roggenkampii strain 35734 plasmid p35734-141.404kb, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

69. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to CP049307 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

70. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgtgcggcgaccagttc	Protospacer
*** **********.*********** .*

71. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgtgcggcgaccagttc	Protospacer
*** **********.*********** .*

72. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgtgcggcgaccagttc	Protospacer
*** **********.*********** .*

73. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgtgcggcgaccagttc	Protospacer
*** **********.*********** .*

74. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP011635 (Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

75. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgtgcggcgaccagttc	Protospacer
*** **********.*********** .*

76. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgtgcggcgaccagttc	Protospacer
*** **********.*********** .*

77. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcggcgccgacacgtgcggcgaccagttc	Protospacer
*** **********.*********** .*

78. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP027144 (Enterobacter hormaechei subsp. hoffmannii strain AR_0365 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

79. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to KY320277 (Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

80. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP044111 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

81. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP044111 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

82. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_KY494864 (Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

83. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_KT935446 (Klebsiella pneumoniae strain Kp2964 plasmid 2964TF, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

84. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP010380 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

85. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to KP899803 (Salmonella enterica strain 8025 plasmid p8025, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

86. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to CP009869 (Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

87. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP012168 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

88. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP032179 (Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

89. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP029142 (Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

90. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP017294 (Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

91. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP031575 (Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

92. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP031135 (Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence) position: , mismatch: 4, identity: 0.862

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgcgcggcgaccaggcg	Protospacer
**  ********.***************

93. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.828

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggtgccgacacgcgcggcgaccagttc	Protospacer
.** .********************* .*

94. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.828

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggtgccgacacgcgcggcgaccagttc	Protospacer
.** .********************* .*

95. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.828

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggtgccgacacgcgcggcgaccagttc	Protospacer
.** .********************* .*

96. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 5, identity: 0.828

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
acaccgccgacactcgcagcgaccaggcg	Protospacer
 *.********** ***.**********

97. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.828

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggtgccgacacgcgcggcgaccagttc	Protospacer
.** .********************* .*

98. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.828

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggtgccgacacgcgcggcgaccagttc	Protospacer
.** .********************* .*

99. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.828

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggtgccgacacgcgcggcgaccagttc	Protospacer
.** .********************* .*

100. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.828

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggtgccgacacgcgcggcgaccagttc	Protospacer
.** .********************* .*

101. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP009975 (Pseudomonas putida S12 plasmid pTTS12, complete sequence) position: , mismatch: 5, identity: 0.828

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccgcgccgacatgggcggcgaccaggcg	Protospacer
**  ********.* *************

102. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.828

tcgccgccgacacgcgcggcga---ccaggcc	CRISPR spacer
gcgccgccgacacgcgcgccgacttccag---	Protospacer
 ***************** ***   ****

103. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 5, identity: 0.828

tcgccgccgacacgcgcggcga---ccaggcc	CRISPR spacer
gcgccgccgacacgcgcgccgacttccag---	Protospacer
 ***************** ***   ****

104. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 5, identity: 0.828

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccgagaagcgcggcgacgacgac	Protospacer
********** * ********** * * *

105. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 5, identity: 0.828

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccgagaagcgcggcgacgacgac	Protospacer
********** * ********** * * *

106. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 5, identity: 0.844

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
gcataggcgatgcggccgtcgccgccgacgaa	Protospacer
 * * ***************.* *********

107. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 5, identity: 0.844

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
gcgtaggcgatgcggccgtcgccgccgacgaa	Protospacer
 * * ***************.* *********

108. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 5, identity: 0.828

ttgcggacccgggcaccggcgcc---gatccg	CRISPR spacer
ttgccgagccgggcaccggcgccacagat---	Protospacer
**** ** ***************   ***

109. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP039640 (Azospirillum sp. TSH100 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.828

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
tggcggacccggcgaccggcgccgaacag	Protospacer
* **********  *********** * *

110. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccgacacccgcggcgcccggcgg	Protospacer
************* ******* **.*

111. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggtgccgacacgcgtggcgaccagttc	Protospacer
.** .***********.********* .*

112. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccgacgcgcgcggcaacctcatc	Protospacer
***********.********.***  ..*

113. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP047896 (Sphingomonas sp. C33 plasmid pC33, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
acgccgccgaaacgcgcggcgacagcgcg	Protospacer
 ********* ************ . **

114. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP015742 (Shinella sp. HZN7 plasmid pShin-06, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
cgggcgccgacacgcccgtcgaccaggcg	Protospacer
. * *********** ** *********

115. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggtgccgacacgcgtggcgaccagttc	Protospacer
.** .***********.********* .*

116. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggtgccgacacgcgtggcgaccagttc	Protospacer
.** .***********.********* .*

117. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggtgccgacacgcgtggcgaccagttc	Protospacer
.** .***********.********* .*

118. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP015169 (Acetobacter ascendens strain LMG 1591 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
gcgcagccgacacgcgctgcgaccattcg	Protospacer
 *** ************ *******  *

119. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021512 (Acetobacter pasteurianus subsp. pasteurianus strain SRCM101342 plasmid pAP1342-3, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
gcgcagccgacacgcgctgcgaccattcg	Protospacer
 *** ************ *******  *

120. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
cctgctccgccacgcgcggcgaccagacc	Protospacer
.*  * *** ****************.**

121. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggcgccgacccgcgcggcgacccgccg	Protospacer
.** ******* ************ * *

122. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggcgccgacccgcgcggcgacccgccg	Protospacer
.** ******* ************ * *

123. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
ccggtgccgacacgcgtggcgaccagttc	Protospacer
.** .***********.********* .*

124. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to MH976512 (Gordonia phage Geodirt, complete genome) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccgacgtgcgcggcgacacgatc	Protospacer
***********..**********  *..*

125. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP013345 (Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tccatgccgacgcgcgcggcgaccagcgc	Protospacer
**  .******.**************  *

126. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP013635 (Rhizobium sp. N324 plasmid pRspN324e, complete sequence) position: , mismatch: 6, identity: 0.793

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
cctgcgccgtcaagcgcggcgaccaggac	Protospacer
.*  ***** ** ************** *

127. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 6, identity: 0.812

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
gcgaaggcgatgcggccgtcgcgcccgacgaa	Protospacer
 *   ***************.** ********

128. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
gcatgggcgacctcgacctgctcttccggcct	Protospacer
 **. * ****************.***.****

129. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to MN369761 (Mycobacterium phage Malthus, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

130. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to MK224497 (Mycobacterium phage Henu3, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

131. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to KJ944841 (Mycobacterium phage Cheetobro, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

132. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to MN945904 (Mycobacterium phage Eponine, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

133. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to AP018469 (Mycobacterium phage Y10 DNA, complete genome, note: sample1) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

134. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to KY087992 (Mycobacterium phage Mitti, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

135. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to MF140402 (Mycobacterium phage Chancellor, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

136. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to AP018470 (Mycobacterium phage Y2 DNA, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

137. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to KT361920 (Mycobacterium phage Slarp, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

138. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NC_022063 (Mycobacterium phage Phelemich, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcgcgctcgacgtcgacctgctcctcaagccg	Protospacer
**.*  ***** ************** ****

139. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to MT310882 (Mycobacterium phage JF1, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

140. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to KF024727 (Mycobacterium phage Reprobate, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcgcgctcgacgtcgacctgctcctcaagccg	Protospacer
**.*  ***** ************** ****

141. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to AP018471 (Mycobacterium phage Y10 DNA, complete genome, note: sample2) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

142. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to KX621007 (Mycobacterium phage Taquito, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

143. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to MH051258 (Mycobacterium phage SamScheppers, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

144. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to MF140435 (Mycobacterium phage Wintermute, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

145. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NC_027365 (Mycobacterium virus Fionnbarth, complete genome) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgacctgctcgacgacccc	Protospacer
*** *******************  * * **.

146. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NC_020894 (Streptomyces hygroscopicus subsp. jinggangensis TL01 plasmid pSHJGH1, complete sequence) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct--	CRISPR spacer
ccaccatcgacctcgacctgcgc--ccagccgtg	Protospacer
.****.*************** *  ******

147. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NC_017766 (Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG1, complete sequence) position: , mismatch: 6, identity: 0.812

tcaccgtcgacctcgacctgctcctccagcct--	CRISPR spacer
ccaccatcgacctcgacctgcgc--ccagccgtg	Protospacer
.****.*************** *  ******

148. spacer 1.4|239175|29|NZ_CP041242|CRISPRCasFinder matches to MT521993 (Gordonia phage RedWattleHog, complete genome) position: , mismatch: 6, identity: 0.793

ctgccggtacgggccgagtttccagcctt	CRISPR spacer
gagccggtgcgggccgagcttccagacct	Protospacer
  ******.*********.****** *.*

149. spacer 1.4|239175|29|NZ_CP041242|CRISPRCasFinder matches to MN586040 (Gordonia phage Stormageddon, complete genome) position: , mismatch: 6, identity: 0.793

ctgccggtacgggccgagtttccagcctt	CRISPR spacer
gagccggtgcgggccgagcttccagacct	Protospacer
  ******.*********.****** *.*

150. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP033220 (Parasedimentitalea marina strain W43 plasmid pW43A, complete sequence) position: , mismatch: 6, identity: 0.793

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
acccgcacccgggcaccgccgccgatcag	Protospacer
 . ** ************ ******** *

151. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP033220 (Parasedimentitalea marina strain W43 plasmid pW43A, complete sequence) position: , mismatch: 6, identity: 0.793

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
acccgcacccgggcaccgccgccgatcag	Protospacer
 . ** ************ ******** *

152. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP044073 (Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.793

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
cagccgacccgggcaccggcgccgcagcg	Protospacer
. ** *******************   **

153. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NC_015146 (Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence) position: , mismatch: 6, identity: 0.793

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
gggcgaacccgggcagcggcgccgacacg	Protospacer
  ***.********* *********. **

154. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.793

---ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
agagcgcg---ccgggcaccggcaccgatccg	Protospacer
    .***   ************.********

155. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 6, identity: 0.793

---ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
agagcgcg---ccgggcaccggcaccgatccg	Protospacer
    .***   ************.********

156. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 6, identity: 0.793

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
tggccgacccggccaccggcgccgacggg	Protospacer
* ** ******* ************.  *

157. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 6, identity: 0.793

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
gggggggcacgggcaccggcgccgatctg	Protospacer
  * **.* ******************.*

158. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NC_008545 (Burkholderia cenocepacia HI2424 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.793

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
tcgtcgtaccgggcgccggcgccgatccg	Protospacer
*.*. *  ******.**************

159. spacer 1.6|239283|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP024986 (Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence) position: , mismatch: 6, identity: 0.793

gagccgtattcctgcccggcctcggcggt	CRISPR spacer
ggcccgtactccagcccggcctcggcgta	Protospacer
*. *****.*** **************

160. spacer 1.6|239283|29|NZ_CP041242|CRISPRCasFinder matches to NC_024970 (Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 6, identity: 0.793

gagccgtattcctgcccggcctcggcggt	CRISPR spacer
ggcccgtactccagcccggcctcggcgta	Protospacer
*. *****.*** **************

161. spacer 1.6|239283|29|NZ_CP041242|CRISPRCasFinder matches to NZ_KJ396772 (Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 6, identity: 0.793

gagccgtattcctgcccggcctcggcggt	CRISPR spacer
ggcccgtactccagcccggcctcggcgta	Protospacer
*. *****.*** **************

162. spacer 1.6|239283|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.793

gagccgtattcctgcccggcctcggcggt	CRISPR spacer
gagacgtattcctgcccggccccgcccag	Protospacer
*** *****************.** * .

163. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 6, identity: 0.812

gcgttgcggacccgggcaccggcgcc---gatccg	CRISPR spacer
gggttgccgagccgggcaccggcgccacagat---	Protospacer
* ***** ** ***************   ***

164. spacer 2.1|3586480|28|NZ_CP041242|CRISPRCasFinder matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

tccccccggccctcgcgcatagcgctcg	CRISPR spacer
ccgctgcggccctcgcgcatcgcgctcc	Protospacer
.* *. ************** ******

165. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

166. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

167. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

168. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

169. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

170. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

171. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

172. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

173. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

174. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

175. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

176. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

177. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

178. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

179. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

180. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

181. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

182. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

183. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

184. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

185. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

186. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

187. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

188. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

189. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
atgccgccgacgcgcgcggcgagcagcat	Protospacer
 .*********.********** ***  .

190. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccaccgacacccgcggcgacgccatc	Protospacer
*****.******* *********   ..*

191. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
gcgccgccgacccgcgcggtgaccaccat	Protospacer
 ********** *******.*****   .

192. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NC_022995 (Burkholderia sp. M701 plasmid pM7012 DNA, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccgacacgcgcagcgaagcgctg	Protospacer
*****************.****   * .

193. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP019603 (Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
acgcggtcgacacgcgcggcgaccctgag	Protospacer
 *** *.*****************  *

194. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

195. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

196. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

197. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

198. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

199. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

200. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

201. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
aggacatcgagacgcgcggcgaccaggcg	Protospacer
  * *..*** *****************

202. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

203. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

204. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NC_011216 (Burkholderia phage KS10, complete genome) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
gcgcggccgtcacgcgcggcgaccgcatc	Protospacer
 *** **** **************. ..*

205. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

206. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

207. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

208. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
cctgcgccgtcaagcgcggcgaccaggat	Protospacer
.*  ***** ** ************** .

209. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

210. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

211. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

212. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

213. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.759

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
tcgccgccggcacgcgcggcgggctgcgt	Protospacer
*********.***********. * *  .

214. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP048816 (Caulobacter rhizosphaerae strain KCTC 52515 plasmid unnamed) position: , mismatch: 7, identity: 0.781

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
ccttcgtcgatgcggccgtcgcggctttcggc	Protospacer
****** *************.****.  **.

215. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP016820 (Rhodococcus sp. p52 plasmid pDF02, complete sequence) position: , mismatch: 7, identity: 0.781

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
ccgatgccgatgcggccgccacggccgccgac	Protospacer
**  .* ***********.******** ***

216. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 7, identity: 0.781

ccttcggc-gatgcggccgtcacggccgacgaa	CRISPR spacer
-ctgcaccggaagcgcccgtcacggccgacgac	Protospacer
 ** *. * ** *** ****************

217. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.781

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaccgtcgtcctcgaccggctcctcggacgc	Protospacer
********* ******** ******* ..* .

218. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.781

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaccgtcgtcctcgaccggctcctcggacgc	Protospacer
********* ******** ******* ..* .

219. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NC_030917 (Gordonia phage OneUp, complete genome) position: , mismatch: 7, identity: 0.781

tcaccgtcgacctcgacctgctcct--ccagcct	CRISPR spacer
acaccgtcgacctcgacgagctcctcaccgac--	Protospacer
 ****************  ******  **..*

220. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP040761 (Paracoccus sp. 2251 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tggacgatgacctcgacctggccctccagcct	Protospacer
* . ** .************ .**********

221. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.781

tcaccgtcgacctcgacctgctc---ctccagcct	CRISPR spacer
tcaccgtcgacgccgacctgctcgcacccaag---	Protospacer
*********** .**********   *.* **

222. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NC_015952 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence) position: , mismatch: 7, identity: 0.781

tcaccgtcgacctcgacctgctcctccagcct--	CRISPR spacer
tgcacgtcgacctggacctgctccacc--cctgg	Protospacer
*   ********* ********** **  ***

223. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to GU393987 (Caulobacter phage Cd1 genomic sequence) position: , mismatch: 7, identity: 0.781

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
gcaacgtcaacctcgacctgctccatcggctt	Protospacer
 ** ****.*************** .*.**.*

224. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to MK524485 (Mycobacterium phage MissDaisy, complete genome) position: , mismatch: 7, identity: 0.781

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgaccttctcgacgacccc	Protospacer
*** *************** ***  * * **.

225. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to MH926058 (Mycobacterium phage Reptar3000, complete genome) position: , mismatch: 7, identity: 0.781

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgaccttctcgacgacccc	Protospacer
*** *************** ***  * * **.

226. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to MK524488 (Mycobacterium phage Patt, complete genome) position: , mismatch: 7, identity: 0.781

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaacgtcgacctcgaccttctcgacgacccc	Protospacer
*** *************** ***  * * **.

227. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_LR134467 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence) position: , mismatch: 7, identity: 0.759

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
ccgcggaccagggcaccggcgccgaattc	Protospacer
..******* *************** ..

228. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.759

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
gtgtggacccgggcaccggcgcggtggtg	Protospacer
 **.****************** *   .*

229. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP015530 (Rhodococcus sp. WB1 plasmid pWB1, complete sequence) position: , mismatch: 7, identity: 0.759

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
ctgcggaccggggcaccggcggcgcgtag	Protospacer
.******** *********** **  . *

230. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.759

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
gtgtggacccgggcaccggcgcggtggtg	Protospacer
 **.****************** *   .*

231. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 7, identity: 0.759

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
gtgccgacccggccaccggcgccgtggcc	Protospacer
 *** ******* ***********   *

232. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.759

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
cgctgaaccgggtcaccggcgccgatccg	Protospacer
.  .*.*** ** ****************

233. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP026654 (Streptomyces dengpaensis strain XZHG99 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
ggcctgacccgggcacagccgccgatcca	Protospacer
   * *********** * *********.

234. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 7, identity: 0.759

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
cgctgaaccgggtcaccggcgccgatccg	Protospacer
.  .*.*** ** ****************

235. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 7, identity: 0.759

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
cgctgaaccgggtcaccggcgccgatccg	Protospacer
.  .*.*** ** ****************

236. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 7, identity: 0.781

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
ccggggggggcacgggcaccggcgccgatctg	Protospacer
 **  * **.* ******************.*

237. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_CP039640 (Azospirillum sp. TSH100 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
ccctggcggacccggcgaccggcgccgaacag	Protospacer
 * * **********  *********** * *

238. spacer 2.1|3586480|28|NZ_CP041242|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.75

tccccccggccctcgcgcatagcgctcg	CRISPR spacer
accacccggccctcgcgcatcgcgacga	Protospacer
 ** **************** *** . .

239. spacer 2.1|3586480|28|NZ_CP041242|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 7, identity: 0.75

tccccccggccctcgcgcatagcgctcg	CRISPR spacer
accacccggccctcgcgcatcgcgacga	Protospacer
 ** **************** *** . .

240. spacer 2.1|3586480|28|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.75

tccccccggccctcgcgcatagcgctcg	CRISPR spacer
accacccggccctcgcgcatcgcgacga	Protospacer
 ** **************** *** . .

241. spacer 2.1|3586480|28|NZ_CP041242|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.75

tccccccggccctcgcgcatagcgctcg	CRISPR spacer
accacccggccctcgcgcatcgcgacga	Protospacer
 ** **************** *** . .

242. spacer 1.1|239007|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP030829 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750b, complete sequence) position: , mismatch: 8, identity: 0.724

tcgccgccgacacgcgcggcgaccaggcc	CRISPR spacer
accagaccgacacgcgcggcgatcaggat	Protospacer
 *   .****************.**** .

243. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
gacctggcggtgcggccgtcacggcagacgta	Protospacer
  ...****.*************** **** *

244. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP015006 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA01, complete sequence) position: , mismatch: 8, identity: 0.75

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
gccgcatcgatgcgcccgtcatggccgacgag	Protospacer
 *. *. ******* ******.*********.

245. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaccgtcgacctcggccggctcgccgaacgc	Protospacer
***************.** **** .* *.* .

246. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaccgtcgacctcggccggctcgccgaacgc	Protospacer
***************.** **** .* *.* .

247. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcgccgtcgacctggacctgctcggcgaactg	Protospacer
**.********** *********  * *.*.

248. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP029834 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
ggaaactcgacgtcgaactgctcctccagccc	Protospacer
  *   ***** **** **************.

249. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
ggaaactcgacgtcgaactgctcctccagccc	Protospacer
  *   ***** **** **************.

250. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
ggaaactcgacgtcgaactgctcctccagccc	Protospacer
  *   ***** **** **************.

251. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
ggaaactcgacgtcgaactgctcctccagccc	Protospacer
  *   ***** **** **************.

252. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP049751 (Rhodococcus fascians A21d2 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaccgtcgacctcgccttgctcgaacacgcc	Protospacer
*************** *.*****   **  *.

253. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.724

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
ctgcggacccggacacccgcgccgcctat	Protospacer
.***********.**** ****** ..

254. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NC_013449 (Streptomyces sp. W9 plasmid pCQ3, complete sequence) position: , mismatch: 8, identity: 0.724

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
acagcgttccgggcatcggcgccgatccg	Protospacer
 ..  * .*******.*************

255. spacer 1.5|239229|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.724

ttgcggacccgggcaccggcgccgatccg	CRISPR spacer
ctgcggacccggacacccgcgccgcctat	Protospacer
.***********.**** ****** ..

256. spacer 1.6|239283|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 8, identity: 0.724

gagccgtattcctgcccggcctcggcggt	CRISPR spacer
agatccagttgctgcccggcctcggcggt	Protospacer
....*  .** ******************

257. spacer 1.6|239283|29|NZ_CP041242|CRISPRCasFinder matches to NZ_CP023976 (Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence) position: , mismatch: 8, identity: 0.724

gagccgtattcctgcccggcctcggcggt	CRISPR spacer
agatccagttgctgcccggcctcggcggt	Protospacer
....*  .** ******************

258. spacer 1.7|239115|35|NZ_CP041242|PILER-CR matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.771

aggtcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tggtcaccgtcgtcctcgaccggctcctcggacgc	Protospacer
 *********** ******** ******* ..* .

259. spacer 1.7|239115|35|NZ_CP041242|PILER-CR matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.771

aggtcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tggtcaccgtcgtcctcgaccggctcctcggacgc	Protospacer
 *********** ******** ******* ..* .

260. spacer 1.7|239115|35|NZ_CP041242|PILER-CR matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 8, identity: 0.771

--aggtcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcgggaaac--tcgacgtcgaactgctcctccagccc	Protospacer
  .**  **  ***** **** **************.

261. spacer 1.7|239115|35|NZ_CP041242|PILER-CR matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 8, identity: 0.771

aggtcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
accgcatgggcgacctcgacctgctcttccggcct	Protospacer
*   **. * ****************.***.****

262. spacer 1.7|239115|35|NZ_CP041242|PILER-CR matches to NC_030917 (Gordonia phage OneUp, complete genome) position: , mismatch: 8, identity: 0.771

aggtcaccgtcgacctcgacctgctcct--ccagcct	CRISPR spacer
agcacaccgtcgacctcgacgagctcctcaccgac--	Protospacer
**  ****************  ******  **..*

263. spacer 1.8|239172|32|NZ_CP041242|PILER-CR matches to MT521993 (Gordonia phage RedWattleHog, complete genome) position: , mismatch: 8, identity: 0.75

aggctgccggtacgggccgagtttccagcctt	CRISPR spacer
cgcgagccggtgcgggccgagcttccagacct	Protospacer
 *   ******.*********.****** *.*

264. spacer 1.8|239172|32|NZ_CP041242|PILER-CR matches to MN586040 (Gordonia phage Stormageddon, complete genome) position: , mismatch: 8, identity: 0.75

aggctgccggtacgggccgagtttccagcctt	CRISPR spacer
cgcgagccggtgcgggccgagcttccagacct	Protospacer
 *   ******.*********.****** *.*

265. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_CP033220 (Parasedimentitalea marina strain W43 plasmid pW43A, complete sequence) position: , mismatch: 8, identity: 0.75

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
accacccgcacccgggcaccgccgccgatcag	Protospacer
.*  . ** ************ ******** *

266. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_CP033220 (Parasedimentitalea marina strain W43 plasmid pW43A, complete sequence) position: , mismatch: 8, identity: 0.75

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
accacccgcacccgggcaccgccgccgatcag	Protospacer
.*  . ** ************ ******** *

267. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 8, identity: 0.75

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
ccgttgcggacgcgggcacgggcgctgcgctc	Protospacer
 ********** ******* *****.*  *.

268. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NC_015146 (Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence) position: , mismatch: 8, identity: 0.75

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
tctgggcgaacccgggcagcggcgccgacacg	Protospacer
 *   ***.********* *********. **

269. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_CP026654 (Streptomyces dengpaensis strain XZHG99 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
gccggcctgacccgggcacagccgccgatcca	Protospacer
**    * *********** * *********.

270. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

271. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

272. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

273. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

274. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

275. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

276. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

277. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

278. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

279. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

280. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

281. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

282. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
gcggttacgatgcggccgtcacagccggcgac	Protospacer
 *  . .***************.****.***

283. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_AP014659 (Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6a, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
agacggtcgatgctgcagtcacggccgacgac	Protospacer
   . * ****** ** **************

284. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

285. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

286. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

287. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

288. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

289. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

290. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

291. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

292. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

293. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

294. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

295. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

296. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

297. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

298. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

299. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

300. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

301. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

302. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

303. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

304. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

305. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

306. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

307. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

308. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

309. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

310. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

311. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

312. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

313. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

314. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

315. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cagtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

316. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgatgtggcggtcacggccggttcg	Protospacer
*  *********.*** **********..  .

317. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NC_010311 (Streptomyces sp. HK1 plasmid pSHK1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
ccgagccagatgcggccggcacgtccgacgac	Protospacer
**      ********** **** *******

318. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to CP054927 (Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
agggtgacggtgcggccgtcgcggccgacgga	Protospacer
    .*.**.**********.*********.*

319. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
ccgcgggcgattcggccgtcacgcccgaaatc	Protospacer
** . ****** *********** **** .

320. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
tcggcatcgatgcgcccgtcacggtcgacgtg	Protospacer
.*  *. ******* *********.***** .

321. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
tcggcatcgatgcgcccgtcacggtcgacgtg	Protospacer
.*  *. ******* *********.***** .

322. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 9, identity: 0.719

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
cggtcggcgaggccgccgtcacggccattcag	Protospacer
*  ******* ** ************. . *.

323. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP015585 (Roseomonas gilardii strain U14-5 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
agcccgtcgagctcggcctgctcctccgggtc	Protospacer
   ******* ****.***********.* ..

324. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP016354 (Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence) position: , mismatch: 9, identity: 0.719

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaccggcaacctcgacctgctccggcgcgtc	Protospacer
****** *.***************  *.  ..

325. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP015204 (Rhodococcus sp. 008 plasmid pR8C1, complete sequence) position: , mismatch: 9, identity: 0.719

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
tcaccgtcgcccacgacctgctcgcagaagcg	Protospacer
********* ** ********** .  *. *

326. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 9, identity: 0.719

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
gcaccgtcgaccccgaccggctccggacggcc	Protospacer
 ***********.***** *****    * *.

327. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_AP014707 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_3p, complete sequence) position: , mismatch: 9, identity: 0.719

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
acacggtcgaccgcgacctgctccagctcgcc	Protospacer
 *** ******* ***********  *   *.

328. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP047177 (Rathayibacter sp. VKM Ac-2759 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
ccgccgtcgccctcgccctgctcctctacgtc	Protospacer
.*.****** ***** **********.*  ..

329. spacer 1.7|239115|35|NZ_CP041242|PILER-CR matches to NZ_CP016354 (Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence) position: , mismatch: 9, identity: 0.743

aggtcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
aggtcaccggcaacctcgacctgctccggcgcgtc	Protospacer
********* *.***************  *.  ..

330. spacer 1.7|239115|35|NZ_CP041242|PILER-CR matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 9, identity: 0.743

aggtcaccg-----tcgacctcgacctgctcctccagcct	CRISPR spacer
-----tccggaaactcgacgtcgaactgctcctccagccc	Protospacer
      ***     ***** **** **************.

331. spacer 1.7|239115|35|NZ_CP041242|PILER-CR matches to NZ_CP029834 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.743

aggtcaccg-----tcgacctcgacctgctcctccagcct	CRISPR spacer
-----tccggaaactcgacgtcgaactgctcctccagccc	Protospacer
      ***     ***** **** **************.

332. spacer 1.7|239115|35|NZ_CP041242|PILER-CR matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.743

aggtcaccg-----tcgacctcgacctgctcctccagcct	CRISPR spacer
-----tccggaaactcgacgtcgaactgctcctccagccc	Protospacer
      ***     ***** **** **************.

333. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
accgtgccgacccggccaccggcgccgtggcc	Protospacer
.*  *** ******* ***********   *

334. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
tcacgctgaaccgggtcaccggcgccgatccg	Protospacer
 *..  .*.*** ** ****************

335. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_CP034813 (Paracoccus sp. Arc7-R13 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
ccgttgcggacccaggcatcggcggccacgac	Protospacer
 ************.****.***** * *.

336. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 9, identity: 0.719

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
tcacgctgaaccgggtcaccggcgccgatccg	Protospacer
 *..  .*.*** ** ****************

337. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 9, identity: 0.719

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
tcacgctgaaccgggtcaccggcgccgatccg	Protospacer
 *..  .*.*** ** ****************

338. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP029174 (Methylobacterium sp. DM1 plasmid pLVM1, complete sequence) position: , mismatch: 10, identity: 0.688

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
gggacggcgatgcggccttcgcggccgccctc	Protospacer
    ************* **.****** *

339. spacer 1.2|239061|32|NZ_CP041242|CRISPRCasFinder matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 10, identity: 0.688

ccttcggcgatgcggccgtcacggccgacgaa	CRISPR spacer
gtctgcccgatgcggcggtgacggccgacggt	Protospacer
 ..*   ********* ** **********.

340. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 10, identity: 0.688

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
ccggcgtcgacctcgacccactcctcctcgac	Protospacer
.*. **************..*******    .

341. spacer 1.3|239118|32|NZ_CP041242|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 10, identity: 0.688

tcaccgtcgacctcgacctgctcctccagcct	CRISPR spacer
ccggcgtcgacctcgacccactcctcctcgac	Protospacer
.*. **************..*******    .

342. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_LR134467 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence) position: , mismatch: 10, identity: 0.688

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
aatccgcggaccagggcaccggcgccgaattc	Protospacer
.  ..******* *************** ..

343. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_CP015530 (Rhodococcus sp. WB1 plasmid pWB1, complete sequence) position: , mismatch: 10, identity: 0.688

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
agtctgcggaccggggcaccggcggcgcgtag	Protospacer
.  .******** *********** **  . *

344. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 11, identity: 0.656

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
cgcctgcggacccggacacccgcgccgcctat	Protospacer
   .***********.**** ****** ..

345. spacer 1.9|239226|32|NZ_CP041242|PILER-CR matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 11, identity: 0.656

gcgttgcggacccgggcaccggcgccgatccg	CRISPR spacer
cgcctgcggacccggacacccgcgccgcctat	Protospacer
   .***********.**** ****** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1764985 : 1773161

Bacillus_virus(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141623312.1\|1764985_1766422_+	replicative DNA helicase	A0A1B0VG30	Salmonella_phage	7.5e-124	55.5
WP_167285080.1\|1766497_1767637_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	1.2e-36	30.2
WP_141623314.1\|1767809_1769582_+	S8 family serine peptidase	A0A127AWU5	Bacillus_phage	2.2e-24	39.2
WP_141623315.1\|1769769_1770465_+	OmpA family protein	G3M9Z0	Bacillus_virus	1.3e-09	28.9
WP_141625103.1\|1770563_1771007_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	1.3e-10	36.1
WP_141623316.1\|1771295_1772327_+	ROK family protein	NA	NA	NA	NA
WP_141623317.1\|1772543_1773161_+	repressor LexA	A0A1W6JNS2	Morganella_phage	1.8e-13	38.6

DBSCAN-SWA_2

2885458 : 2929926

Pseudomonas_phage(44.0%)

terminase,protease,tail,portal,integrase

attL 2885157:2885201|attR 2928229:2928273

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2885157:2885201	attL	NA	NA	NA	NA
WP_141624167.1\|2885458_2886481_-\|tail	tail fiber domain-containing protein	A0A1Z1LWN5	Synechococcus_phage	3.9e-10	66.0
WP_141624168.1\|2886480_2888694_-	hypothetical protein	Q5ZQV9	Pseudomonas_phage	4.5e-120	38.0
WP_167285216.1\|2888686_2888860_-	hypothetical protein	NA	NA	NA	NA
WP_141624169.1\|2888852_2889092_-	hypothetical protein	A0A2D1GNL8	Pseudomonas_phage	9.8e-05	36.2
WP_141624170.1\|2889091_2889334_-	hypothetical protein	A0A0S0NC86	Pseudomonas_phage	7.6e-13	44.0
WP_141624171.1\|2889343_2890126_-	hypothetical protein	A9J4Y0	Pseudomonas_phage	5.3e-47	39.7
WP_141624172.1\|2890130_2891837_-	hypothetical protein	A0SMQ4	Pseudomonas_virus	1.6e-96	36.6
WP_141624173.1\|2891837_2892884_-	hypothetical protein	A0A0M3MXF1	Stenotrophomonas_phage	1.7e-40	34.1
WP_141624174.1\|2892883_2893750_-	hypothetical protein	A0A2P1CA63	Pseudomonas_phage	4.0e-48	36.5
WP_141624175.1\|2893751_2897015_-	hypothetical protein	J9SGV2	Pseudomonas_phage	3.8e-22	25.1
WP_141624176.1\|2897156_2897693_-	hypothetical protein	NA	NA	NA	NA
WP_141624177.1\|2897696_2898449_-	hypothetical protein	Q5ZQX2	Pseudomonas_phage	1.1e-44	39.2
WP_141624178.1\|2898496_2899144_-	hypothetical protein	NA	NA	NA	NA
WP_141624179.1\|2899136_2899574_-	hypothetical protein	NA	NA	NA	NA
WP_141624180.1\|2899566_2899881_-	hypothetical protein	NA	NA	NA	NA
WP_167285217.1\|2899877_2900123_-	hypothetical protein	NA	NA	NA	NA
WP_141624182.1\|2900125_2900515_-	hypothetical protein	NA	NA	NA	NA
WP_141624183.1\|2900507_2900738_-	hypothetical protein	NA	NA	NA	NA
WP_141624184.1\|2900734_2901079_-	hypothetical protein	NA	NA	NA	NA
WP_141624185.1\|2901081_2901678_-	hypothetical protein	A0A2I6PIA5	Pseudomonas_phage	6.4e-21	41.4
WP_141624186.1\|2901781_2902135_-	DUF2190 family protein	NA	NA	NA	NA
WP_141624187.1\|2902206_2904489_-\|protease	Clp protease ClpP	A0A1W6JT88	Pseudomonas_phage	1.2e-91	35.2
WP_167285220.1\|2904485_2906072_-\|portal	phage portal protein	A0A0A0YUB7	Pseudomonas_phage	4.5e-77	36.6
WP_141624189.1\|2906089_2906311_-	hypothetical protein	NA	NA	NA	NA
WP_141624190.1\|2906379_2906700_-	hypothetical protein	NA	NA	NA	NA
WP_141624191.1\|2906707_2908627_-\|terminase	phage terminase large subunit family protein	B7SYD3	Stenotrophomonas_phage	5.3e-242	63.9
WP_141624192.1\|2908623_2909205_-\|terminase	terminase small subunit	B7SYD2	Stenotrophomonas_phage	5.5e-09	40.6
WP_141624193.1\|2909367_2911926_-	toprim domain-containing protein	B7SYD0	Stenotrophomonas_phage	8.3e-283	62.6
WP_167285223.1\|2912206_2912446_-	hypothetical protein	NA	NA	NA	NA
WP_141625191.1\|2912442_2912799_-	hypothetical protein	NA	NA	NA	NA
WP_141624195.1\|2913042_2913387_+	hypothetical protein	NA	NA	NA	NA
WP_141624196.1\|2913490_2913721_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_167285225.1\|2913800_2914514_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_141624198.1\|2914514_2915102_-	hypothetical protein	A0A0P0IYG9	Acinetobacter_phage	1.1e-07	41.7
WP_141624199.1\|2915131_2915773_-	NAD-dependent DNA ligase	A0A0U4J8W4	Pseudomonas_phage	1.3e-38	43.3
WP_141624200.1\|2915997_2916429_+	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_141624201.1\|2916461_2916725_+	hypothetical protein	NA	NA	NA	NA
WP_141624202.1\|2916724_2916931_+	hypothetical protein	NA	NA	NA	NA
WP_141624203.1\|2916927_2917356_+	hypothetical protein	NA	NA	NA	NA
WP_141624204.1\|2917352_2917541_+	hypothetical protein	NA	NA	NA	NA
WP_141624205.1\|2917544_2917760_+	hypothetical protein	NA	NA	NA	NA
WP_141625192.1\|2917864_2918047_+	hypothetical protein	NA	NA	NA	NA
WP_141624206.1\|2918057_2918366_+	hypothetical protein	NA	NA	NA	NA
WP_141624207.1\|2918362_2918902_+	hypothetical protein	A0A0M3UKD7	Mycobacterium_phage	2.2e-36	47.0
WP_141624208.1\|2918898_2919489_+	hypothetical protein	NA	NA	NA	NA
WP_141624209.1\|2919520_2919742_+	hypothetical protein	NA	NA	NA	NA
WP_141624210.1\|2919749_2920148_+	hypothetical protein	NA	NA	NA	NA
WP_141624211.1\|2920165_2920789_+	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_141624212.1\|2920825_2921290_+	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_141624213.1\|2921296_2921740_+	four helix bundle protein	NA	NA	NA	NA
WP_141624214.1\|2921736_2923083_+	reverse transcriptase	D4HTV9	Vibrio_phage	2.5e-44	32.5
WP_141624215.1\|2923090_2923405_+	hypothetical protein	NA	NA	NA	NA
WP_141624216.1\|2923401_2923854_+	hypothetical protein	NA	NA	NA	NA
WP_141624217.1\|2923846_2925604_+	modification methylase	Q5QF27	Pseudomonas_virus	2.3e-191	54.8
WP_141624218.1\|2925600_2925795_+	hypothetical protein	NA	NA	NA	NA
WP_141624219.1\|2925791_2926010_+	hypothetical protein	V9IQX6	Stenotrophomonas_phage	1.6e-09	55.2
WP_141624220.1\|2926015_2927146_+\|integrase	integrase	V9IQN0	Stenotrophomonas_phage	8.7e-67	38.6
WP_167285228.1\|2927279_2927483_+	hypothetical protein	NA	NA	NA	NA
WP_141624222.1\|2927479_2927722_+	hypothetical protein	NA	NA	NA	NA
WP_141624223.1\|2927718_2928090_+	hypothetical protein	NA	NA	NA	NA
WP_141624224.1\|2928447_2929158_-	7-cyano-7-deazaguanine synthase QueC	A0A126HGA1	Vibrio_phage	2.2e-20	32.1
2928229:2928273	attR	NA	NA	NA	NA
WP_141624225.1\|2929248_2929926_-	7-carboxy-7-deazaguanine synthase QueE	J9PV61	Bacillus_phage	3.5e-39	40.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP041242

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection