CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP041191	Labrenzia sp. PHM005 chromosome, complete genome	0 crisprs	WYL,csa3,DEDDh,cas3	0	0	4	0
NZ_CP041190	Labrenzia sp. PHM005 plasmid p1BIR, complete sequence	1 crisprs	NA	0	2	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

29344 : 44272

Rhodobacter_phage(42.86%)

transposase,integrase,capsid

attL 12334:12348|attR 36942:36956

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
12334:12348	attL	NA	NA	NA	NA
WP_141183573.1\|29344_29872_-	helix-turn-helix domain-containing protein	A0A2K9V305	Faecalibacterium_phage	3.4e-05	36.6
WP_141183574.1\|30028_30340_+	transcriptional regulator	NA	NA	NA	NA
WP_141183575.1\|30591_31431_+	ParB N-terminal domain-containing protein	R9U496	Rhizobium_phage	7.9e-49	46.2
WP_141188497.1\|31456_31882_+	hypothetical protein	NA	NA	NA	NA
WP_141183576.1\|31878_34041_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	M4T586	Rhodobacter_phage	2.6e-136	40.7
WP_141183577.1\|34109_34865_+	AAA family ATPase	A0A0A1IVZ3	Pseudomonas_phage	1.9e-41	40.2
WP_141183578.1\|34864_35506_+	hypothetical protein	M4SNW4	Rhodobacter_phage	2.6e-20	34.4
WP_141183579.1\|35502_35883_+	transcriptional regulator	A0A1B0T6G8	Thiobacimonas_phage	2.5e-18	43.1
WP_141183580.1\|35875_36130_+	hypothetical protein	NA	NA	NA	NA
WP_141183581.1\|36126_36555_+	hypothetical protein	NA	NA	NA	NA
WP_141183582.1\|36559_36805_+	gas vesicle protein V	NA	NA	NA	NA
WP_141183583.1\|36826_37093_+	hypothetical protein	NA	NA	NA	NA
36942:36956	attR	NA	NA	NA	NA
WP_141183584.1\|37089_37710_+	DUF1018 domain-containing protein	A0A219VHC6	Ochrobactrum_phage	3.1e-34	41.4
WP_141183585.1\|37706_38057_+	helix-turn-helix domain-containing protein	A0A1B0T6G2	Thiobacimonas_phage	1.2e-14	42.9
WP_168206220.1\|38143_38800_+	hypothetical protein	A9DET4	Yersinia_phage	3.2e-37	59.8
WP_141183586.1\|38826_39054_+	hypothetical protein	NA	NA	NA	NA
WP_141183587.1\|39053_39389_+	DUF2730 family protein	NA	NA	NA	NA
WP_168206221.1\|39388_39685_+	hypothetical protein	M4SPS4	Rhodobacter_phage	1.7e-14	42.9
WP_141183589.1\|39688_40273_+	DUF3486 family protein	M4SNU5	Rhodobacter_phage	2.1e-32	47.1
WP_141183590.1\|40269_41928_+	hypothetical protein	M4SRU6	Rhodobacter_phage	6.0e-210	66.7
WP_141183591.1\|41927_43490_+	DUF935 family protein	M4SPR8	Rhodobacter_phage	7.2e-112	43.9
WP_141183592.1\|43492_44272_+\|capsid	minor capsid protein	A0A219VH74	Ochrobactrum_phage	1.5e-54	46.0

DBSCAN-SWA_2

47945 : 62566

Rhodobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141183595.1\|47945_48992_+	hypothetical protein	A0A0M5N0Q6	Ralstonia_phage	1.3e-24	31.6
WP_141183596.1\|48988_49399_+	hypothetical protein	A0A1B0T6E4	Thiobacimonas_phage	2.9e-28	54.1
WP_141183597.1\|49428_50325_+	hypothetical protein	M4SRT6	Rhodobacter_phage	1.8e-91	51.7
WP_141183598.1\|50440_50671_+	hypothetical protein	NA	NA	NA	NA
WP_141183599.1\|50680_51112_+	DUF1320 family protein	A0A1B0T6F3	Thiobacimonas_phage	1.8e-20	42.0
WP_141183600.1\|51111_51711_+	phage virion morphogenesis protein	A0A1B1P725	Rhodovulum_phage	4.5e-14	32.8
WP_141183601.1\|51707_52136_+	hypothetical protein	NA	NA	NA	NA
WP_168206222.1\|52132_52282_+	hypothetical protein	NA	NA	NA	NA
WP_141183602.1\|52285_53209_+	hypothetical protein	G8GWF3	Rhodobacter_phage	1.3e-84	49.3
WP_141183603.1\|53217_53556_+	hypothetical protein	NA	NA	NA	NA
WP_141183604.1\|53621_53927_+	hypothetical protein	NA	NA	NA	NA
WP_141183605.1\|53923_55933_+	hypothetical protein	M4SPQ3	Rhodobacter_phage	1.2e-18	32.5
WP_141183606.1\|55937_56564_+	TIGR02217 family protein	A0A0B5A2K3	Paracoccus_phage	1.7e-56	55.0
WP_141183607.1\|56560_57445_+	DUF2163 domain-containing protein	A0A1V0DY93	Dinoroseobacter_phage	1.2e-68	47.6
WP_141183608.1\|57441_57897_+	peptidase P60	F4YXU4	Roseobacter_phage	4.4e-30	42.9
WP_141183609.1\|57896_61850_+	hypothetical protein	A0A0B5A7K5	Paracoccus_phage	2.0e-235	39.1
WP_141183610.1\|61846_62566_+	DUF2793 domain-containing protein	A0A1V0DY81	Dinoroseobacter_phage	8.8e-49	46.2

DBSCAN-SWA_3

3923477 : 3935594

uncultured_Mediterranean_phage(72.73%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141186686.1\|3923477_3924497_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	1.4e-23	44.2
WP_141188793.1\|3924538_3925348_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.4e-34	35.6
WP_141186687.1\|3925340_3926048_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	8.4e-44	50.3
WP_141186688.1\|3926047_3927163_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	6.8e-32	36.8
WP_141186689.1\|3927307_3927532_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	4.3e-10	75.6
WP_141186690.1\|3927573_3927993_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_141186691.1\|3927989_3928790_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.8e-55	48.2
WP_141186692.1\|3928857_3930138_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.2e-98	45.7
WP_141186693.1\|3930187_3930946_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.5e-40	39.7
WP_141186694.1\|3930968_3931661_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	9.5e-24	42.3
WP_141186695.1\|3931759_3932341_+	hypothetical protein	NA	NA	NA	NA
WP_141186696.1\|3932377_3932836_+	hypothetical protein	NA	NA	NA	NA
WP_141186697.1\|3933033_3934470_+	peptidoglycan DD-metalloendopeptidase family protein	A0A0Y0AH42	Bacillus_phage	2.6e-07	32.8
WP_141186698.1\|3934538_3935594_-	histidinol-phosphate transaminase	A0A0H3TLT9	Faustovirus	4.8e-19	26.1

DBSCAN-SWA_4

4978573 : 4994634

Dinoroseobacter_phage(16.67%)

portal,protease,capsid,tail,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141187530.1\|4978573_4979464_-	lysozyme	A0A068CDE9	Acinetobacter_phage	1.4e-08	35.1
WP_141187531.1\|4979540_4980266_-	DUF2793 domain-containing protein	A0A1V0DY81	Dinoroseobacter_phage	3.0e-44	43.5
WP_141187532.1\|4980258_4984146_-	hypothetical protein	A0A0K1Y6G6	Rhodobacter_phage	7.2e-230	41.1
WP_141188885.1\|4984145_4984634_-	peptidase P60	A0A1V0DYB6	Dinoroseobacter_phage	3.3e-31	47.2
WP_141187533.1\|4984611_4985502_-	DUF2163 domain-containing protein	A0A0K0PVK1	Roseobacter_phage	1.9e-48	37.5
WP_141187534.1\|4985541_4986177_-	TIGR02217 family protein	A0A0K1LLZ8	Rhodobacter_phage	6.0e-49	50.2
WP_141187535.1\|4986275_4986530_+	DUF465 domain-containing protein	NA	NA	NA	NA
WP_141188886.1\|4986552_4987023_-\|tail	phage tail tape measure protein	A0A1B0VMG8	Pseudomonas_phage	1.2e-06	47.6
WP_141187536.1\|4987089_4987293_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_141187537.1\|4987292_4987640_-	gene transfer agent family protein	NA	NA	NA	NA
WP_141187538.1\|4987666_4988080_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_141187539.1\|4988272_4988689_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_141187540.1\|4988685_4989006_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_141187541.1\|4989002_4989572_-	hypothetical protein	A0A141GEW4	Brucella_phage	3.4e-19	33.0
WP_141188887.1\|4989720_4990950_-\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	7.9e-82	42.2
WP_141187542.1\|4991048_4991567_-\|head,protease	HK97 family phage prohead protease	A0A0R6PIR7	Moraxella_phage	8.1e-20	41.8
WP_141187543.1\|4991838_4992036_-	hypothetical protein	NA	NA	NA	NA
WP_141187544.1\|4992028_4993237_-\|portal	phage portal protein	W8ECU7	Geobacillus_phage	2.9e-76	41.7
WP_168206557.1\|4993329_4994634_-	DNA-packaging protein	A0A0K1LMR9	Caulobacter_phage	9.9e-83	42.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP041190

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041190_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041190_1

13603-13715

Orphan

Consensus_repeat	Method
ATTCATGTGTGAAATGACGAAT	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP041190_1

>merge|NZ_CP041190|1|13603-13715|PILER-CR
ATTCATGTGTAAAATGACGAAAATACATGTGTGAAATGACGAAGCCGCATGTGTGAAATGACGAATAGGGCACAAAAGTTATCCGCACGGAATTCATGTGTGAAATGACGAAT

>NZ_CP041190|1|1|13603-13715|PILER-CR
ATTCATGTGTAAAATGACGAAA	ATACATGTGTGAAATGACGAAG
CCGCATGTGTGAAATGACGAAT	AGGGCACAAAAGTTATCCGCACGGA
ATTCATGTGTGAAATGACGAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041190.1\|WP_141183540.1\|9809_10724_-\|Abi-family-protein	unknown	unknown	gnl\|CDD\|377910
NZ_CP041190.1\|WP_141183538.1\|7734_8121_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041190.1\|WP_141183550.1\|17962_18304_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041190.1\|WP_141183547.1\|15672_15915_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041190.1\|WP_141183541.1\|11142_11766_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041190.1\|WP_141183548.1\|15980_16460_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041190.1\|WP_141183545.1\|13756_14827_+\|RepB-family-plasmid-replication-initiator-protein	unknown	unknown	gnl\|CDD\|370826
NZ_CP041190.1\|WP_141183543.1\|12567_12828_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041190.1\|WP_141183539.1\|8477_8828_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041190.1\|WP_141183549.1\|16545_17973_-\|relaxase/mobilization-nuclease-domain-containing-protein	unknown	unknown	gnl\|CDD\|367497
NZ_CP041190.1\|WP_141183537.1\|7017_7299_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041190.1\|WP_141183542.1\|12199_12571_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041190.1\|WP_141183536.1\|5969_6881_-\|Abi-family-protein	unknown	unknown	gnl\|CDD\|377910
NZ_CP041190.1\|WP_141183544.1\|12828_13161_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041190.1\|WP_141183551.1\|18907_19156_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041190.1\|WP_141183546.1\|14950_15646_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|349760
NZ_CP041190.1\|WP_141183535.1\|5228_5774_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737

Protein	Function_ID	Function_description	E-value
NZ_CP041190.1\|WP_141183540.1\|9809_10724_-\|Abi-family-protein	gnl\|CDD\|377910	pfam07751, Abi_2, Abi-like protein. This family, found in various bacterial species, contains sequences that are similar to the Abi group of proteins, which are involved in bacteriophage resistance mediated by abortive infection in Lactococcus species. The proteins are thought to have helix-turn-helix motifs, found in many DNA-binding proteins, allowing them to perform their function.	1.12047e-64
NZ_CP041190.1\|WP_141183549.1\|16545_17973_-\|relaxase/mobilization-nuclease-domain-containing-protein	gnl\|CDD\|367497	pfam03432, Relaxase, Relaxase/Mobilisation nuclease domain. Relaxases/mobilisation proteins are required for the horizontal transfer of genetic information contained on plasmids that occurs during bacterial conjugation. The relaxase, in conjunction with several auxiliary proteins, forms the relaxation complex or relaxosome. Relaxases nick duplex DNA in a specific manner by catalyzing trans-esterification.	7.10881e-09
NZ_CP041190.1\|WP_141183536.1\|5969_6881_-\|Abi-family-protein	gnl\|CDD\|377910	pfam07751, Abi_2, Abi-like protein. This family, found in various bacterial species, contains sequences that are similar to the Abi group of proteins, which are involved in bacteriophage resistance mediated by abortive infection in Lactococcus species. The proteins are thought to have helix-turn-helix motifs, found in many DNA-binding proteins, allowing them to perform their function.	3.29026e-48
NZ_CP041190.1\|WP_141183535.1\|5228_5774_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	1.20497e-35
NZ_CP041190.1\|WP_141183545.1\|13756_14827_+\|RepB-family-plasmid-replication-initiator-protein	gnl\|CDD\|370826	pfam10134, RPA, Replication initiator protein A. Members of this family of bacterial proteins are single-stranded DNA binding proteins that are involved in DNA replication, repair and recombination.	3.57452e-90
NZ_CP041190.1\|WP_141183546.1\|14950_15646_+\|AAA-family-ATPase	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	2.50916e-21

>NZ_CP041190.1|WP_141183544.1|12828_13161_+|hypothetical-protein
MDNESLETAIISASARVLLNYKIHRDPRIDFGSLNRPICAGFELAALTVTAINTLKLDHPDKTEQIEEIEKITELILSSPSDHIGLSTLDHDMKRLADNCIELFNPDYSG
>NZ_CP041190.1|WP_141183543.1|12567_12828_+|hypothetical-protein
MTKSDRDMNHLLERMHTCSGTVIMTDKALNDPDEDEPEFLELAAKLREEHSLLLAQLYNEFICEVLERRRTTGDFQYPFEPLGSGS
>NZ_CP041190.1|WP_141183542.1|12199_12571_+|hypothetical-protein
MSQFHDHETGQQLRCACTNVIGFWQLLHCEHTTSGKPICPIKRMAWRAHLTGCAANLAEFVIKHDRDIARGFLEDPRRMPEIIGKALGIRAIVNVGERLEIEDQLEDCASKFAIQLLGALKCK
>NZ_CP041190.1|WP_141183541.1|11142_11766_-|hypothetical-protein
MTKKSYTEHIGRRAAANVFHAFDFAKNTGHPMNTYTVLHLRDQDSASVTTQFTKIRRKFRNWYSYHQKKNNCAMLPPIYTYTFEAPTGAVHVNWVLHIPDAMLAEFQKKLPKWVEKVTGDLQPYDIKTERITPGTDKRVANYCNKGVDPLYAEHFNLNQISAPQGRIYGRRVTVSTAISKASREAVGFKAKYHRNDHQKGRIWQFPS
>NZ_CP041190.1|WP_141183540.1|9809_10724_-|Abi-family-protein
MEITDEQRAKSYLSHINYYRLSAYWYPFRESQTITDPNTGRQRTTILDTFKPGTHFSHALDLYIFDKKLRLMALDALERIEIALRADLAILLGQRAPLAHRDPAQLHGHFSRRRRNPQAETEHEKWLRILDGKAVRSREDFAQHFRRKYPGADMPIWVAAELWDFGALSHLYAGLLQADRDAIAQSYGVPDGRIFETWVRVLNDVRNICAHHSRLWNKPLVNIPRMAGPGDIPAFDHIQADRRAQTRVYAALAIMRHMVGVINPNSSWCLFLLEHLGTFPDNAYVSLKNAGFADGWEQQVIWTG
>NZ_CP041190.1|WP_141183539.1|8477_8828_-|hypothetical-protein
MDAITKTDDPTEGQTLQKIEAYLRGVQADDEVVIRNTHGGILTFEIAKVTGTKPSSGRLYTDLSGGYGGCAWYMKSGKNTYYPGGQSQLFIPTDAIREFMNEHPTGMWTYKTYSPE
>NZ_CP041190.1|WP_141183538.1|7734_8121_+|hypothetical-protein
MKMKLIIAVATISMSATSAFASCSSGFFTNAACEMGWIDRNAANLIDRGHGALGSPMDRFAQRIVDRILPGSNPGFGRNQHYNERYTEPRRMIGNYCATQYGRFGPVQPMPVGSFCADIYGNRGHIVR
>NZ_CP041190.1|WP_141183537.1|7017_7299_-|hypothetical-protein
MADFIFPDNNTVLLTSLGISTVMIGGGILLLRSLKENSPLAPHALQLSGLTFIAPILLVMSLVTDLPNEALVGFIGTIVGYFFGVSKVPPDKK
>NZ_CP041190.1|WP_141183536.1|5969_6881_-|Abi-family-protein
MGRHTPARGGKGRPFFVHGLSLRPYTKPHALPADRVQHLRSKGLIISRPNVAAQKIEAIGYERLRIYFLSRRDQPGRTFRTGTTYRDIIQLYECDARLRELAFEAVGRFELAFRNVISEALSDRFGSHPYYNRTAFKDAKAHNQALSQVIQTFDKSKDERAKHYRQTYDPPALPPIWTFKEFLTFGGAARLYASLNGPLRTDVARAFGVPRLPIFESWVLCFVDLRNICAHHDRLFNRRFQKQLQHLPREGIPAAANNTLKAHLECLDHALAAVGEQSGSVAKAQRLMNLQKYAAVSPAEAGF
>NZ_CP041190.1|WP_141183535.1|5228_5774_-|recombinase-family-protein
MKIGYARVSSINQNLDRQIAALRAEGCDKIFRDKASGKSLRGRPELEKAIDALGTDHVLIVAEWDRATRSMMDGLGIMQRIADRGALIKVLDKPHLDLTTPIGRGLLVMLSAMAEDERERIISRAEDGRAVARTKNVKFGRKSKLDEHQRRKALERLAAGESAREIGRDFGVSHTTISRLR
>NZ_CP041190.1|WP_141183545.1|13756_14827_+|RepB-family-plasmid-replication-initiator-protein
MTNQTEQQRDLSPLLPDRHPEPDFFVCDIFDAAPKADTASMVHPLFTLSTKPDYRIREYSKGAIWLKVKPGSDGAATVHDRDVLIYCISQCMAAINDGRKIDRKMRFRAHDLLRTTNRKTSGEGYRLLQAALARLQSTQIETNIVTGGAEQWKVFSFIDSAETIKETRDGRMQEVEITLSDWVFNAIREKGGDILTISRDYFRLRKPLERRLYEIARKSCGQKSYFHYKVQTLYEITGSASTLPEFRRMLTKIIRDNQQHRHIPDYVFELDGDLVKIRPKREFSEAYEPAPKAIDKVKLKLGVHEAAKKLAAGWDTYSLEDDWRAMLAQKGEVPANPEGSFVGFVKWYVQKHGAAR
>NZ_CP041190.1|WP_141183546.1|14950_15646_+|AAA-family-ATPase
MPVITFANSKGGSGKTTSALLLACALAELKPTTIIDADPRHPVTTWGKMDGKPDNLTVVTNDSERTILDEIEAASEKDPFVIIDLEGTASRLMSYAISQSDLVIIPLKEQQQDAMAALDVIQEIHRDMKATRRKIPYATLFTQSKAAVKSRTAKHIAMQFRENPKIDCFTIEIFERDAFAAMFTIGGTIRDMNPSKVGGLDKAILNLEGFRDEVIAKLRANREAQATSEVA
>NZ_CP041190.1|WP_141183547.1|15672_15915_+|hypothetical-protein
MDLGDLDDFQPKPKPTQPAVDTKRAVDSVSSFPSREAPEEGQMNIKGNKAILMRFKQMCKDDRRSYADMLEILMDRFEKP
>NZ_CP041190.1|WP_141183548.1|15980_16460_-|hypothetical-protein
MSKTIRAHFIAITAVFAEMLLSAVSADAAEFKKMGYTGEYDHEQMLEKAREASKNGNVVVFVNSKHELFRKAVTIGFKKFTINALKAGASNDATFTVVYGEDVDGSPEIQDVDFYINGINLHSFRVEDFNNQPAELAKATIQHAEVAINKHLDAMKKTE
>NZ_CP041190.1|WP_141183549.1|16545_17973_-|relaxase/mobilization-nuclease-domain-containing-protein
MVPKLHAKGSSFKGAASYLLYDKDRAPSSDRVAWTQTRNLVSEDPNTAWKIMAATALDQARLKQQAGVKNTGRKSDKHVLHFTLAWHPDQDPDRDEMMKAANGAIKALGASKHQALIIAHNDEKHPHLHVMINRVSPQDGRHLSSSKEKLKLSKWAQAYEEESGQVLCEQRVTNNLLRSQGHYVRGEKNAPRHIFEQQKAAAANDNPHYEAVREGQKSKDADIAGRGRDQAKRHKAQWDELDQSHRQSKAGILHGVKRDMARAGRKILEDYKPKITETLKRQRAEVKTFDALEATLFGRAKNAVSGLNLLKRVYGDERGSLLSRGFAVLTRASARRELIDKAHAKEIRDLKVAQNKETRAERAKIKERGRDSLSDQDKSFTAERSALVFKQGLESASLRSEWRQRRKDRASAWDKFAEFSAKRKRTMGDFKAAGAKKDNEGYKASVLARQARLAARMSREGEKDKDSKKDRDTDT
>NZ_CP041190.1|WP_141183550.1|17962_18304_-|hypothetical-protein
MARPKKHEHERRDASTRTDLTLAEKTKLAELVRESGLRSEAEFVRAAIFSANIHPPARTSSVDPALISELNRIGVNVNQLAASVHMDRDFVQYWREIGDALSNALEKVIADGS
>NZ_CP041190.1|WP_141183551.1|18907_19156_-|hypothetical-protein
MSQSTNNTPLETLRDGAVKVTIWENQSQKGIWYSVEPGRAYTDAEGIVKTATWLSKMDILKLRRLLDQAYDRIREIRSQRIA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP041190_1	1.1\|13625\|22\|NZ_CP041190\|PILER-CR	13625-13646	22	NZ_CP041190	Labrenzia sp. PHM005 plasmid p1BIR, complete sequence	13625-13646	0	1.0
NZ_CP041190_1	1.2\|13669\|25\|NZ_CP041190\|PILER-CR	13669-13693	25	NZ_CP041190	Labrenzia sp. PHM005 plasmid p1BIR, complete sequence	13669-13693	0	1.0
NZ_CP041190_1	1.1\|13625\|22\|NZ_CP041190\|PILER-CR	13625-13646	22	NZ_CP041190	Labrenzia sp. PHM005 plasmid p1BIR, complete sequence	13694-13715	2	0.909

1. spacer 1.1|13625|22|NZ_CP041190|PILER-CR matches to NZ_CP041190 (Labrenzia sp. PHM005 plasmid p1BIR, complete sequence) position: , mismatch: 0, identity: 1.0

atacatgtgtgaaatgacgaag	CRISPR spacer
atacatgtgtgaaatgacgaag	Protospacer
**********************

2. spacer 1.2|13669|25|NZ_CP041190|PILER-CR matches to NZ_CP041190 (Labrenzia sp. PHM005 plasmid p1BIR, complete sequence) position: , mismatch: 0, identity: 1.0

agggcacaaaagttatccgcacgga	CRISPR spacer
agggcacaaaagttatccgcacgga	Protospacer
*************************

3. spacer 1.1|13625|22|NZ_CP041190|PILER-CR matches to NZ_CP041190 (Labrenzia sp. PHM005 plasmid p1BIR, complete sequence) position: , mismatch: 2, identity: 0.909

atacatgtgtgaaatgacgaag	CRISPR spacer
attcatgtgtgaaatgacgaat	Protospacer
** ******************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP041191

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP041190

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection