CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP031202	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_D, complete sequence	0 crisprs	NA	0	0
NZ_CP031199	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_A, complete sequence	0 crisprs	NA	0	1
NZ_CP031207	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_I, complete sequence	0 crisprs	NA	0	0
NZ_CP031206	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_H, complete sequence	0 crisprs	NA	0	0
NZ_CP031204	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_F, complete sequence	0 crisprs	NA	0	0
NZ_CP031201	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_C, complete sequence	1 crisprs	NA	1	0
NZ_CP031203	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_E, complete sequence	0 crisprs	NA	0	0
NZ_CP031200	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence	1 crisprs	NA	1	0
NZ_CP031198	Lactobacillus brevis strain UCCLBBS449 chromosome, complete genome	1 crisprs	cas3,csa3,DEDDh,DinG	2	12
NZ_CP031205	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_G, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031200_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031200_1

39587-39690

Orphan

Consensus_repeat	Method
TGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031200_1

>merge|NZ_CP031200|1|39587-39690|CRISPRCasFinder
TGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTTTGCGGGGTGTCGTCAACGAACTTTCGCGAATGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTTTG

>NZ_CP031200|1|1|39587-39690|CRISPRCasFinder
TGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTTTG	CGGGGTGTCGTCAACGAACTTTCGCGAA
TGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTTTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031200.1\|WP_065463719.1\|38592_38772_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031200.1\|WP_003589709.1\|29390_29750_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|377579
NZ_CP031200.1\|WP_125584215.1\|33289_34315_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP031200.1\|WP_139592735.1\|29111_29390_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP031200.1\|WP_139592736.1\|36183_38244_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473
NZ_CP031200.1\|WP_086989620.1\|36003_36171_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031200.1\|WP_056988651.1\|25788_26175_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031200.1\|WP_075168598.1\|29958_30792_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031200.1\|WP_010014585.1\|30791_31937_+\|ATP-dependent-Clp-protease-ATP-binding-subunit	unknown	unknown	gnl\|CDD\|223616
NZ_CP031200.1\|WP_139592734.1\|26225_28991_-\|class-I-SAM-dependent-DNA-methyltransferase	unknown	unknown	gnl\|CDD\|223934

Protein	Function_ID	Function_description	E-value
NZ_CP031200.1\|WP_125584215.1\|33289_34315_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.20949e-71
NZ_CP031200.1\|WP_139592735.1\|29111_29390_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.06582e-10
NZ_CP031200.1\|WP_139592736.1\|36183_38244_-\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	3.86338e-102
NZ_CP031200.1\|WP_003589709.1\|29390_29750_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|377579	pfam05973, Gp49, Phage derived protein Gp49-like (DUF891). This family consists of hypothetical bacterial proteins of unknown function as well as phage Gp49 proteins.	3.84952e-17
NZ_CP031200.1\|WP_010014585.1\|30791_31937_+\|ATP-dependent-Clp-protease-ATP-binding-subunit	gnl\|CDD\|223616	COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones].	2.94477e-20
NZ_CP031200.1\|WP_139592734.1\|26225_28991_-\|class-I-SAM-dependent-DNA-methyltransferase	gnl\|CDD\|223934	COG1002, COG1002, Type II restriction enzyme, methylase subunits [Defense mechanisms].	4.71492e-05

>NZ_CP031200.1|WP_065463719.1|38592_38772_-|hypothetical-protein
MSKKIWIVIFRYLLAIGLFLAYSALFDNQDHDLIRSTLVFAICLGLAIIPFSHKTKSKK
>NZ_CP031200.1|WP_139592736.1|36183_38244_-|MobA/MobL-family-protein
MAIFHMSFSNISAGKGRSAIASAAYRSGEKLFDDKEGRRYFYARSVIPESFILTPQNAPEWASDREKLWNEVEKNDRKSNSRYAKEFNVALPVELSESEQKELLTKYVQENFVDQGMVADVAIHRDHSDNPHAHVMLTNRPFNPDGSWGLKAKTQYIKDENGKQLLTKSGFPKQRKIWLVDWDKKEKINEWRKNWALSVNQFLAQKNIPDRISEKSFVNQGIQETPTQHEGINSQRKNRKAFNQQVRAQRNAQAKYHNLDEKIRNHEHFDALTDELSFSEKHTISHLSQQLKTYVDLEHLDDKQRMLFNWKNSLLIKHAVGEDVTKQLLTIDQKTTSLKQANQLLNKVVERATKKLYPELNFEQTTAAERRELIKETNSEQTIFKGSELAERLADIRNDLLTQQLLTFTKRPYTSWQLVNQQVQTIKKQLTTVLAKHGHHLDDLKHTDRGMLAAYQPNELEFISKAVKNLRVMREVKAVVQTQYNSILTTAFPNSDLDKLETIDKEQIYTAVVYYDPELKPLSADDLSQLQQQPPVVFTSQQHQAGLNYLLGKMELKDIQDHRLQRVLKHDGTRQLFIGECGQDPKLDHQQIEMVQTRLKQQTMRFDQYKRAQVKDYQAINYHPTSPKNYLTNILDEALMTILYAKNTDYLRKQQLRGLKETEWEMTKKKRQHQTRNRHEDGGMHL
>NZ_CP031200.1|WP_086989620.1|36003_36171_-|hypothetical-protein
MKGAYKYLKGTTENGAYYQAAWQKLADGYVDLYGTTPIQIRSLPTLNDIFEDEEG
>NZ_CP031200.1|WP_125584215.1|33289_34315_+|IS30-family-transposase
MTRIKNIISNQYHQLSLAERGRIEALRDLDWSIRRIAKVLHRDPSTISRELRRGTTTQINANTRIFEQLYLAETGEAVYRKHRLNSCYRGLFDHCQTFCNALVTALKARPRMHSVDTFVHQFKTNYPGVVCPSTPTVYRYIDDQRLAIRNSDLPAKLRRRVKRPGTKHHRINKKNLGHSIEERPTVVQARQELGHWEGDLVKGKRVESEPALMTLTERISRLEIIVKLPNYHADTCLKALQNTLYDYGTEYFKTITFDNGAEFSSLSQVEGTDIYFAHPYSPWERGTNENTNGLLREFFPKGRSLALASLVDIQLAQDTLNNRLRRSLNYRCPADLMPELA
>NZ_CP031200.1|WP_010014585.1|30791_31937_+|ATP-dependent-Clp-protease-ATP-binding-subunit
MANIQLFYGSSKDFRSLLNQNQVEDNYTPFMELIRQYNVTVRANDTMGNKDAEFSRDKIGNVVIFADDFASVTEHVISNFSNIVLLGHDIENLYIQNPPKRVEYSIRSNFDEDEIVEVTSPYFSPSTTEVTKLYSQLLTGKVIGQNNAKHASCVGLYKAAYHHQKKPTVMMFYGPSGVGKTELAKNISNFYHGKLTRIQFSMMQTEEAFKYVFGDEHARPSMARDLLSRESNIVLIDEFDKVSPSLYNVFYQMFDEGIFEDINYKVDVSSCIFILTSNFNDEETIASTVGLPIYSRIDQKIKFEKLTKEEISTVISNAFKRILSELTPEDQKFISASKLEEHYQENLQIFSNVRMLDSFIENDVYTMLLEQQITVNSSSDE
>NZ_CP031200.1|WP_075168598.1|29958_30792_+|hypothetical-protein
MKKILPRKIIYFDETSAVDLLQVRQKGHLTRTEETIRSMTGKIGADADIKAQLDEDVGVNKLVSHISGLSAGINSMMGANGSLNGSKIARTVIENSLLYDFLESAESKRGTPLLDIKEDYALSIPKDSMTYFATIAPLTEMMEGHQQLDNPDITMAISKMNSGIRNSKGYYEVVGEKTDSKFGKSITTQKVFRFNIDAFKNNYRIQDLPKMNLVLYAIHVGTTKLSQLDFETEFNLDSQQSEVGFSGLAKQAQSHQDADSNDEKSLDVFDVVLAGVR
>NZ_CP031200.1|WP_003589709.1|29390_29750_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MENPKFEFYTRPSGHNEFQEFLDSLKPVEKQKLVTVIAKTQKFGLQVAARQMWIRKISDGIFELRTTGSNIQRGLYFHVEGPRYVITHGFTKKTQKTPVSELNHAKELRTEYYDNLGGK
>NZ_CP031200.1|WP_139592735.1|29111_29390_-|helix-turn-helix-domain-containing-protein
MAKNISFDHYLAEQLKDPEFKAGFDAESAKLESAVALMSERERAGLTQRELAERADVPQSTIARIEHGQNTSFDTMSKIAFALGKKLKVEFT
>NZ_CP031200.1|WP_139592734.1|26225_28991_-|class-I-SAM-dependent-DNA-methyltransferase
MKEADQKRAATAFVKRWQDRGNERQDSQTFWLDLLETVYDIPNPGEYISFEDRVMLDHTSFIDGFIDTTKVLIEQKGRNKSLFDGIRQSDGSLLSPFEQAKRYSANLPYSKRPRWIITSNFTQFFVYDMEQPNGEPAVIQLKDLPTEYYRLDFIVDQLNPHLDKEMEVSMQAGELVGKIYDELFTQYRDPTNASSQRSINELSVRLVFCLYAEDAGIFGRHGMFHDYLNEFETRHLRTALIDLFRVLDTPIDKRDPYLEEKLAEFPYVNGGMFTNEEVEIPQFTDSLRALILDQASKEFDWSEISPTIFGAVFESTLNPDTRREGGMHYTSIANIHKVIDPMFLDGLRNELTEIKQIKQRKTMIQRATDFQARLGKLRFFDPACGSGNFLTETYLSLRKLENQVISLIYGNESMLAVDDDLIKVSIQQFYGIEINDFAVSVGKTALWIAESQMMEETAAIVYANMDFLPLKTYTNITEGNAIRLDWETVVGGERITYIIGNPPFYGHEKRTRAQAADMDIAFHDFTKYGKLDYVAAWYNKAADFIQGKTTEVAFVSTNSITQGEQAPTLWPKLFEKSIEIQFAYRTFRWSSEAKEKAQVHVVIIGFTGYPRKEKKRLFEGGQMKLVDHINAYLTAGTDVFPQPRRKTSISGANFPVMSKGSQPTDGGNLILSPAERAALIKQYPQTESYIRRYVGSRDFINNVERYCIWLKGVSPSQFRSVPPIMERLAAVTEARLKSPTPSVKALAEVPMLFTEIRQPDSNYLAVPEVSSENRRYVPMGWMSPAVIASNKLYLVPNASLYMFGVMTSNVHMAWMRAVAGRMKSDYSYSPTVYANFPWPEVDDKQKAQIEQTAQGILDARKLYPDSSLADLYDPLATVPELRKAHQDNDRAVMRAYGLTIKGTTESDTVAMLFERYRQLTK
>NZ_CP031200.1|WP_056988651.1|25788_26175_+|hypothetical-protein
MAKMLSMRDFDYSKIGNIFELDEVTPKMATEERLDDSGNKIMGNDGTPRKFNTDEIVGYKYSVTILEGEHRKKSTQITVAGLDCPINNAEIMKRDSVKCRFTGLEPSMVGNPIYYKAEKIELVAPQAK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NC_017017	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence	5388-5415	0	1.0
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP014928	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence	6825-6852	0	1.0
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NC_017468	Lactobacillus helveticus H10 plasmid pH10, complete sequence	15845-15872	0	1.0
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP047125	Lactobacillus hilgardii strain FLUB plasmid unnamed4	5238-5265	0	1.0
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP033891	Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence	3331-3358	0	1.0
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP031200	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence	39625-39652	0	1.0
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP014920	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence	12633-12660	0	1.0
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NC_008498	Lactobacillus brevis ATCC 367 plasmid 1, complete sequence	8763-8790	1	0.964
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP014874	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence	6855-6882	1	0.964
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NC_006529	Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence	4743-4770	1	0.964
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP014900	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence	28836-28863	1	0.964
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP027191	Lactobacillus sp. CBA3605 plasmid pCBA3605-1, complete sequence	29360-29387	1	0.964
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP027195	Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence	30410-30437	1	0.964
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NC_015421	Lactobacillus buchneri NRRL B-30929 plasmid pLBUC03, complete sequence	1006-1033	1	0.964
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP014913	Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence	22509-22536	2	0.929
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP019033	Lactobacillus fermentum strain SNUV175 plasmid pSNU175-4, complete sequence	21084-21111	2	0.929
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP017368	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence	5771-5798	2	0.929
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP017265	Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence	26505-26532	2	0.929
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	6892-6919	2	0.929
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	20911-20938	2	0.929
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP017358	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence	4831-4858	2	0.929
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP019982	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence	10406-10433	2	0.929
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP019982	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence	86925-86952	2	0.929
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP014934	Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence	5934-5961	2	0.929
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP014937	Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence	5935-5962	2	0.929
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	MK994179	Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence	4886-4913	2	0.929
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP011537	Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence	7182-7209	2	0.929
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_AP014682	Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-2, complete sequence	516-543	4	0.857
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	NZ_CP017093	Streptococcus suis strain ISU2812 plasmid pISU2812, complete sequence	160-187	5	0.821
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	KX785321	Streptococcus suis strain 6936 plasmid unnamed1, complete sequence	2250-2277	5	0.821
NZ_CP031200_1	1.1\|39625\|28\|NZ_CP031200\|CRISPRCasFinder	39625-39652	28	MN034684	Leviviridae sp. isolate H1_Rhizo_27_scaffold_801 RNA-dependent RNA polymerase (H1Rhizo27801_000001), hypothetical protein (H1Rhizo27801_000002), and hypothetical protein (H1Rhizo27801_000003) genes, complete cds	2055-2082	6	0.786

1. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NC_017017 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence) position: , mismatch: 0, identity: 1.0

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcgtcaacgaactttcgcgaa	Protospacer
****************************

2. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP014928 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence) position: , mismatch: 0, identity: 1.0

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcgtcaacgaactttcgcgaa	Protospacer
****************************

3. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NC_017468 (Lactobacillus helveticus H10 plasmid pH10, complete sequence) position: , mismatch: 0, identity: 1.0

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcgtcaacgaactttcgcgaa	Protospacer
****************************

4. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP047125 (Lactobacillus hilgardii strain FLUB plasmid unnamed4) position: , mismatch: 0, identity: 1.0

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcgtcaacgaactttcgcgaa	Protospacer
****************************

5. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP033891 (Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence) position: , mismatch: 0, identity: 1.0

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcgtcaacgaactttcgcgaa	Protospacer
****************************

6. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP031200 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence) position: , mismatch: 0, identity: 1.0

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcgtcaacgaactttcgcgaa	Protospacer
****************************

7. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP014920 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence) position: , mismatch: 0, identity: 1.0

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcgtcaacgaactttcgcgaa	Protospacer
****************************

8. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NC_008498 (Lactobacillus brevis ATCC 367 plasmid 1, complete sequence) position: , mismatch: 1, identity: 0.964

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
tggggtgtcgtcaacgaactttcgcgaa	Protospacer
.***************************

9. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP014874 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence) position: , mismatch: 1, identity: 0.964

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgttgtcaacgaactttcgcgaa	Protospacer
********.*******************

10. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NC_006529 (Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence) position: , mismatch: 1, identity: 0.964

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcgtcaacggactttcgcgaa	Protospacer
****************.***********

11. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP014900 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence) position: , mismatch: 1, identity: 0.964

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgttgtcaacgaactttcgcgaa	Protospacer
********.*******************

12. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP027191 (Lactobacillus sp. CBA3605 plasmid pCBA3605-1, complete sequence) position: , mismatch: 1, identity: 0.964

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgttgtcaacgaactttcgcgaa	Protospacer
********.*******************

13. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP027195 (Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence) position: , mismatch: 1, identity: 0.964

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgttgtcaacgaactttcgcgaa	Protospacer
********.*******************

14. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NC_015421 (Lactobacillus buchneri NRRL B-30929 plasmid pLBUC03, complete sequence) position: , mismatch: 1, identity: 0.964

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cgggttgtcgtcaacgaactttcgcgaa	Protospacer
**** ***********************

15. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP014913 (Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence) position: , mismatch: 2, identity: 0.929

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcatcaacggactttcgcgaa	Protospacer
*********.******.***********

16. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP019033 (Lactobacillus fermentum strain SNUV175 plasmid pSNU175-4, complete sequence) position: , mismatch: 2, identity: 0.929

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggagtgtcgtcaacggactttcgcgaa	Protospacer
***.************.***********

17. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP017368 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence) position: , mismatch: 2, identity: 0.929

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcatcaacggactttcgcgaa	Protospacer
*********.******.***********

18. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP017265 (Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence) position: , mismatch: 2, identity: 0.929

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcatcaacggactttcgcgaa	Protospacer
*********.******.***********

19. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 2, identity: 0.929

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcatcaacggactttcgcgaa	Protospacer
*********.******.***********

20. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 2, identity: 0.929

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcatcaacggactttcgcgaa	Protospacer
*********.******.***********

21. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP017358 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence) position: , mismatch: 2, identity: 0.929

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcatcaacggactttcgcgaa	Protospacer
*********.******.***********

22. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP019982 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence) position: , mismatch: 2, identity: 0.929

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggagtgttgtcaacgaactttcgcgaa	Protospacer
***.****.*******************

23. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP019982 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence) position: , mismatch: 2, identity: 0.929

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggagtgttgtcaacgaactttcgcgaa	Protospacer
***.****.*******************

24. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP014934 (Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence) position: , mismatch: 2, identity: 0.929

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcatcaacggactttcgcgaa	Protospacer
*********.******.***********

25. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP014937 (Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence) position: , mismatch: 2, identity: 0.929

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcatcaacggactttcgcgaa	Protospacer
*********.******.***********

26. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to MK994179 (Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence) position: , mismatch: 2, identity: 0.929

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggggtgtcatcaacggactttcgcgaa	Protospacer
*********.******.***********

27. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP011537 (Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence) position: , mismatch: 2, identity: 0.929

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cggagtgtcgtcaacggactttcgcgaa	Protospacer
***.************.***********

28. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_AP014682 (Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-2, complete sequence) position: , mismatch: 4, identity: 0.857

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
aggggtgtcgtcaacgaacttatgcgga	Protospacer
 ******************** .***.*

29. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to NZ_CP017093 (Streptococcus suis strain ISU2812 plasmid pISU2812, complete sequence) position: , mismatch: 5, identity: 0.821

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cagcttatcgtcaacgaactttcgcgac	Protospacer
*.*  *.********************

30. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to KX785321 (Streptococcus suis strain 6936 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
cagcttatcgtcaacgaactttcgcgac	Protospacer
*.*  *.********************

31. spacer 1.1|39625|28|NZ_CP031200|CRISPRCasFinder matches to MN034684 (Leviviridae sp. isolate H1_Rhizo_27_scaffold_801 RNA-dependent RNA polymerase (H1Rhizo27801_000001), hypothetical protein (H1Rhizo27801_000002), and hypothetical protein (H1Rhizo27801_000003) genes, complete cds) position: , mismatch: 6, identity: 0.786

cggggtgtcgtcaacgaactttcgcgaa	CRISPR spacer
gctggtgtcgtcaacgaacattcgctac	Protospacer
   **************** ***** *

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP031198

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031198_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031198_1

2529867-2530199

Orphan

I-E,II-B

Consensus_repeat	Method
GGATCACCCCCACACCTGTGGGGAATAC	CRISPRCasFinder
GGATCACCCCCACACCTGTGGGGAATAC	CRT
GGATCACCCCCACACCTGTGGGGAATAC	PILER-CR

5 spacers

The CRISPR arrays of NZ_CP031198_1

>merge|NZ_CP031198|1|2529867-2530199|CRISPRCasFinder,CRT,PILER-CR
GAAATGCCCCCACACCTGTGGGGTATACGCTTAAAATCAAGCAGTCGTTGGGCTACGTCAAGGATCACCCCCACACCTGTGGGGAATACCAACTGACACCCGTTGAGCCACTTCCCATGCAAGGATCACCCCCACACCTGTGGGGAATACCCGTCGAAGAAAACGGGGTGGCTACGCCGCTAGGGATCACCCCCACACCTGTGGGGAATACTTTCTGGATTGACCAGCAGAGAGTACCCGGCCAGGATCACCCCCACACCTGTGGGGAATACTTAAAAAGTGCATCTCAGACTAAGGAGTGTTTAGGATCACCCCCACACCTGTGGGGAATAC

>NZ_CP031198|1|1|2529867-2530199|CRISPRCasFinder
GAAATGCCCCCACACCTGTGGGGTATAC	GCTTAAAATCAAGCAGTCGTTGGGCTACGTCAA
GGATCACCCCCACACCTGTGGGGAATAC	CAACTGACACCCGTTGAGCCACTTCCCATGCAA
GGATCACCCCCACACCTGTGGGGAATAC	CCGTCGAAGAAAACGGGGTGGCTACGCCGCTAG
GGATCACCCCCACACCTGTGGGGAATAC	TTTCTGGATTGACCAGCAGAGAGTACCCGGCCA
GGATCACCCCCACACCTGTGGGGAATAC	TTAAAAAGTGCATCTCAGACTAAGGAGTGTTTA
GGATCACCCCCACACCTGTGGGGAATAC

>NZ_CP031198|1|1|2529867-2530199|CRT
GAAATGCCCCCACACCTGTGGGGTATAC	GCTTAAAATCAAGCAGTCGTTGGGCTACGTCAA
GGATCACCCCCACACCTGTGGGGAATAC	CAACTGACACCCGTTGAGCCACTTCCCATGCAA
GGATCACCCCCACACCTGTGGGGAATAC	CCGTCGAAGAAAACGGGGTGGCTACGCCGCTAG
GGATCACCCCCACACCTGTGGGGAATAC	TTTCTGGATTGACCAGCAGAGAGTACCCGGCCA
GGATCACCCCCACACCTGTGGGGAATAC	TTAAAAAGTGCATCTCAGACTAAGGAGTGTTTA
GGATCACCCCCACACCTGTGGGGAATAC

>NZ_CP031198|1|1|2529928-2530199|PILER-CR
GGATCACCCCCACACCTGTGGGGAATAC	CAACTGACACCCGTTGAGCCACTTCCCATGCAA
GGATCACCCCCACACCTGTGGGGAATAC	CCGTCGAAGAAAACGGGGTGGCTACGCCGCTAG
GGATCACCCCCACACCTGTGGGGAATAC	TTTCTGGATTGACCAGCAGAGAGTACCCGGCCA
GGATCACCCCCACACCTGTGGGGAATAC	TTAAAAAGTGCATCTCAGACTAAGGAGTGTTTA
GGATCACCCCCACACCTGTGGGGAATAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031198.1\|WP_042749655.1\|2515885_2519674_-\|helicase-exonuclease-AddAB-subunit-AddA	unknown	unknown	gnl\|CDD\|274299
NZ_CP031198.1\|WP_042749658.1\|2531014_2531950_+\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|130256
NZ_CP031198.1\|WP_081374791.1\|2538507_2540310_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380090
NZ_CP031198.1\|WP_042520631.1\|2527131_2528115_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381309
NZ_CP031198.1\|WP_021742666.1\|2513712_2514525_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP031198.1\|WP_011668936.1\|2525947_2526313_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031198.1\|WP_042749659.1\|2531964_2532720_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|366444
NZ_CP031198.1\|WP_039106462.1\|2540362_2540815_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031198.1\|WP_042520630.1\|2530338_2530869_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP031198.1\|WP_011668945.1\|2537270_2537792_+\|QueT-transporter-family-protein	unknown	unknown	gnl\|CDD\|377623
NZ_CP031198.1\|WP_042520633.1\|2523557_2524700_+\|ArgE/DapE-family-deacylase	unknown	unknown	gnl\|CDD\|181490
NZ_CP031198.1\|WP_010619295.1\|2543490_2544516_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP031198.1\|WP_042749660.1\|2532877_2533792_-\|prenyltransferase	unknown	unknown	gnl\|CDD\|260125
NZ_CP031198.1\|WP_139592714.1\|2541083_2543357_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|285636
NZ_CP031198.1\|WP_042520626.1\|2533893_2537010_-\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|370572
NZ_CP031198.1\|WP_042520632.1\|2524802_2525816_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200578
NZ_CP031198.1\|WP_024526073.1\|2526389_2526989_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|379199
NZ_CP031198.1\|WP_011668939.1\|2528395_2529706_+\|NCS2-family-permease	unknown	unknown	gnl\|CDD\|225161
NZ_CP031198.1\|WP_042749653.1\|2514888_2515794_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031198.1\|WP_139592713.1\|2519657_2523263_-\|ATP-dependent-helicase	unknown	unknown	gnl\|CDD\|213736

Protein	Function_ID	Function_description	E-value
NZ_CP031198.1\|WP_042749655.1\|2515885_2519674_-\|helicase-exonuclease-AddAB-subunit-AddA	gnl\|CDD\|274299	TIGR02785, ATP-dependent_helicase/nuclease_subunit_A, helicase-exonuclease AddAB, AddA subunit, Firmicutes type. AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the Firmicutes (as modeled here) and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP031198.1\|WP_042749658.1\|2531014_2531950_+\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	gnl\|CDD\|130256	TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other].	1.03053e-105
NZ_CP031198.1\|WP_081374791.1\|2538507_2540310_+\|hypothetical-protein	gnl\|CDD\|380090	pfam18013, Phage_lysozyme2, Phage tail lysozyme. This domain has a lysozyme like fold. It is found in the tail protein of various phages probably giving them the ability to degrade the host cell wall peptidoglycan layer.	1.03939e-34
NZ_CP031198.1\|WP_042520631.1\|2527131_2528115_+\|aldo/keto-reductase	gnl\|CDD\|381309	cd19083, AKR_AKR11A1_11D1, AKR11A and AKR11D families of aldo-keto reductase (AKR). Bacillus subtilis aldo-keto reductase IolS, also called vegetative protein 147 (VEG147), is a founding member of aldo-keto reductase family 11 member A1 (AKR11A1). It is able to reduce the standard aldo-keto reductase (AKR) substrates DL-glyceraldehyde, D-erythrose, and methylglyoxal in the presence of NADPH, albeit with poor efficiency in vitro. Bacillus aryabhattai aldo keto reductase is a founding member of aldo-keto reductase family 11 member D1 (AKR11D1).	6.20915e-167
NZ_CP031198.1\|WP_021742666.1\|2513712_2514525_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	1.24988e-19
NZ_CP031198.1\|WP_010619295.1\|2543490_2544516_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	2.05419e-70
NZ_CP031198.1\|WP_042520630.1\|2530338_2530869_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	7.17121e-16
NZ_CP031198.1\|WP_011668945.1\|2537270_2537792_+\|QueT-transporter-family-protein	gnl\|CDD\|377623	pfam06177, QueT, QueT transporter. This family includes the queT gene encoding a hypothetical integral membrane protein with 5 predicted transmembrane regions. The queT genes in Firmicutes are often preceded by the PreQ1 (7-aminomethyl-7-deazaguanine) riboswitches of two distinct classes, suggesting involvement of the QueT transporters in uptake of a queuosine biosynthetic intermediate.	2.03886e-36
NZ_CP031198.1\|WP_042520633.1\|2523557_2524700_+\|ArgE/DapE-family-deacylase	gnl\|CDD\|181490	PRK08588, PRK08588, succinyl-diaminopimelate desuccinylase; Reviewed.	0
NZ_CP031198.1\|WP_042749660.1\|2532877_2533792_-\|prenyltransferase	gnl\|CDD\|260125	cd13962, PT_UbiA_UBIAD1, 1,4-Dihydroxy-2-naphthoate octaprenyltransferase. Human UBIAD1 is an enzyme involved in the synthesis of MK-4. Menaquinones (MKs, also called bacterial forms) are one of the two forms of natural vitamin K, the other being the plant form, phylloquinone (PK). All forms of vitamin K have a 2-methyl-1,4-naphthoquinone (menadione; K3) ring structure in common. At the 3-position of the ring, PK has a phytyl side chain while MKs have several repeating prenyl units. Prenyltransferases (PTs) catalyze the regioselective transfer of prenyl moieties onto a wide variety of substrates and play an important role in many biosynthetic pathways.	2.96459e-59
NZ_CP031198.1\|WP_139592714.1\|2541083_2543357_+\|hypothetical-protein	gnl\|CDD\|285636	pfam08460, SH3_5, Bacterial SH3 domain.	5.17484e-09
NZ_CP031198.1\|WP_042520626.1\|2533893_2537010_-\|YfhO-family-protein	gnl\|CDD\|370572	pfam09586, YfhO, Bacterial membrane protein YfhO. This protein is a conserved membrane protein. The yfhO gene is transcribed in Difco sporulation medium and the transcription is affected by the YvrGHb two-component system. Some members of this family have been annotated as glycosyl transferases of the PMT family.	3.45689e-75
NZ_CP031198.1\|WP_042520632.1\|2524802_2525816_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200578	cd10954, CE4_CtAXE_like, Catalytic NodB homology domain of Clostridium thermocellum acetylxylan esterase and its bacterial homologs. This family is represented by Clostridium thermocellum acetylxylan esterase (CtAXE, EC 3.1.1.72), a member of the carbohydrate esterase 4 (CE4) superfamily. CtAXE deacetylates O-acetylated xylan, a key component of plant cell walls. It shows no detectable activity on generic esterase substrates including para-nitrophenyl acetate. It is specific for sugar-based substrates and will precipitate acetylxylan, as a consequence of deacetylation. CtAXE is a monomeric protein containing a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold as other CE4 esterases. However, due to differences in the topography of the substrate-binding groove, the chemistry of the active center, and metal ion coordination, CtAXE has different metal ion preference and lacks activity on N-acetyl substrates. It is significantly activated by Co2+. Moreover, CtAXE displays distinctly different ligand coordination to the metal ion, utilizing an aspartate, a histidine, and four water molecules, as opposed to the conserved His-His-Asp zinc-binding triad of other CE4 esterases.	3.00717e-79
NZ_CP031198.1\|WP_024526073.1\|2526389_2526989_-\|SDR-family-oxidoreductase	gnl\|CDD\|379199	pfam13460, NAD_binding_10, NAD(P)H-binding.	9.31849e-29
NZ_CP031198.1\|WP_011668939.1\|2528395_2529706_+\|NCS2-family-permease	gnl\|CDD\|225161	COG2252, COG2252, Xanthine/uracil/vitamin C permease [Nucleotide transport and metabolism].	4.97728e-143
NZ_CP031198.1\|WP_042749659.1\|2531964_2532720_+\|ABC-transporter-permease	gnl\|CDD\|366444	pfam01061, ABC2_membrane, ABC-2 type transporter.	4.62129e-17
NZ_CP031198.1\|WP_139592713.1\|2519657_2523263_-\|ATP-dependent-helicase	gnl\|CDD\|213736	TIGR02773, ATP-dependent_helicase/deoxyribonuclease_subunit_B, helicase-exonuclease AddAB, AddB subunit. DNA repair is accomplished by several different systems in prokaryotes. Recombinational repair of double-stranded DNA breaks involves the RecBCD pathway in some lineages, and AddAB (also called RexAB) in other. The AddA protein is conserved between the firmicutes and the alphaproteobacteria, while the partner protein is not. Nevertheless, the partner is designated AddB in both systems. This model describes the AddB protein as found Bacillus subtilis and related species. Although the RexB protein of Streptococcus and Lactococcus is considered to be orthologous, functionally equivalent, and merely named differently, all members of this protein family have a P-loop nucleotide binding motif GxxGxGK[ST] at the N-terminus, unlike RexB proteins, and a CxxCxxxxxC motif at the C-terminus, both of which may be relevant to function. [DNA metabolism, DNA replication, recombination, and repair].	0

>NZ_CP031198.1|WP_011668939.1|2528395_2529706_+|NCS2-family-permease
MQRIANFFHFEELGTNYKTEILAGLTTFVSMAYILFVNPQVLGASGISQGAVFTATAFASAFGCMLMGILANYPIAISASLGINAFFAYSVVIGMKVPWQTALAGVFVASILFMILTAFKLREKVVDAIPRDLKMAISAGIGLFIAFIGLSQGGLVAADKSTIVSLGSLQVGSTWLTIFGLLVTVLLMSARVPGAIFIGMVANSILGLVTGLIPMPSHIVAAVPSISSTFMVGLTHVGSINSLQMIVVVLTFLLVTFFDTTGTLVGLAEQAGLVKNNKLPRIGKALMADSSTMVVGSLLGTSPMGAFVESSAGIAVGGRTGFTAIVTGILFIFGAFFSPLLAVVTDQVTAPALIIVGVLMAQSLKNIHWEKFEVAAPAFLIVLGMPLTYSISDGIALGFITYPLTMLAAKRGKEVGAMMYGLAVVFVLFLWILNAA
>NZ_CP031198.1|WP_042520631.1|2527131_2528115_+|aldo/keto-reductase
MTHELVTIGKTDVRTTPLGLGTNAVGGYNLFPNLKDDDGLNLVKAGLNHGIQLLDTAFVYGLGHSEELVGQAMHDFDRHSFTLATKGAQDFSSGEQVINNDPAFLTAQVDASLKRLNTDYLDIYYIHFPDKQTPKAEAVGALQRLREQGKIRAIGLSNFSLAQVKEANADGYVDVVEDEFSLLHRDHETDLMPYLADHQISFVPYFPLASGLLTGKYDQSVQFPADDIRSQISDFQEPRYSQALTAIDQVRPIAQAHHATVAQTILAWYMQNPLVSVVIPGAKRAAQVEANAQALEVTLTAAEYQTIDTAFAGFKATANGKSLADPD
>NZ_CP031198.1|WP_024526073.1|2526389_2526989_-|SDR-family-oxidoreductase
MTTYLIIGANRVGQLVARQLATESATVRLLHDGKETLPSDLATQVTELTGDLTQEATYTAALQDQPIIFSALTGMDVDLAFEALFDAQYHQRLTFQRFVMLSTAGVDQEVTGDLAYPGITNVAEYLKQQRYAAKLVDEAEFPYTILRPVTLADSPRRDPQIIKEGTAVPAGTVSRETVAQVAVSLLQAGGADYQSLAIC
>NZ_CP031198.1|WP_011668936.1|2525947_2526313_-|hypothetical-protein
MALQIDEQQLQAIRERMDEANQRAHFVIFQSVERESGKVLRLITDIDSFRAIQEQHQDDSDMVIIQDIVPITDTLARWAVAENMAAQQGDNAEVLADLERYTNEVLKENHQTVNPPESTDD
>NZ_CP031198.1|WP_042520632.1|2524802_2525816_-|polysaccharide-deacetylase-family-protein
MVKIGKVLGVLVATVALGVGSVPVTGQAKSTNKTVTFGQLTNKNTHRLAAIRQAARQEILITTKAKSSRVAAVYQVKLPTHMTKTATLTKSGLRMNLLKNSFKVKQITIPYAQLKGKVLNRYLPKANRTSTIKTSKLVALTFDDGPDPTLTPRLLKTLKKYHAHATFFEVGQSVSRYPKISRAVLAGGNEIGNHSWNHPNFNSIGTAQTVSQVTRTNRAIYQATGTLPQYVRPPYGNITVAEGRAIEQPIIRWSVDSRDWAYLNSSKDINEVMHDTHGGDIILMHDIHAQSVAAAPTIIKRLQAKGYKLVTVSQLLNSQALPGLQYFGAHDYRTVGK
>NZ_CP031198.1|WP_042520633.1|2523557_2524700_+|ArgE/DapE-family-deacylase
MEDSEQIQILQHLISINSVNDHEADVAAYIQQLFADHGITSQIIPYADGRANIIAEIGDTTSDQVFALAGHLDTVATGDVADWKFDPFSAHIVDNQLYGRGAADMKSGLAAMVITLINLADQQTPLTGRLRFIGTVGEENGAMGSRMLTEKGVADDLTAMVIGEPTGGNLVYAHNGSLNYHVYSRGVGAHSSMPEKGINAITNLIKYVTAEATAFDDAPVSPELGPLVHSVTVFNGGEQVNSIPAKAELQGNIRPIPEFDNTAVIHRLHETVDRLNQEPGVDLALHVDYSFKPIISAKDSPLVQTTKAIADQEFGHAIDLQVIHGATDASEFTKSSHDFPVIAYGAGKWDAAHALNESVDLDEFRHVQHIYQQLVEKFLS
>NZ_CP031198.1|WP_139592713.1|2519657_2523263_-|ATP-dependent-helicase
MSLQFILGSAGQDHRTPMVTALAQQVTAHPTDQSYYLVPNHIKFETEVDVLSALKNQIAPEQALFAQTQVQVFSFTRLAWSFMKNEPIYQLPRISPAGLNMLIYQIIQTHADELTIFRGEVDRPGFVSQLATQLAEFKVGQVTAADLMSAIEQLDTTNTDLQAKLHDLMIIYEAFETQMMGKFVENTDLLNQLATYLEQQVDLQHAHFYLEGFSQLSAQERQLVAILIQRSASVTVALNLDHGYPQKLPDKTTLFFQSAKLYQQLYMVAQANRVPVLIDQQAKTARVSADLQALDTYWQASQILSPQPSAVEKPTHIQIVQAANRYVEVSRVATQIRQLVATGNYRYRDFLVLTRHLDAYQTVIDPIFRAQAVPYFDDADIRMADHPFVELLNALFDVQRRNYRYADVFRVLKSELLLPRDADGELMAVPAYRQALALTENFVLKNGLEGQHWWTQDKDWVYNRFAMGDGGVQTTRDDQISAQINRIRQFVKQILPPFFARLKAAATYTDAAAVLYQFVTNAGVSERLIAWRDQAIAAGDLTKAGQPEQTWAAFCDILDEFHTILGDLPTVLPDFQALLQAGFAGAKFSQIPSTLDQVVISESGIVQANNRKITFIMGATADTMPDNQIPTTLLADNDRQDLSARLQQVDDGTYLRDDAATQLAGEPYLNYLAFMSGSERLIFSYPAMSDDARSGLQLSPYVARIKDYFGLSIDIAAANPVAENEAILPFVGTRRTTLRHLVQASHDSQLREVPLSRSWLYVLNLLRTDPTYGELTTKLLGSLSYRNVPTQLTPDIVTQLYGTKINTSISKLEEYYANPYAYFLKYGLNLQERDVFALSPASTGEFFHATLDGLMKLVNDQKLNLAALDDQQLREMTDEVMAKLLDTTENPQFAILESSHRMGYIRQQLMKTMRQMAKTLQEQSKRTKLRPKRTEVQFGLGDDRGLAALSFDVGKRRQVTVRGRIDRLDAVQVKDKTYLGIVDYKSSEHKFSYQEAYYGRAMQMLTYLDAVKQNLPTLLDTPTAKDAELAGAVYLHLQDPILKAAEVLGEDPLTSLLKAEQYQGLLLDDPDLLTNLDTLFGTPDYSGSSLLFRGLRRTKTGKITSYGKLLVNPNELDLLLTHTERLIKRAATDIFDGRVDLAPFREQNRTALQYSPYKSVMQFDPLLKENNYRDLPSLNKDDVMARIAAEQEQEATDEHEI
>NZ_CP031198.1|WP_042749655.1|2515885_2519674_-|helicase-exonuclease-AddAB-subunit-AddA
MSTKFSFTPSQDQAIHQTGNNLLVSASAGSGKTRVLVQRVIERLKAGVGIDQILIVTFTKAAAAEMRERIQTALRQELAASQGDSAQQQFYLRQLNQLPVADISTLDAFCLRLLQRYYYVIDLDPVFRLLADETENGLLRDEVWADLREDLYANDDSGLFAQLTENFSGDRNDQGLADLVQQTYTFANATPNPTAWLAELPQPYQLDSDQLMTTSFYQQRLRPFFQSQLQQLQADLTSAQALANQAGLDKQAAHVTAVLENIAAVQQLVTGDSWNALRAAIQDFAWGRMPAVRKTNEDYPIYNELKTTYYDPARKQLDSLKKTYLIQDEQQAMTTIRRSGELVGELSRVVTAFRTAYRQEKQRRHVLDFADVEHAALAILTQDSDQSRQVAAQLRHQFAEIMVDEYQDTNGLQEAILTAIAEPAPQGNLFMVGDVKQSIYRFRQADPTLFMTKTDQYAADAAAGELIVLAENFRSMKNVDDFTNLIFKQLMDRELGEIDYTGAAQLKFGASYYPDTVTSTAELLVYLTEDAPESAGDADSEAMDATFQVDNKHQGEVLMVGQKIQQLIADQTPIYDREAKQVRPMTYGDITLLTPTRTNNLIITDELRRLGIPVVVNDAQNYFKTTEIQIMMALLQIIDNPYQDIPLAAVLRSPIVGLNENELALLRINQRTGDYYQAVLHFQRSFVPNQASDFQQAVYQKVSHFLEQLQEFRDIAQQDELVTLIWRIYQETGFLDYVGGMPAGEQRQANLHALYERAKSYEQSSFKGLFQFVRFVERLQERDDDLAGAPVQAADDAVSVMTIHGSKGLEFPVVFIMDASRQFNKQDQQGNYVMSGKTGIGIDYLDPDSRVKAPSLQKLVTAQAISRASLAEEMRKLYVALTRAESRVYIVGSHKTQEAAISAWEQAYRSPNLVLNATLREKNTLANYLDWIGMCLVRDPKFAAELRQGTTTFSGLAGDPATFAVHFVTAHDLGPTQGVNETAVDWLQAASETAAKVTTPPVDTEQLHQIMDFRYPHQAATATTAYQSVSEAKRLFEDPDNATIGEYQASATGQVGGHRFVTHDFARPDFLQTVREPLATEIGSATHLVLQQLDVTVTPTLDRVQGVIDQLVADQVLTAEVAQRIQPELILRFFSSSVGQQILAAPDQLHREVPFSLLMPARSLFQDFQETDSQVLVHGIIDGYLTTPAGVILFDYKTDHVNAQNQAASIEKIVERYGGQVNLYAAALKQMTGQPIVGQYLYLLAIGELVAVPEQQVRRLSE
>NZ_CP031198.1|WP_042749653.1|2514888_2515794_+|hypothetical-protein
MTIITRIIKGCLCLLALGTVTVGSLSGRAQTEKPSALVKVGDYRASTDFLNLSAYYQTTRPVTVKVAYVSTYKSQHTIMQKLTLPAGLTVAGNLTTTKHGSYLVPSLQLYLARLSYPALQNSAKANYTIDPGASAYSPQATISDTTKLRAFKRVAAPDYMPGYSHGDLYIGGAKAALSPVEPTTKSIRITPDGYVEVLKYDTKANAGLGFYQKPVSLAKIVKTRFHDPNRTLYLNHPLASVKTKAITQNGQTRYRLTLKNLHTPQHIAGDPETGTAGTFDSLYSIGGTTYYTFIGYDGVSN
>NZ_CP031198.1|WP_021742666.1|2513712_2514525_-|helix-turn-helix-transcriptional-regulator
MAYLGIITENFTRRFGIMGWDLQFTHYLDDMQTYRSRDQTAKALILLGYVERDFIRFYRAGRIAEGIQFAKENLARSRLLLNELPPQQKRAQLHGLVDILAFEGVQNHAFIYEFIQLRDDYHRQIKTLPVTTARYVPWIIEIVQDFGNLAAKDGLPYDDHLESTLDIIYYVSAHLRDKLTVKQVVDHVNQRCNPVGVQRAFSDEMQMSIRDYINVKKIREAQRALLTTTVSVKQIAQELGFYDTSDFSKRFKREIGQTPLEYRQINSQKD
>NZ_CP031198.1|WP_042520630.1|2530338_2530869_-|MarR-family-transcriptional-regulator
MSDLFKQETTASKLIEFGMLRHVADDIADRDDDHPERQMIFQGQGKILLALMQEDHLAQKELAERLNLTAQSTAEFVRKLEKKGFVTRMKSPTDRRVTVVSITDAGRKETTKNVQQIPPFLTILDDTELDQLAHILDKVNQHMYEEVNAANPTWFNKFHQVIMNRMLSQLHSGEDR
>NZ_CP031198.1|WP_042749658.1|2531014_2531950_+|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein
MQPSTAITVSHLSKTFGVKTVVDDLSFAVKPGEVFGLLGPNGAGKTTTLRMMTTLLKATSGTVTIFGHDVRKESRLARAMFGLTGQYASIDEDISARENLMIFSRLNGLSRTAAKQRTTELLEEFSLTASANKALSDFSGGMRRRLDLAVSLITRPGLIFLDEPTTGLDPRTRSQMWTTIRQLVAHGSTIVLTTQYLDEADALADRIAVIDHGKLIKLGTPTALKQQIGGATLTLSLAKATQGPLAQRLLAQALHAQPTLNGAQLTAHLENPNQITDLLVQLQTADISLANIAVQEPSLDDVFFALTTGKN
>NZ_CP031198.1|WP_042749659.1|2531964_2532720_+|ABC-transporter-permease
MEIQTQHGNLIGNSLTMANRNLLKTLHNPDRFMDVIIQPVMFMLLFGYLFGGAIAGGVQAYLPTIVPGILIQTLLSAASGSGAQIREDLDSGVFDRFKSLPMAHIAPLAGQLFADILRLLVATVASLLTGYAMGWRPTVGFGWIIVIGWAISWVFALFGLLAKSSSMVQSVSMMVMMLLSFLSNAFIPLKTLPHFMRVIADANPITYVITAIRQILAQGAWNNNAWIVLIFGIGIVVLFAPLTVWAYNHNN
>NZ_CP031198.1|WP_042749660.1|2532877_2533792_-|prenyltransferase
MPKWLNWSVFYELTEIYTAPLNVMWFILGAAIAQYHVHTVDWINVGLCLAVVFIFDLAVNVADNYYDYLHAHDREDYTQKTNPIGRLHLPAKGVFWLAWVLYAVAAIPGIVLAMRTGWPVAVFGVVGYLIGIFYTAGPHPINATPVSAAVVALAIAFWIQLTCVYVSIYGQQPLSWSIVGTTFLLCMPLTLIFFTVQLANDTSDREEDIANHRYTLAVYLGKRRSVRLIQLFLVIGTLWTLVNVGLGLAPLVTALAVILLPVMWRGMRPFFAIQDKRKTFMAMVKSASLFFIAYPVLFALGTWL
>NZ_CP031198.1|WP_042520626.1|2533893_2537010_-|YfhO-family-protein
MRIAHHRWPLWVLYTLAFAVIAAISFGIFGVANRTLIWNMDGITQHYPLIREFHQLLMKSGLAGVTGWSWTFGLGADKLTTLAYYVLGDPFAYALALLPTRLLEVGYGWAIVLRLYAAGLAFLVLAKRYAFKPGSQLVGAVTYAFTGYSLMVGVHHPFFLLPMIWLPLLFVGIDRILQGKGWGFLAAVTGITILSNFYFAYILGLGSLIYAIIRYFSCRERGQLAVSWLVATARFLAAAVTGLLISGVLLLPSLLMMLKSTRTVSIFANGLWLYPLNYYLTLSNTILTTGNTLNYWAVLGITGFGFLGCVYTLVHWRQHRWLAITLLAVIVGLLFPAVAAFFNVLSTPSNRWILLAAVPFGLALMTLMDHLTALSLPDRWWLLGSSLGLLVVIYLSNGFTFSNPARDLLTYGLLLATTLLVVVALPRRWMFGGVGILIGLNLINNAWGYYDPNLSNQATQQLRASDATRYIQDYFDGAQSAVQSDHAFSRVSATRNYNLFRTVGNNMTMSHGLHGIMSYFSVQNGYVGQFSRDLGNAEYAMNAPMGQADGRTTLTQLLGVKYLFARTDQVTNHAALPYGYQAAKKIYPEQPVYGLSNGVGTQVLTTNLAFPLVYTQPQVLTIKAWHRLSLVDRERSLTQAAVTSQPVAGVKAAHYQSPKRTLAYTVTPDTIPVIDSTNKVIQYRLKQAAAGQKTGLNDKQLATYGTTIQTPQLTVDKNGLLSKQEVQQYGPMVQLSRNQAALQRVLTHNQQIIQRTTQVNQTGLHQLTSDAQGQPIKYTVTLKHPQQAQGTELYLELDGISSQQLTTKDQLQTADNTSVLGNTPRSNLTKLNAWRTAISNPDLGDYWVTAKTRNATKTFSQFGLDNLSDYEPKHQVLLNLGYSQQLRKTIDVTFNATKQLNIKSAKLIAVPFGASYDQQVHAVQRRGLQHAQIRDNSVTGELTTPQASVMTTSIPYSSGWRLTVDGRPTATTVVNEGFVGARLAAGTHRIRLTYRTPGLIGGLILTIVGLVAWLGEMSWWHWRHPQAKTHAAKSKSDA
>NZ_CP031198.1|WP_011668945.1|2537270_2537792_+|QueT-transporter-family-protein
MNSKKRVSGVSDTRSMVLAALIAALYVVLTTVLSALSFGPFQIRLSEMFNHLVVFNKRYIAAVTLGVFIANIIASPFGFLDIATGTIQTLLALLVMYWLSKFVHNRIAQMAINTVVAVFFMCMIAWEIAIVSKTAFWPTFWANWLSIGWGELVSMIFGGVVIYLLSLKIDFTK
>NZ_CP031198.1|WP_081374791.1|2538507_2540310_+|hypothetical-protein
MTERDFMSTEVADISSYQDDSLAFMQSLAVYAKSIIVKITQGSATGDAYINPKAKTQVANGLKVFKTVGAYHYFKGNSQKYGDSDPINEAKWFDKNLQAVGLDKSTVCAIDVEDAVVMQNATHDINLFLQYMSQQGYKHLVVYASASWFISGRINKTQLFNGTPIWVAAYNNVEPGVDNASAWQYTDNGHGLHVDFSYDFDGTLLGEATSTGTGSGTITPVQPTDALHQHAAQVYNYFHAKGLSDAAICGILGNLQHESTINPAQWQLGMPHTWSMSSSTGYGIAQFTPAGKIKAYADKIGKSVSDISVQLDYIWGQVTTNGFYGGGKTFKQFALNTNPKTAAVDFLRGYEMHTMISDALAAREKYAANWWTIYNKGNAGTFGVNTRKMNTATAQATPDGYSIDISGAFTFDTSCAVRNTPKMSDAGVATYTDGGTVNYDKKLKTDDHFWLSYVSASGIRRYVPYANTATGVYFGSDTNPKDPISTDSETGSAGTTTGTTTAGGTAETTPEMYTISATGAFTFNTNCRVRNTPVMSDTGVATYTTGMVVNYDTKLKNDNHFWLSYLAASGVRRYVPYGNISKGTYFGTDTNPKDPIKPAE
>NZ_CP031198.1|WP_039106462.1|2540362_2540815_+|hypothetical-protein
MPNPLYNSVDYTATIKKTREFLADYHMWHVEAAHFSSWVKSPSNFGTPSYHSTENTVENRVVDQANAQFECELRTKTLEQLATVDNESALLSDLLLFRWINNWSVKKTCTELAEKYQRGFIAERTYANYLKKALWEFAVICPRSLFVQKS
>NZ_CP031198.1|WP_139592714.1|2541083_2543357_+|hypothetical-protein
MHKFISAIRAFFIPIIMKEVLCMAIDVSNTPDMYKITASGSFTFNTSCRVRNTPNMSDSGVATYTSGMTVSYDSKLKNGNHLWLSYIATSGTRRYIPYANTDTGVYFGTDTNSVNPIKAATSGSGSTGTGTTTGALGSLTGQTGANVADQTPDGTILAMSGSFTFSEAARGRDKTSMTTANKVDSFAIGETVYYNAKVKADGHYWFRYIHTSGATYYVPYATIAPFRYYGTDSKPGDPVYSQSSTTGGNTGDSSTSRTQGGQDTGVPNFQSNGSASFSIDNDTMLVNGFATLTDNGAWTRNTPLMSAANITHYAKGSKVKYVKKIHADSRIWVVLSNGQYLPIGKLSTPISETQKYQDSSIPSYHSKFSYTIDSNVHQPWASIWPYTANDTNNDDRNNSLLYENPKQELIPTTTEQNELSLVKNQVDAISTSDAVTIGFMTDTHFSSFKTPSTARTLRQMKTMSYYAKNYGLDLMIHGGDLNDGAEEKKYELDDVKRAMDALKLGHRPLLVAQGNHDDNSGFARDFDGYYPRNIITNSEAYPYRFGNFANLLDTKGNTANQATYGKYKIPNSKINVILLDGFDQSDNYSSPITARRDFRHGWTHFSQTQQNWLRSTLNTIPNDELVLVVTHIMLHGVNFHTPNTFAEAKLSGSYAPGVVESGNIRQILVDYNNRTNNLVAVLGGHTHVDDYSSDYGINWIVSTCAVSDRGDGQGSRPIGSVNEQAWDTFVIDPSTRKLHRVRYGWHNNSYFSSSYSF
>NZ_CP031198.1|WP_010619295.1|2543490_2544516_+|IS30-family-transposase
MTRIKNIISNQYHQLNLAERGRIESLRDLDWSIRRIAQALHRNPSTISRELKRGTTTQINASTHIFEQSYLAETGEAIYRKHRLNSCYRGLFDHCQTFCNALVTALKARPRMHSVDTFVHQFKTDHPRLVCPSTPTVYRYIDDQRLAIRNSDLPAKLRRRIKCPGAKHHRINKKNLGHSIEERPAMVQARQELGHWEGDLVKGKRVESEPALMTLTERVSRLEIIVKLPNYHADTCLKALQNTLYDYGTEHFKTITFDNGAEFSSLSQVKGTDIYFAHPYSPWERGTNENTNGLLREFFPKGRSLASASLIDIQLAQDTLNNRLRRSLNYRCPADLMPELA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP031198_1	1.1\|2529895\|33\|NZ_CP031198\|CRISPRCasFinder,CRT	2529895-2529927	33	KY979109	Salmonella phage SHP1, complete genome	32802-32834	8	0.758
NZ_CP031198_1	1.1\|2529895\|33\|NZ_CP031198\|CRISPRCasFinder,CRT	2529895-2529927	33	NC_019500	Enterobacteria phage Bp7, complete genome	22258-22290	8	0.758
NZ_CP031198_1	1.2\|2529956\|33\|NZ_CP031198\|CRISPRCasFinder,CRT,PILER-CR	2529956-2529988	33	MG592538	Vibrio phage 1.171.O._10N.261.52.F12, partial genome	46866-46898	8	0.758

1. spacer 1.1|2529895|33|NZ_CP031198|CRISPRCasFinder,CRT matches to KY979109 (Salmonella phage SHP1, complete genome) position: , mismatch: 8, identity: 0.758

gcttaaaatcaagcagtcgttgggctacgtcaa	CRISPR spacer
tcttaacatcaagcagtcgtttggcattatcac	Protospacer
 ***** ************** ***  ..***

2. spacer 1.1|2529895|33|NZ_CP031198|CRISPRCasFinder,CRT matches to NC_019500 (Enterobacteria phage Bp7, complete genome) position: , mismatch: 8, identity: 0.758

gcttaaaatcaagcagtcgttgggctacgtcaa	CRISPR spacer
tcttaacatcaagcagtcgtttggcattatcac	Protospacer
 ***** ************** ***  ..***

3. spacer 1.2|2529956|33|NZ_CP031198|CRISPRCasFinder,CRT,PILER-CR matches to MG592538 (Vibrio phage 1.171.O._10N.261.52.F12, partial genome) position: , mismatch: 8, identity: 0.758

caactgacacccgttgagccacttcccatgcaa	CRISPR spacer
gccccgacacccgttgagccgctacccatggta	Protospacer
   *.***************.** ******  *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

30561 : 81368

Bacillus_phage(18.75%)

transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075168570.1\|30561_31563_-\|protease	Zn-dependent protease	NA	NA	NA	NA
WP_011666843.1\|32574_33291_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.0e-41	39.6
WP_042520591.1\|33335_35192_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	1.6e-33	32.3
WP_052471652.1\|35178_36480_+	hypothetical protein	NA	NA	NA	NA
WP_021741327.1\|36502_37357_+	hypothetical protein	NA	NA	NA	NA
WP_011666847.1\|37502_38330_+	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	2.7e-33	34.9
WP_015473007.1\|38476_39823_+	PDZ domain-containing protein	W5SAB9	Pithovirus	7.0e-07	26.2
WP_011666849.1\|40359_40839_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_042522191.1\|41151_42075_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.6e-31	31.3
WP_081374847.1\|42147_43992_+	site-specific DNA-methyltransferase	Q1MVP0	Enterobacteria_phage	2.0e-68	33.1
WP_011373852.1\|44652_45573_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2
WP_081374852.1\|45666_47571_+	type III restriction-modification system endonuclease	Q71TG1	Escherichia_phage	5.6e-42	29.0
WP_015473476.1\|47665_48595_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	8.5e-20	29.9
WP_015473476.1\|49848_50778_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	8.5e-20	29.9
WP_042520582.1\|51214_51781_-	hypothetical protein	NA	NA	NA	NA
WP_042520581.1\|51953_52220_+	hypothetical protein	NA	NA	NA	NA
WP_139592506.1\|52470_52674_+	hypothetical protein	NA	NA	NA	NA
WP_042520579.1\|52736_53141_+	hypothetical protein	NA	NA	NA	NA
WP_042520578.1\|53317_53614_+	DUF1643 domain-containing protein	NA	NA	NA	NA
WP_011666851.1\|54266_54491_+	hypothetical protein	NA	NA	NA	NA
WP_110139208.1\|54916_55378_-	hypothetical protein	NA	NA	NA	NA
WP_042520577.1\|55689_56142_+	hypothetical protein	NA	NA	NA	NA
WP_042520576.1\|56275_58159_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_042520575.1\|58310_58742_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_024526011.1\|58926_60054_-	hypothetical protein	NA	NA	NA	NA
WP_042521265.1\|60361_61273_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_042520574.1\|61452_63522_-	BspA family leucine-rich repeat surface protein	NA	NA	NA	NA
WP_039105749.1\|64002_64296_+	hypothetical protein	NA	NA	NA	NA
WP_075168717.1\|64320_65313_+	hypothetical protein	F8WPZ7	Bacillus_phage	4.4e-14	37.4
WP_042520573.1\|65625_66963_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	4.5e-46	30.9
WP_075168715.1\|67021_67645_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_024526005.1\|67659_68499_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_042520572.1\|68660_69023_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_042520571.1\|69097_70591_-	ABC-F type ribosomal protection protein	A0A2I4R674	Erysipelothrix_phage	2.2e-17	24.6
WP_024526002.1\|70845_71448_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_042520570.1\|71564_73040_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_042521263.1\|73182_73791_+	LysE family transporter	NA	NA	NA	NA
WP_042520569.1\|73984_74416_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_024525998.1\|74542_75496_+	alpha/beta hydrolase	A0A167RJ59	Powai_lake_megavirus	4.0e-65	41.9
WP_042520568.1\|75621_76566_+	ADP-ribosylglycohydrolase	A0A1S6UB21	Serratia_phage	5.4e-22	28.7
WP_042520567.1\|76565_77162_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_042520566.1\|77270_77585_-	hypothetical protein	NA	NA	NA	NA
WP_035464723.1\|77624_78197_-	permease cadmium resistance protein	NA	NA	NA	NA
WP_035464720.1\|78285_78717_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_042749717.1\|78759_79272_-	GtrA family protein	NA	NA	NA	NA
WP_011373852.1\|80447_81368_+\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2

DBSCAN-SWA_2

774216 : 782870

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042750031.1\|774216_777072_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.7e-305	54.6
WP_011667427.1\|777227_777773_+	membrane protein	NA	NA	NA	NA
WP_011667428.1\|777918_778803_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	2.1e-07	28.8
WP_015473435.1\|778799_779810_+	YvcK family protein	A1IMD5	Streptococcus_phage	1.3e-93	52.8
WP_042521615.1\|779812_780751_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	7.7e-53	39.4
WP_011667431.1\|780873_781470_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	2.2e-53	52.8
WP_086989537.1\|782094_782870_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

DBSCAN-SWA_3

825335 : 886203

Lactococcus_phage(17.65%)

transposase,integrase

attL 861495:861513|attR 871207:871225

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139592549.1\|825335_826265_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	4.2e-19	30.0
WP_042522235.1\|826501_827239_+	cell surface protein	NA	NA	NA	NA
WP_042522233.1\|827344_828544_+	cell surface protein	NA	NA	NA	NA
WP_042750055.1\|828527_829298_+	cell surface protein	NA	NA	NA	NA
WP_024525586.1\|829310_830204_+	heme ABC transporter substrate-binding protein IsdE	NA	NA	NA	NA
WP_042522227.1\|830200_831169_+	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	2.3e-12	28.6
WP_042522224.1\|831149_831908_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	3.9e-15	29.8
WP_021741399.1\|831978_832914_-	exopolyphosphatase	NA	NA	NA	NA
WP_042750060.1\|832915_835075_-	RNA degradosome polyphosphate kinase	NA	NA	NA	NA
WP_042522220.1\|835071_836610_-	HD domain-containing protein	NA	NA	NA	NA
WP_042522219.1\|836631_837453_-	LicD family protein	A0A1V0SD50	Indivirus	1.9e-07	33.6
WP_042750062.1\|837472_838045_-	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_011667482.1\|838178_838622_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011667484.1\|838911_839361_-	OsmC family protein	NA	NA	NA	NA
WP_139592550.1\|839728_839908_+	hypothetical protein	NA	NA	NA	NA
WP_042750064.1\|841856_842228_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_035464358.1\|842451_842946_+	alcohol dehydrogenase	A0A060QSU6	Streptococcus_phage	2.3e-08	53.7
WP_042522298.1\|843080_844466_+	class II fumarate hydratase	NA	NA	NA	NA
WP_042522296.1\|844575_845058_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_042522294.1\|845050_845968_+	hypothetical protein	NA	NA	NA	NA
WP_081374834.1\|846143_847499_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_139592552.1\|847715_848735_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_042750071.1\|848966_849713_+	hypothetical protein	NA	NA	NA	NA
WP_042522289.1\|849766_850762_+	DMT family transporter	NA	NA	NA	NA
WP_087051840.1\|850775_851825_+	linear amide C-N hydrolase	M1HS66	Paramecium_bursaria_Chlorella_virus	5.6e-28	27.1
WP_042750072.1\|851935_853168_-	arginine deiminase	NA	NA	NA	NA
WP_087053436.1\|853278_853404_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_139592554.1\|853430_854360_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-20	30.2
WP_042522283.1\|854455_855094_-	hypothetical protein	NA	NA	NA	NA
WP_042750078.1\|855095_855365_-	hypothetical protein	NA	NA	NA	NA
WP_042522279.1\|855583_856120_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_042522277.1\|856209_857322_+	NAD(P)-dependent alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.4e-21	25.8
WP_052471707.1\|857533_857815_-	hypothetical protein	NA	NA	NA	NA
WP_042749622.1\|857976_859197_+\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	1.9e-104	49.4
WP_031263932.1\|859206_859944_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.5e-59	50.4
WP_042522306.1\|860519_860918_-	HicB family protein	NA	NA	NA	NA
861495:861513	attL	NA	NA	NA	NA
WP_042750084.1\|861527_862682_-\|integrase	site-specific integrase	S6C485	Thermus_phage	4.3e-53	36.0
WP_087051845.1\|862749_863481_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042750085.1\|863619_863805_+	hypothetical protein	NA	NA	NA	NA
WP_042750086.1\|863815_864484_+	hypothetical protein	Q9AZH8	Lactococcus_phage	8.3e-17	38.9
WP_042750087.1\|864500_864785_+	hypothetical protein	NA	NA	NA	NA
WP_139592556.1\|865094_865325_+	hypothetical protein	NA	NA	NA	NA
WP_042750088.1\|865324_865549_+	hypothetical protein	NA	NA	NA	NA
WP_042750089.1\|865561_866332_+	prophage P3 protein 7, DNA replication	A0A060ADS5	Enterococcus_phage	9.5e-17	32.3
WP_087051847.1\|866344_867745_+	virulence protein	Q4ZD27	Staphylococcus_phage	2.4e-74	37.3
WP_042750090.1\|867986_868361_+	hypothetical protein	NA	NA	NA	NA
WP_042750091.1\|868367_868781_+	hypothetical protein	NA	NA	NA	NA
WP_139592558.1\|871991_872726_+	response regulator	W8CYM9	Bacillus_phage	7.4e-35	36.4
871207:871225	attR	NA	NA	NA	NA
WP_042522276.1\|872722_874192_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.4e-21	30.8
WP_042522274.1\|874250_875399_+	class I SAM-dependent rRNA methyltransferase	NA	NA	NA	NA
WP_015473496.1\|875581_876448_+	sugar uptake protein	NA	NA	NA	NA
WP_011667989.1\|876577_877924_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_042522271.1\|878211_881229_+	YfhO family protein	NA	NA	NA	NA
WP_139592561.1\|881473_882649_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_024525554.1\|882955_883438_-	tryptophan-rich sensory protein	NA	NA	NA	NA
WP_011667986.1\|883615_884179_+	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_011373852.1\|885282_886203_+\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2

DBSCAN-SWA_4

984797 : 1042802

unidentified_phage(25.0%)

transposase,integrase,protease

attL 1019477:1019492|attR 1043901:1043916

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087094274.1\|984797_985727_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	3.8e-20	29.9
WP_139592575.1\|985753_985861_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_042750143.1\|985863_986970_+\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
WP_042522326.1\|987353_987650_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042522328.1\|987808_989176_+	MFS transporter	NA	NA	NA	NA
WP_011667943.1\|989950_990832_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_011667942.1\|991001_991406_+	DUF948 domain-containing protein	NA	NA	NA	NA
WP_011667941.1\|991427_991790_+	hypothetical protein	NA	NA	NA	NA
WP_011667940.1\|991874_992972_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_024525483.1\|993166_994168_+	catabolite control protein A	NA	NA	NA	NA
WP_087051836.1\|994219_995491_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-46	31.9
WP_139592577.1\|995747_996590_+	hypothetical protein	NA	NA	NA	NA
WP_042750147.1\|996646_997387_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-30	37.4
WP_042522334.1\|997379_998858_-	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_011667935.1\|999136_999874_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_052471711.1\|999979_1000945_+	Flp pilus assembly complex ATPase component	NA	NA	NA	NA
WP_042522335.1\|1000952_1001933_+	type II secretion pathway/competence component	NA	NA	NA	NA
WP_042522337.1\|1001925_1002237_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_081374819.1\|1002208_1002673_+	type II secretion system protein	NA	NA	NA	NA
WP_042522340.1\|1002644_1002857_+	hypothetical protein	NA	NA	NA	NA
WP_042522342.1\|1002853_1003276_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_035465791.1\|1003565_1004588_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011667926.1\|1004604_1005795_+	acetate kinase	NA	NA	NA	NA
WP_042522345.1\|1006000_1007404_+	amino acid permease	NA	NA	NA	NA
WP_042522347.1\|1007526_1008375_+	aldo/keto reductase	NA	NA	NA	NA
WP_011667923.1\|1008389_1008998_+	metallophosphatase	A0A076G7D9	Bacillus_phage	1.1e-28	38.5
WP_042522349.1\|1009057_1010443_+	5'-nucleotidase	NA	NA	NA	NA
WP_042750156.1\|1010454_1011126_+	YutD family protein	NA	NA	NA	NA
WP_042522350.1\|1011138_1011933_+	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_011667919.1\|1011925_1012555_+	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_107696547.1\|1013144_1013795_+	WxL domain-containing protein	NA	NA	NA	NA
WP_075168695.1\|1014034_1016266_+	hypothetical protein	NA	NA	NA	NA
WP_042522352.1\|1016598_1018452_+	membrane protein	NA	NA	NA	NA
WP_024525463.1\|1018644_1020051_+	amino acid permease	NA	NA	NA	NA
1019477:1019492	attL	NA	NA	NA	NA
WP_139592578.1\|1020290_1021085_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_039105195.1\|1021102_1021942_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	3.6e-70	48.2
WP_139592580.1\|1022064_1022643_-	hypothetical protein	NA	NA	NA	NA
WP_134787804.1\|1022660_1023448_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_042750166.1\|1023489_1023783_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_052471712.1\|1023855_1024209_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_011667913.1\|1024289_1024955_-	membrane protein	NA	NA	NA	NA
WP_011667912.1\|1025054_1025564_-	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	4.2e-37	49.4
WP_024525458.1\|1025685_1026279_+	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	5.1e-26	41.9
WP_011667910.1\|1026312_1026702_+	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_042521201.1\|1033800_1035003_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_011667908.1\|1035109_1035613_-	monooxygenase	NA	NA	NA	NA
WP_042521204.1\|1035736_1036477_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_011667906.1\|1036680_1037088_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_042521206.1\|1037235_1037961_+	adaptor protein MecA	NA	NA	NA	NA
WP_042521207.1\|1038197_1039661_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011667902.1\|1039869_1040619_-	hypothetical protein	NA	NA	NA	NA
WP_075168790.1\|1040678_1041563_-	hypothetical protein	NA	NA	NA	NA
WP_042750175.1\|1041621_1041846_-	hypothetical protein	NA	NA	NA	NA
WP_015473476.1\|1041872_1042802_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	8.5e-20	29.9
1043901:1043916	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1214874 : 1261304

Streptococcus_phage(15.38%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035465686.1\|1214874_1215621_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_021741158.1\|1215607_1215877_+	GIY-YIG nuclease family protein	A0A0C5AS36	Spodoptera_frugiperda_granulovirus	8.5e-05	37.1
WP_139592561.1\|1215953_1217129_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_042521474.1\|1217320_1218319_+	D-2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	2.6e-46	35.8
WP_024525163.1\|1218439_1219159_-	HAD family hydrolase	NA	NA	NA	NA
WP_042521476.1\|1219396_1220200_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_139592599.1\|1220349_1221234_+	elongation factor Ts	NA	NA	NA	NA
WP_011668022.1\|1221380_1222103_+	UMP kinase	NA	NA	NA	NA
WP_021741162.1\|1222105_1222663_+	ribosome recycling factor	NA	NA	NA	NA
WP_011668021.1\|1222689_1223112_+	hypothetical protein	NA	NA	NA	NA
WP_075168498.1\|1223214_1224003_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	7.7e-22	41.0
WP_021741164.1\|1224024_1224816_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_024525166.1\|1224911_1226189_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_039104488.1\|1226224_1227934_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_139592601.1\|1228026_1232364_+	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	1.0e-19	37.6
WP_011668015.1\|1232564_1232840_+	hypothetical protein	NA	NA	NA	NA
WP_011668014.1\|1232966_1233440_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_042521478.1\|1233463_1234669_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_042521480.1\|1234695_1234992_+	YlxR family protein	NA	NA	NA	NA
WP_011668011.1\|1234984_1235287_+	hypothetical protein	NA	NA	NA	NA
WP_139592603.1\|1235334_1237677_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	6.7e-21	23.5
WP_011668009.1\|1237696_1238047_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_042521483.1\|1238127_1239039_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_042750279.1\|1239059_1240007_+	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
WP_011668006.1\|1240258_1241296_+	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_021741174.1\|1241316_1241901_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_011668004.1\|1241940_1243800_+	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	2.8e-131	46.2
WP_021741175.1\|1243917_1245066_+	molecular chaperone DnaJ	M1PC06	Moumouvirus	1.9e-16	28.3
WP_086989537.1\|1245311_1246087_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_011668002.1\|1246222_1246372_+	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_021741176.1\|1246411_1247938_+	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	7.4e-37	27.7
WP_011668000.1\|1247937_1249146_+	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	1.1e-22	27.8
WP_011667999.1\|1249183_1249417_+	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_021741177.1\|1249420_1250710_+	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_075168856.1\|1250890_1252723_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	8.6e-24	27.5
WP_139592562.1\|1252820_1254092_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	6.6e-47	32.1
WP_075168866.1\|1254074_1254356_+	hypothetical protein	NA	NA	NA	NA
WP_139592561.1\|1254816_1255992_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_080662450.1\|1256569_1256671_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_021741179.1\|1257197_1257407_+	DUF3923 family protein	NA	NA	NA	NA
WP_011667492.1\|1257449_1257809_-	hypothetical protein	NA	NA	NA	NA
WP_042521427.1\|1258418_1259600_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_042749622.1\|1260083_1261304_+\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	1.9e-104	49.4

DBSCAN-SWA_6

1324235 : 1369335

Bacillus_virus(17.65%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011667553.1\|1324235_1324511_+	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	3.1e-26	68.5
WP_087128287.1\|1324616_1325876_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011667555.1\|1325994_1326933_-	YitT family protein	M1Q1P6	Streptococcus_phage	2.2e-52	38.8
WP_042521398.1\|1327066_1328260_+\|tRNA	CCA tRNA nucleotidyltransferase	G3MAR3	Bacillus_virus	4.1e-35	39.7
WP_075168534.1\|1328288_1330181_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	3.6e-49	29.5
WP_042520532.1\|1330192_1331143_+	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	7.7e-117	61.8
WP_042750344.1\|1331159_1331651_+	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	1.6e-22	36.5
WP_011667560.1\|1331830_1332472_-	hemolysin III family protein	NA	NA	NA	NA
WP_075168535.1\|1332640_1333492_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	7.6e-15	33.6
WP_075168536.1\|1333557_1334478_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_011667563.1\|1334490_1335090_+	YpmS family protein	NA	NA	NA	NA
WP_042521511.1\|1335100_1335322_+	YozE family protein	NA	NA	NA	NA
WP_042750353.1\|1335420_1336116_+	hypothetical protein	NA	NA	NA	NA
WP_042750355.1\|1336217_1336421_-	hypothetical protein	NA	NA	NA	NA
WP_042520529.1\|1336417_1336885_-	hypothetical protein	NA	NA	NA	NA
WP_075168537.1\|1337656_1338148_+	CinA family protein	NA	NA	NA	NA
WP_139592617.1\|1338317_1338989_+	hypothetical protein	NA	NA	NA	NA
WP_011373852.1\|1338985_1339906_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2
WP_139592620.1\|1340020_1340458_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_075168539.1\|1340390_1340582_-	hypothetical protein	NA	NA	NA	NA
WP_139592561.1\|1340587_1341763_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_042520527.1\|1341855_1342680_+	NAD(+) diphosphatase	NA	NA	NA	NA
WP_139592622.1\|1342931_1343162_-	hypothetical protein	NA	NA	NA	NA
WP_042520526.1\|1343959_1344820_+	DUF1837 domain-containing protein	NA	NA	NA	NA
WP_042520525.1\|1344806_1347803_+	DEAD/DEAH box helicase	F2Y0S4	Organic_Lake_phycodnavirus	2.9e-08	22.4
WP_042520524.1\|1350052_1350913_+	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_075168843.1\|1350905_1351679_+	ribonuclease HII	G4YAY0	Emiliania_huxleyi_virus	6.2e-24	40.1
WP_087051836.1\|1351793_1353065_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-46	31.9
WP_075168817.1\|1353173_1354055_+	DNA-protecting protein DprA	NA	NA	NA	NA
WP_075168818.1\|1354189_1356301_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	1.8e-97	35.5
WP_075168815.1\|1356465_1357401_+	tyrosine recombinase XerC	A0A0K0MWE8	Gordonia_phage	4.0e-17	29.6
WP_042750372.1\|1357404_1357947_+	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
WP_139592624.1\|1357964_1359377_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A1B2IDZ7	Erwinia_phage	1.1e-31	27.3
WP_042520523.1\|1359474_1360347_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_024525222.1\|1360400_1361024_-	glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_011667578.1\|1361284_1363252_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	3.7e-121	42.5
WP_021742531.1\|1363274_1365722_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	2.1e-94	30.5
WP_042520520.1\|1365856_1366822_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_042750382.1\|1366850_1367780_+	manganese-dependent inorganic pyrophosphatase	NA	NA	NA	NA
WP_042520519.1\|1367927_1368518_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_086989537.1\|1368560_1369335_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

DBSCAN-SWA_7

1513481 : 1569300

Megavirus(14.29%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024525337.1\|1513481_1514426_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.6e-10	32.2
WP_011667690.1\|1514448_1516866_-	primosomal protein N'	NA	NA	NA	NA
WP_075168721.1\|1516877_1518089_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	6.9e-38	33.7
WP_011667692.1\|1518184_1518400_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_015473640.1\|1518403_1519018_-	guanylate kinase	K4JYM5	Abalone_herpesvirus	1.3e-21	32.8
WP_024525340.1\|1519284_1519608_+	hypothetical protein	NA	NA	NA	NA
WP_024525341.1\|1519657_1520122_-	hypothetical protein	NA	NA	NA	NA
WP_042520415.1\|1520241_1522188_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_042520413.1\|1522428_1524129_-	DNA repair protein RecN	NA	NA	NA	NA
WP_011667696.1\|1524205_1524661_-	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_042520412.1\|1524753_1525569_-	TlyA family RNA methyltransferase	NA	NA	NA	NA
WP_081374830.1\|1525569_1526472_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_011667699.1\|1526461_1526707_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_042520408.1\|1526699_1528055_-	exodeoxyribonuclease VII large subunit	L7Y4U7	Megavirus	2.3e-26	31.1
WP_042520407.1\|1528041_1528908_-	bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/5,10-methylene-tetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	5.1e-27	36.2
WP_011667702.1\|1529056_1529485_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_011667703.1\|1529484_1529925_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_021741213.1\|1529959_1530520_-	elongation factor P	NA	NA	NA	NA
WP_043021929.1\|1530596_1531661_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_011667706.1\|1531757_1532057_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_011667707.1\|1532076_1532415_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_011667708.1\|1532443_1532752_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_042520405.1\|1532915_1533443_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_021741209.1\|1533581_1534124_-	dUTP diphosphatase	NA	NA	NA	NA
WP_011667711.1\|1534138_1535080_-	hypothetical protein	NA	NA	NA	NA
WP_042520404.1\|1535072_1535945_-	hypothetical protein	NA	NA	NA	NA
WP_021741207.1\|1537643_1538984_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_011667714.1\|1539025_1539412_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_042520402.1\|1539518_1540442_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_024525349.1\|1540438_1541194_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	5.5e-17	38.3
WP_011667717.1\|1541339_1541516_+	DUF3042 family protein	NA	NA	NA	NA
WP_011667718.1\|1541561_1541978_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_021741203.1\|1542008_1542980_-	ROK family glucokinase	NA	NA	NA	NA
WP_011667720.1\|1542984_1543215_-	YqgQ family protein	NA	NA	NA	NA
WP_035464259.1\|1543257_1543938_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_042520399.1\|1543953_1544502_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_011667723.1\|1544565_1544715_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_042520396.1\|1544902_1547017_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_139592639.1\|1547381_1548557_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_015473476.1\|1548637_1549567_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	8.5e-20	29.9
WP_042750478.1\|1549690_1549900_-	DUF378 domain-containing protein	NA	NA	NA	NA
WP_042521258.1\|1550202_1552839_+	YfhO family protein	NA	NA	NA	NA
WP_011667727.1\|1552890_1553199_-	iron-sulfur cluster biosynthesis protein	NA	NA	NA	NA
WP_024525354.1\|1553512_1553986_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_015473615.1\|1554095_1554770_-	uridine kinase	A0A1V0SAA3	Catovirus	3.6e-36	39.2
WP_039104799.1\|1554782_1555919_-	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_039104801.1\|1556075_1558484_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_024525357.1\|1558493_1559540_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	5.8e-25	36.3
WP_024525358.1\|1559873_1560248_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011667735.1\|1560282_1560780_-	HD domain-containing protein	NA	NA	NA	NA
WP_039104807.1\|1560904_1561675_-	RNA methyltransferase	NA	NA	NA	NA
WP_024525359.1\|1561781_1562054_+	acylphosphatase	NA	NA	NA	NA
WP_021741718.1\|1562156_1563059_+	membrane protein insertase YidC	NA	NA	NA	NA
WP_021741717.1\|1563207_1563612_-	YxeA family protein	NA	NA	NA	NA
WP_021741716.1\|1563760_1565371_-	HAMP domain-containing histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	2.1e-10	28.3
WP_011667741.1\|1565367_1566054_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.7e-29	30.6
WP_139592640.1\|1566313_1567234_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	5.4e-51	38.2
WP_011667742.1\|1567506_1568523_+	alcohol dehydrogenase AdhP	A0A2P1EIJ9	Megavirus	1.0e-21	25.2
WP_042521256.1\|1568646_1569300_-\|protease	matrixin family metalloprotease	A0A097DAI6	Erinnyis_ello_granulovirus	5.4e-05	46.2

DBSCAN-SWA_8

1578515 : 1642357

Staphylococcus_prophage(13.33%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011373852.1\|1578515_1579436_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2
WP_139592641.1\|1579500_1580052_-	hypothetical protein	NA	NA	NA	NA
WP_075168480.1\|1580414_1581686_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_011667796.1\|1581837_1582197_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_021741703.1\|1582267_1582462_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_075168707.1\|1582511_1583036_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	6.1e-15	33.3
WP_021741702.1\|1583275_1585219_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	4.7e-97	33.2
WP_042521222.1\|1585553_1586480_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	2.7e-26	37.3
WP_075168705.1\|1586483_1587854_-	replication initiation/membrane attachment protein	NA	NA	NA	NA
WP_011667802.1\|1587857_1588358_-	transcriptional repressor NrdR	NA	NA	NA	NA
WP_042521224.1\|1588357_1588987_-	dephospho-CoA kinase	NA	NA	NA	NA
WP_042521225.1\|1588979_1589840_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	F8WPX6	Bacillus_phage	2.8e-25	29.6
WP_042750490.1\|1589862_1592523_-	DNA polymerase I	A0A142F1Q9	Bacillus_phage	1.2e-61	31.8
WP_039104832.1\|1592837_1594184_+	guanine deaminase	NA	NA	NA	NA
WP_042521230.1\|1596114_1596819_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_042521232.1\|1597872_1599204_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_139592644.1\|1599337_1601911_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	1.6e-87	50.1
WP_021742344.1\|1602120_1602759_-\|tRNA	DUF4479 and tRNA-binding domain-containing protein	NA	NA	NA	NA
WP_011667813.1\|1602782_1603115_-	thioredoxin family protein	NA	NA	NA	NA
WP_011667814.1\|1603293_1603620_+	hypothetical protein	NA	NA	NA	NA
WP_042521235.1\|1603726_1605085_-	amino acid permease	NA	NA	NA	NA
WP_042521237.1\|1605119_1606229_-	alanine dehydrogenase	NA	NA	NA	NA
WP_011667817.1\|1606440_1606947_-	universal stress protein	NA	NA	NA	NA
WP_042521238.1\|1606984_1608385_-	dipeptidase PepV	NA	NA	NA	NA
WP_024525378.1\|1608526_1609360_+	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_011667821.1\|1610107_1611742_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_011667822.1\|1611963_1612284_+	hypothetical protein	NA	NA	NA	NA
WP_042521240.1\|1612389_1613154_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_042521242.1\|1613218_1613893_-	AAA family ATPase	NA	NA	NA	NA
WP_021741725.1\|1613906_1614662_-	hypothetical protein	NA	NA	NA	NA
WP_042521246.1\|1614912_1617342_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	68.6
WP_015473582.1\|1617782_1618424_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_024525384.1\|1618420_1618987_+	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	6.1e-37	46.0
WP_042521249.1\|1620647_1621157_-	hypothetical protein	NA	NA	NA	NA
WP_042521250.1\|1621158_1621965_-	EAL domain-containing protein	NA	NA	NA	NA
WP_139592646.1\|1622084_1622267_-	hypothetical protein	NA	NA	NA	NA
WP_087051836.1\|1622249_1623521_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-46	31.9
WP_042521251.1\|1624124_1624502_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004561985.1\|1624848_1625838_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5
WP_042750495.1\|1625925_1626303_-	hypothetical protein	NA	NA	NA	NA
WP_042522181.1\|1626484_1628995_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.3e-139	32.5
WP_075168782.1\|1629368_1629662_-	heavy metal-binding domain-containing protein	NA	NA	NA	NA
WP_015473929.1\|1629652_1630171_-	VanZ family protein	NA	NA	NA	NA
WP_015473930.1\|1630726_1631203_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_111705396.1\|1631255_1631984_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_035464831.1\|1632244_1632490_-	hypothetical protein	NA	NA	NA	NA
WP_021742214.1\|1632639_1633602_+	NAD(P)-binding domain-containing protein	A0A1B1IVB5	uncultured_Mediterranean_phage	5.3e-25	28.7
WP_042750498.1\|1633821_1636536_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_021742217.1\|1636548_1637220_+	beta-phosphoglucomutase	NA	NA	NA	NA
WP_139592649.1\|1637273_1638044_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011668241.1\|1638197_1638845_+	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	9.1e-45	45.9
WP_011668242.1\|1638893_1639220_-	DUF960 domain-containing protein	NA	NA	NA	NA
WP_042522189.1\|1639293_1640769_-	MFS transporter	NA	NA	NA	NA
WP_087051836.1\|1641085_1642357_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-46	31.9

DBSCAN-SWA_9

1646383 : 1712094

Lactobacillus_phage(83.33%)

plate,integrase,terminase,transposase,tail,protease

attL 1660702:1660718|attR 1709080:1709096

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042522191.1\|1646383_1647307_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.6e-31	31.3
WP_042522193.1\|1647583_1648153_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_042522195.1\|1648406_1648874_+	universal stress protein	NA	NA	NA	NA
WP_042750503.1\|1649892_1650255_+	hypothetical protein	NA	NA	NA	NA
WP_042750506.1\|1650244_1650547_+	hypothetical protein	NA	NA	NA	NA
WP_042750507.1\|1650887_1653056_-	S8 family peptidase	NA	NA	NA	NA
WP_139592651.1\|1653045_1654143_-	AAA family ATPase	A0A125SJ49	Acidianus_tailed_spindle_virus	5.3e-13	35.7
WP_139592652.1\|1655850_1656288_-	hypothetical protein	D6PST6	Lactobacillus_phage	4.6e-16	76.9
WP_139592654.1\|1656292_1656838_-	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	2.0e-32	52.0
WP_042749412.1\|1657417_1657603_-	hypothetical protein	NA	NA	NA	NA
WP_139592656.1\|1657602_1657851_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042749415.1\|1658007_1658379_+	helix-turn-helix transcriptional regulator	Q6SEA1	Lactobacillus_prophage	2.7e-09	53.3
WP_042749416.1\|1658390_1658804_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_139592658.1\|1658900_1659710_+	hypothetical protein	NA	NA	NA	NA
WP_042749419.1\|1660439_1660658_+	hypothetical protein	NA	NA	NA	NA
1660702:1660718	attL	NA	NA	NA	NA
WP_042749420.1\|1660874_1661870_+	AAA family ATPase	E9LUK9	Lactobacillus_phage	1.9e-70	48.1
WP_139592660.1\|1661882_1662317_+	hypothetical protein	NA	NA	NA	NA
WP_139592662.1\|1662309_1663005_+	hypothetical protein	NA	NA	NA	NA
WP_139592664.1\|1663098_1664298_+\|integrase	tyrosine-type recombinase/integrase	D6PSS4	Lactobacillus_phage	1.4e-139	63.1
WP_042750503.1\|1664983_1665346_+	hypothetical protein	NA	NA	NA	NA
WP_042750506.1\|1665335_1665638_+	hypothetical protein	NA	NA	NA	NA
WP_042750507.1\|1665978_1668147_-	S8 family peptidase	NA	NA	NA	NA
WP_139592666.1\|1668152_1669235_-	ATP-binding protein	A0A125SJ49	Acidianus_tailed_spindle_virus	5.3e-13	35.7
WP_042750510.1\|1669627_1670680_-	lysozyme M1 (1,4-beta-N-acetylmuramidase)	D6PSS2	Lactobacillus_phage	1.2e-171	94.1
WP_011667835.1\|1670679_1671198_-	hypothetical protein	D6PSS1	Lactobacillus_phage	1.5e-79	91.9
WP_011667836.1\|1671190_1671493_-	hypothetical protein	NA	NA	NA	NA
WP_011667837.1\|1671489_1671876_-	hypothetical protein	NA	NA	NA	NA
WP_042750512.1\|1672262_1672712_-	hypothetical protein	NA	NA	NA	NA
WP_042750514.1\|1672749_1673328_-	hypothetical protein	NA	NA	NA	NA
WP_042750517.1\|1674952_1675543_-	hypothetical protein	D6PT00	Lactobacillus_phage	1.1e-76	84.9
WP_042750518.1\|1675532_1676711_-\|plate	baseplate J/gp47 family protein	D6PSZ9	Lactobacillus_phage	7.1e-181	81.6
WP_139592668.1\|1676691_1677096_-	DUF2634 domain-containing protein	D6PSZ8	Lactobacillus_phage	2.9e-49	78.6
WP_139592670.1\|1677095_1677278_-	hypothetical protein	D6PSZ7	Lactobacillus_phage	1.3e-25	100.0
WP_139592672.1\|1677439_1678681_-	hypothetical protein	D6PSZ6	Lactobacillus_phage	4.7e-183	82.3
WP_139592674.1\|1678670_1679069_-	hypothetical protein	D6PSZ5	Lactobacillus_phage	1.8e-67	97.7
WP_139592675.1\|1679074_1679722_-	LysM peptidoglycan-binding domain-containing protein	D6PSZ4	Lactobacillus_phage	3.7e-107	91.2
WP_139592676.1\|1679721_1684269_-\|tail	phage tail tape measure protein	D6PSZ2	Lactobacillus_phage	1.8e-118	90.8
WP_052493597.1\|1684502_1685456_-	hypothetical protein	A0A2R3ZXM6	Staphylococcus_phage	1.7e-39	31.1
WP_042750522.1\|1685515_1686736_-\|tail	phage tail tape measure protein	D6PSY9	Lactobacillus_phage	1.7e-60	98.5
WP_042750523.1\|1686931_1687306_-	hypothetical protein	D6PSY5	Lactobacillus_phage	6.4e-67	98.4
WP_042750524.1\|1687376_1687775_-	hypothetical protein	D6PSY4	Lactobacillus_phage	1.2e-71	98.5
WP_042750525.1\|1687789_1688827_-	DUF3383 family protein	D6PSY3	Lactobacillus_phage	1.9e-140	94.7
WP_042750526.1\|1688839_1689310_-	hypothetical protein	D6PSY2	Lactobacillus_phage	6.6e-61	97.5
WP_139592677.1\|1689302_1689680_-	hypothetical protein	D6PSY1	Lactobacillus_phage	6.4e-67	99.2
WP_139592678.1\|1689676_1690279_-	hypothetical protein	D6PSY0	Lactobacillus_phage	5.4e-108	98.5
WP_139592679.1\|1690275_1690602_-	DUF4054 domain-containing protein	D6PSX9	Lactobacillus_phage	4.3e-51	93.5
WP_042750529.1\|1690613_1690976_-	hypothetical protein	D6PSX8	Lactobacillus_phage	2.3e-58	98.3
WP_042750531.1\|1690986_1691865_-	DUF2184 domain-containing protein	D6PSX7	Lactobacillus_phage	8.0e-161	99.0
WP_042750533.1\|1691879_1692344_-	hypothetical protein	D6PSX6	Lactobacillus_phage	9.9e-78	99.4
WP_042750536.1\|1692358_1693462_-	DUF2213 domain-containing protein	D6PSX5	Lactobacillus_phage	3.2e-159	90.5
WP_139592680.1\|1693473_1693899_-	LysM peptidoglycan-binding domain-containing protein	D6PSX4	Lactobacillus_phage	9.2e-22	96.3
WP_042750935.1\|1693765_1694593_-	hypothetical protein	D6PSX3	Lactobacillus_phage	3.4e-129	95.5
WP_139592681.1\|1694595_1695957_-	DUF1073 domain-containing protein	D6PSX2	Lactobacillus_phage	4.0e-260	98.5
WP_139592721.1\|1695973_1697317_-\|terminase	PBSX family phage terminase large subunit	D6PSX1	Lactobacillus_phage	7.9e-168	99.6
WP_042750542.1\|1697294_1698047_-	hypothetical protein	D6PSW8	Lactobacillus_phage	2.9e-111	91.7
WP_061777551.1\|1698429_1698813_-	antitoxin HicB	D6PSW2	Lactobacillus_phage	5.8e-23	100.0
WP_042750942.1\|1698929_1699127_-	type II toxin-antitoxin system HicA family toxin	D6PSW1	Lactobacillus_phage	2.8e-29	100.0
WP_042750545.1\|1699526_1699796_+	DUF3892 domain-containing protein	A0A059NT53	Lactococcus_phage	3.6e-11	61.0
WP_139592682.1\|1699995_1700163_-	BC1881 family protein	NA	NA	NA	NA
WP_042749401.1\|1700668_1701148_-	hypothetical protein	NA	NA	NA	NA
WP_042749402.1\|1701421_1701685_-	hypothetical protein	NA	NA	NA	NA
WP_042749404.1\|1701672_1702092_-	RusA family crossover junction endodeoxyribonuclease	D6PSU4	Lactobacillus_phage	1.2e-42	60.4
WP_139592683.1\|1702084_1702795_-	toxin Bro	U5U413	Lactobacillus_phage	2.8e-31	43.7
WP_139592684.1\|1702806_1703595_-	DnaD domain protein	NA	NA	NA	NA
WP_139592685.1\|1703606_1704470_-	hypothetical protein	A0A0P0IZH9	Lactobacillus_phage	9.2e-77	52.6
WP_042749406.1\|1704396_1705458_-	hypothetical protein	D7RWF9	Brochothrix_phage	4.5e-57	50.4
WP_042749407.1\|1705458_1705674_-	hypothetical protein	NA	NA	NA	NA
WP_042749409.1\|1705664_1705958_-	hypothetical protein	D6PST8	Lactobacillus_phage	2.4e-21	54.7
WP_042749410.1\|1706231_1706507_-	hypothetical protein	D6PST5	Lactobacillus_phage	9.8e-25	59.8
WP_139592686.1\|1706511_1707021_-	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	3.7e-41	53.8
WP_139592687.1\|1707400_1707649_+	hypothetical protein	NA	NA	NA	NA
WP_042749412.1\|1707637_1707823_-	hypothetical protein	NA	NA	NA	NA
WP_139592656.1\|1707822_1708071_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042749415.1\|1708227_1708599_+	helix-turn-helix transcriptional regulator	Q6SEA1	Lactobacillus_prophage	2.7e-09	53.3
WP_042749416.1\|1708610_1709024_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_042749417.1\|1709120_1709954_+	hypothetical protein	NA	NA	NA	NA
1709080:1709096	attR	NA	NA	NA	NA
WP_042749418.1\|1710258_1710480_+	hypothetical protein	NA	NA	NA	NA
WP_042749419.1\|1710663_1710882_+	hypothetical protein	NA	NA	NA	NA
WP_042749420.1\|1711098_1712094_+	AAA family ATPase	E9LUK9	Lactobacillus_phage	1.9e-70	48.1

DBSCAN-SWA_10

2003695 : 2062608

Staphylococcus_phage(21.43%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021741535.1\|2003695_2004739_-\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
WP_042521035.1\|2004907_2005864_+	nucleoside hydrolase	NA	NA	NA	NA
WP_011668433.1\|2006004_2006352_+	hypothetical protein	NA	NA	NA	NA
WP_042521033.1\|2006392_2007055_-	hypothetical protein	NA	NA	NA	NA
WP_042521031.1\|2007126_2007942_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_042521028.1\|2008827_2010105_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_081374805.1\|2010188_2011025_-	HAD-IIB family hydrolase	NA	NA	NA	NA
WP_087128738.1\|2011156_2011945_+	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_042521024.1\|2011941_2012271_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_042521022.1\|2012994_2014173_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.1e-15	28.6
WP_080769698.1\|2014394_2015366_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_011668443.1\|2015696_2016260_+	ECF transporter S component	NA	NA	NA	NA
WP_042521021.1\|2016284_2017694_+	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	7.1e-10	27.8
WP_011668445.1\|2017690_2018344_+	cobalt ABC transporter permease	NA	NA	NA	NA
WP_042521020.1\|2018368_2019022_+	thiaminase II	NA	NA	NA	NA
WP_011668448.1\|2020168_2020360_+	hypothetical protein	NA	NA	NA	NA
WP_024526468.1\|2020440_2020680_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_011668449.1\|2020695_2021040_-	hypothetical protein	NA	NA	NA	NA
WP_035464402.1\|2021094_2022258_-	hypothetical protein	NA	NA	NA	NA
WP_039106557.1\|2022339_2023314_-	asparaginase	NA	NA	NA	NA
WP_086989952.1\|2023912_2025214_+	purine permease	Q9KX94	Enterobacteria_phage	3.8e-34	30.2
WP_042521018.1\|2025331_2026225_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.9e-19	26.7
WP_042521017.1\|2026221_2027442_+	ABC transporter permease	NA	NA	NA	NA
WP_021741513.1\|2027902_2029252_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_039106002.1\|2029354_2030221_-	DegV family protein	NA	NA	NA	NA
WP_024526463.1\|2030437_2031244_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.6e-59	42.5
WP_024526462.1\|2031415_2031784_+	YbgA family protein	NA	NA	NA	NA
WP_024526461.1\|2031795_2032158_+	hypothetical protein	NA	NA	NA	NA
WP_081374806.1\|2032246_2033653_+	glutamate decarboxylase	NA	NA	NA	NA
WP_080504815.1\|2033743_2034448_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_042521014.1\|2034635_2035916_+	nickel-dependent lactate racemase	NA	NA	NA	NA
WP_024526458.1\|2035918_2036680_+	nickel pincer cofactor biosynthesis protein LarB	A0A288TYA6	Enterococcus_phage	1.4e-23	41.8
WP_042521012.1\|2036676_2037909_+	nickel pincer cofactor biosynthesis protein LarC	NA	NA	NA	NA
WP_021742928.1\|2037915_2038752_+	ATP-dependent sacrificial sulfur transferase LarE	NA	NA	NA	NA
WP_015639560.1\|2038759_2039482_+	aquaporin family protein	NA	NA	NA	NA
WP_042521009.1\|2039568_2040552_+	HoxN/HupN/NixA family nickel/cobalt transporter	NA	NA	NA	NA
WP_042521007.1\|2041000_2041420_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_024526449.1\|2041963_2042146_-	hypothetical protein	NA	NA	NA	NA
WP_010619295.1\|2042364_2043390_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-40	35.2
WP_139592693.1\|2043498_2044497_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.3e-58	40.5
WP_042521005.1\|2044847_2045960_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	5.6e-34	38.8
WP_024526447.1\|2045922_2046762_+	ABC transporter permease	Q6GZ02	Mycoplasma_phage	1.9e-10	24.8
WP_042521002.1\|2046758_2047562_+	ABC transporter permease	NA	NA	NA	NA
WP_042521000.1\|2047558_2048629_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_042520998.1\|2048671_2049475_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.8e-11	26.9
WP_021740906.1\|2049487_2050378_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_011668548.1\|2050367_2051321_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_042520996.1\|2051390_2052281_-	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_024526442.1\|2052561_2052912_+	hypothetical protein	NA	NA	NA	NA
WP_011668551.1\|2052968_2053172_-	hypothetical protein	NA	NA	NA	NA
WP_086989537.1\|2053285_2054060_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_011668552.1\|2054097_2054361_-	phosphotransferase system, HPr-related protein	NA	NA	NA	NA
WP_042520994.1\|2054513_2056880_+	ATP-dependent DNA helicase	NA	NA	NA	NA
WP_042520993.1\|2056876_2057569_+	hypothetical protein	A0A217ERD3	Bacillus_phage	1.4e-14	46.5
WP_042520991.1\|2057565_2058483_+	sce7725 family protein	NA	NA	NA	NA
WP_042520989.1\|2058606_2059650_-	lactonase family protein	NA	NA	NA	NA
WP_042520987.1\|2059793_2060240_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_042749563.1\|2060393_2061665_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_011373852.1\|2061687_2062608_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2

DBSCAN-SWA_11

2139333 : 2186686

Staphylococcus_phage(27.27%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011373852.1\|2139333_2140254_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2
WP_021741622.1\|2140657_2141338_-	ABC transporter permease	NA	NA	NA	NA
WP_039106084.1\|2141338_2142403_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.2e-31	37.2
WP_042520916.1\|2142467_2143271_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_035464455.1\|2143778_2144327_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_042520914.1\|2144414_2146055_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_042520911.1\|2146552_2148808_+	glycosyl hydrolase	NA	NA	NA	NA
WP_042520909.1\|2148855_2149839_-	choloylglycine hydrolase family protein	A7IWP6	Paramecium_bursaria_Chlorella_virus	9.3e-25	36.4
WP_042520907.1\|2150328_2153478_-	SMC family ATPase	NA	NA	NA	NA
WP_021741989.1\|2153474_2154608_-	exonuclease SbcCD subunit D	A0A0U1ZYB2	Staphylococcus_phage	1.8e-08	23.1
WP_024526382.1\|2154619_2155180_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_042749556.1\|2155403_2156330_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_042521314.1\|2156480_2157425_+	1,4-beta-N-acetylmuramidase	A0A160LKP9	Bacillus_phage	9.2e-22	34.0
WP_086989560.1\|2157486_2158611_-	endoglucanase	NA	NA	NA	NA
WP_042520904.1\|2158746_2159067_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_042750599.1\|2159066_2159489_-	cupin domain-containing protein	NA	NA	NA	NA
WP_039106099.1\|2159494_2159923_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_021741981.1\|2160102_2160672_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_021741980.1\|2161105_2161507_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_004561985.1\|2163450_2164440_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5
WP_024526374.1\|2164578_2165421_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.2e-51	40.4
WP_024526373.1\|2165480_2166665_-	MFS transporter	NA	NA	NA	NA
WP_024855431.1\|2166690_2167884_-	MFS transporter	NA	NA	NA	NA
WP_086989537.1\|2167938_2168714_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_042520899.1\|2168924_2169917_-	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_021741974.1\|2169917_2170184_-	EutN/CcmL family microcompartment protein	NA	NA	NA	NA
WP_075168692.1\|2170461_2171385_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042749563.1\|2171556_2172828_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_042749564.1\|2172941_2173643_-	DUF4430 domain-containing protein	NA	NA	NA	NA
WP_139592698.1\|2173668_2174718_-	fucose-binding lectin II	NA	NA	NA	NA
WP_139592699.1\|2174732_2175371_-	ECF transporter S component	NA	NA	NA	NA
WP_042520895.1\|2175430_2177083_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.6e-15	27.1
WP_042520893.1\|2177070_2177964_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_042520891.1\|2178376_2178787_-	hypothetical protein	NA	NA	NA	NA
WP_024526363.1\|2178789_2179353_-	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_042520886.1\|2179367_2180834_-	UbiD family decarboxylase	NA	NA	NA	NA
WP_042749565.1\|2180951_2181833_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_021741964.1\|2181924_2182335_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.0e-09	38.6
WP_042520883.1\|2182605_2184330_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_021741962.1\|2184470_2184815_+	hypothetical protein	NA	NA	NA	NA
WP_042520880.1\|2184966_2185617_-	porin	NA	NA	NA	NA
WP_139592700.1\|2185616_2185730_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_087094274.1\|2185756_2186686_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	3.8e-20	29.9

DBSCAN-SWA_12

2383617 : 2418898

Staphylococcus_prophage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042749622.1\|2383617_2384838_-\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	1.9e-104	49.4
WP_011373852.1\|2385214_2386135_+\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2
WP_004561985.1\|2386464_2387454_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5
WP_042520710.1\|2388266_2388719_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_042520708.1\|2388821_2389727_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_042520707.1\|2389745_2390276_+	serine acetyltransferase	NA	NA	NA	NA
WP_021742049.1\|2390334_2391525_-	NADH-dependent flavin oxidoreductase	NA	NA	NA	NA
WP_042749623.1\|2391521_2391809_-	hypothetical protein	NA	NA	NA	NA
WP_021742051.1\|2391870_2392257_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042520704.1\|2392393_2393476_+	LD-carboxypeptidase	NA	NA	NA	NA
WP_042520703.1\|2393480_2394413_-	ribosylpyrimidine nucleosidase	NA	NA	NA	NA
WP_042520702.1\|2394513_2395194_+	transcriptional regulator YeiL	NA	NA	NA	NA
WP_042520701.1\|2395264_2396242_-	cation transporter	NA	NA	NA	NA
WP_003593433.1\|2396557_2397730_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_123830887.1\|2397821_2398475_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_042520700.1\|2398533_2399166_-	hypothetical protein	NA	NA	NA	NA
WP_011668765.1\|2399279_2399672_+	DUF1398 family protein	NA	NA	NA	NA
WP_139592707.1\|2399793_2400714_+\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	7.1e-51	38.2
WP_042520698.1\|2400767_2401304_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_042520697.1\|2401400_2402681_-	sugar porter family MFS transporter	NA	NA	NA	NA
WP_139592708.1\|2402768_2403956_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_042749625.1\|2404393_2405077_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-32	37.2
WP_011668769.1\|2405088_2406147_-	ABC transporter permease	NA	NA	NA	NA
WP_039106303.1\|2406150_2406672_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_042520695.1\|2406811_2408002_-	MFS transporter	NA	NA	NA	NA
WP_015474519.1\|2408961_2410212_+	MFS transporter	NA	NA	NA	NA
WP_015474520.1\|2410226_2410694_+	YhcH/YjgK/YiaL family protein	NA	NA	NA	NA
WP_042520694.1\|2411048_2411780_-	L-ribulose-5-phosphate 4-epimerase	NA	NA	NA	NA
WP_042520693.1\|2411795_2412683_-	L-ribulose-5-phosphate 3-epimerase	NA	NA	NA	NA
WP_042520692.1\|2412679_2414212_-	carbohydrate kinase	NA	NA	NA	NA
WP_039106322.1\|2414226_2415231_-	hypothetical protein	NA	NA	NA	NA
WP_021742071.1\|2415360_2416317_-	glyoxylate reductase	NA	NA	NA	NA
WP_021742072.1\|2416760_2417801_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_085762961.1\|2417908_2418898_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	2.2e-58	40.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP031199

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

17972 : 64533

unidentified_phage(20.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012695388.1\|17972_19766_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A1C3S747	Escherichia_phage	5.0e-93	35.7
WP_012695389.1\|19831_20155_+	hypothetical protein	NA	NA	NA	NA
WP_085764787.1\|20279_22397_+	hypothetical protein	NA	NA	NA	NA
WP_024526857.1\|22399_22720_+	hypothetical protein	NA	NA	NA	NA
WP_042751037.1\|22739_23189_+	hypothetical protein	NA	NA	NA	NA
WP_012695391.1\|23189_24029_+	class A sortase	NA	NA	NA	NA
WP_012695392.1\|24054_24948_+	hypothetical protein	NA	NA	NA	NA
WP_012695393.1\|24996_27348_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_085768501.1\|27525_27717_+	hypothetical protein	NA	NA	NA	NA
WP_085764785.1\|27689_27785_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_042751027.1\|27811_28738_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	6.3e-23	27.9
WP_012695395.1\|28951_29644_+	hypothetical protein	NA	NA	NA	NA
WP_012695396.1\|29776_30460_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.3e-61	51.6
WP_012695397.1\|30698_31400_+	hypothetical protein	NA	NA	NA	NA
WP_085764784.1\|31403_31904_+	hypothetical protein	NA	NA	NA	NA
WP_012695398.1\|31957_32392_+	hypothetical protein	NA	NA	NA	NA
WP_012695400.1\|34870_35488_+	recombinase family protein	E5FFF9	Burkholderia_phage	1.1e-18	36.5
WP_139592727.1\|35757_36051_-	SLATT domain-containing protein	NA	NA	NA	NA
WP_052256152.1\|36859_37102_-	hypothetical protein	NA	NA	NA	NA
WP_139592722.1\|37125_37455_-	hypothetical protein	NA	NA	NA	NA
WP_039106828.1\|38661_39297_-	thiol reductase thioredoxin	NA	NA	NA	NA
WP_012695402.1\|39648_39870_+	brevicin 925A	NA	NA	NA	NA
WP_012695403.1\|39901_40111_+	brevicin 925A	NA	NA	NA	NA
WP_012695404.1\|40170_40368_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_080769724.1\|40378_40915_-	DUF3278 domain-containing protein	NA	NA	NA	NA
WP_012695406.1\|41306_42236_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.8e-25	30.8
WP_085764798.1\|42262_42361_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_087051836.1\|44557_45829_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_139592723.1\|46210_46939_+	helix-turn-helix domain-containing protein	A0A0S2MVM8	Bacillus_phage	3.2e-06	46.7
WP_012695409.1\|47005_49162_+	peptide cleavage/export ABC transporter	F2Y302	Organic_Lake_phycodnavirus	5.6e-22	33.5
WP_139592728.1\|49320_49617_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_139592724.1\|49678_50854_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.1e-27	29.2
WP_139592725.1\|50908_51604_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_012695411.1\|52567_55282_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_139592726.1\|55351_57829_+	hypothetical protein	NA	NA	NA	NA
WP_012695413.1\|57954_58302_+	hypothetical protein	NA	NA	NA	NA
WP_012695414.1\|58294_58945_+	hypothetical protein	NA	NA	NA	NA
WP_085764793.1\|58957_60910_+	ATPase	NA	NA	NA	NA
WP_012695416.1\|60924_62214_+	CHAP domain-containing protein	A0A076G7X7	Bacillus_phage	1.8e-12	34.3
WP_085764792.1\|62223_62805_+	hypothetical protein	NA	NA	NA	NA
WP_012695417.1\|62806_63427_+	hypothetical protein	NA	NA	NA	NA
WP_042751063.1\|63507_64533_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.8e-40	35.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP031201

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031201_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031201_1

6959-7058

Orphan

Consensus_repeat	Method
ACTGTAGAATTTACAGTTCTGCGCGCAGCAAGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031201_1

>merge|NZ_CP031201|1|6959-7058|CRISPRCasFinder
ACTGTAGAATTTACAGTTCTGCGCGCAGCAAGGGTTTGAGCGTCCTTTTCAACGGTGTCATGCTGAACTGTAGAATTTACAGTTCTGCGCGCAGCAAGGG

>NZ_CP031201|1|1|6959-7058|CRISPRCasFinder
ACTGTAGAATTTACAGTTCTGCGCGCAGCAAGGG	TTTGAGCGTCCTTTTCAACGGTGTCATGCTGA
ACTGTAGAATTTACAGTTCTGCGCGCAGCAAGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031201.1\|WP_080945479.1\|16304_16877_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP031201.1\|WP_057707345.1\|4572_4851_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031201.1\|WP_043023414.1\|3504_4092_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271192
NZ_CP031201.1\|WP_139592741.1\|17017_18304_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925
NZ_CP031201.1\|WP_005917927.1\|2830_3133_-\|type-II-toxin-antitoxin-system-YafQ-family-toxin	unknown	unknown	gnl\|CDD\|379750
NZ_CP031201.1\|WP_003625713.1\|8073_8349_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031201.1\|WP_139592731.1\|3122_3401_-\|RelB	unknown	unknown	gnl\|CDD\|225619
NZ_CP031201.1\|WP_010014831.1\|5750_6032_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|274102
NZ_CP031201.1\|WP_134787804.1\|15004_15792_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
NZ_CP031201.1\|WP_139592740.1\|10001_10736_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP031201.1\|WP_086989838.1\|4840_5521_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|226648
NZ_CP031201.1\|WP_086989834.1\|8351_9401_-\|ParM/StbA-family-protein	unknown	unknown	gnl\|CDD\|212669
NZ_CP031201.1\|WP_054712831.1\|11120_11519_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223317
NZ_CP031201.1\|WP_139592739.1\|1839_2307_-\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|153102
NZ_CP031201.1\|WP_086989831.1\|9656_9908_+\|transposase	unknown	unknown	gnl\|CDD\|366690
NZ_CP031201.1\|WP_080475109.1\|2306_2492_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031201.1\|WP_139592738.1\|1235_1802_+\|DUF536-domain-containing-protein	unknown	unknown	unknown
NZ_CP031201.1\|WP_086989997.1\|11826_13116_+\|phosphopyruvate-hydratase	unknown	unknown	gnl\|CDD\|234617
NZ_CP031201.1\|WP_065937755.1\|4340_4550_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031201.1\|WP_046870788.1\|19121_20039_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382

Protein	Function_ID	Function_description	E-value
NZ_CP031201.1\|WP_080945479.1\|16304_16877_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	9.42756e-08
NZ_CP031201.1\|WP_043023414.1\|3504_4092_+\|site-specific-integrase	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.0115e-72
NZ_CP031201.1\|WP_139592741.1\|17017_18304_+\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	6.61251e-06
NZ_CP031201.1\|WP_005917927.1\|2830_3133_-\|type-II-toxin-antitoxin-system-YafQ-family-toxin	gnl\|CDD\|379750	pfam15738, YafQ_toxin, Bacterial toxin of type II toxin-antitoxin system, YafQ. YafQ is a family of bacterial toxin ribonucleases of type II toxin-antitoxin systems. The E.coli gene is expressed from the dinB operon. The cognate antitoxin for the E. coli protein is DinJ, in family RelB_antitoxin, pfam02604.	5.70318e-24
NZ_CP031201.1\|WP_139592731.1\|3122_3401_-\|RelB	gnl\|CDD\|225619	COG3077, RelB, DNA-damage-inducible protein J [DNA replication, recombination, and repair].	0.00020736
NZ_CP031201.1\|WP_010014831.1\|5750_6032_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	6.2967e-11
NZ_CP031201.1\|WP_086989997.1\|11826_13116_+\|phosphopyruvate-hydratase	gnl\|CDD\|234617	PRK00077, eno, enolase; Provisional.	0
NZ_CP031201.1\|WP_086989838.1\|4840_5521_-\|AAA-family-ATPase	gnl\|CDD\|226648	COG4185, COG4185, Uncharacterized protein conserved in bacteria [Function unknown].	9.92679e-39
NZ_CP031201.1\|WP_139592740.1\|10001_10736_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.84889e-123
NZ_CP031201.1\|WP_054712831.1\|11120_11519_-\|hypothetical-protein	gnl\|CDD\|223317	COG0239, CrcB, Integral membrane protein possibly involved in chromosome condensation [Cell division and chromosome partitioning].	9.12825e-13
NZ_CP031201.1\|WP_139592739.1\|1839_2307_-\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|153102	cd01043, DPS, DPS protein, ferritin-like diiron-binding domain. DPS (DNA Protecting protein under Starved conditions) domain is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. Some DPS proteins nonspecifically bind DNA, protecting it from cleavage caused by reactive oxygen species such as the hydroxyl radicals produced during oxidation of Fe(II) by hydrogen peroxide. These proteins assemble into dodecameric structures, some form DPS-DNA co-crystalline complexes, and possess iron and H2O2 detoxification capabilities. Expression of DPS is induced by oxidative or nutritional stress, including metal ion starvation. Members of the DPS family are homopolymers formed by 12 four-helix bundle subunits that assemble with 23 symmetry into a hollow shell. The DPS ferroxidase site is unusual in that it is not located in a four-helix bundle as in ferritin, but is shared by 2-fold symmetry-related subunits providing the iron ligands. Many DPS sequences (e.g., E. coli) display an N-terminal extension of variable length that contains two or three positively charged lysine residues that extends into the solvent and is thought to play an important role in the stabilization of the complex with DNA. DPS Listeria Flp, Bacillus anthracis Dlp-1 and Dlp-2, and Helicobacter pylori HP-NAP which lack the N-terminal extension, do not bind DNA. DPS proteins from Helicobacter pylori, Treponema pallidum, and Borrelia burgdorferi are highly immunogenic.	1.57031e-46
NZ_CP031201.1\|WP_086989831.1\|9656_9908_+\|transposase	gnl\|CDD\|366690	pfam01527, HTH_Tnp_1, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family consists of various E. coli insertion elements and other bacterial transposases some of which are members of the IS3 family.	1.34724e-07
NZ_CP031201.1\|WP_086989834.1\|8351_9401_-\|ParM/StbA-family-protein	gnl\|CDD\|212669	cd10227, ParM_like, Plasmid segregation protein ParM and similar proteins. ParM is a plasmid-encoded bacterial homolog of actin, which polymerizes into filaments similar to F-actin, and plays a vital role in plasmid segregation. ParM filaments segregate plasmids paired at midcell into the individual daughter cells. This subfamily also contains Thermoplasma acidophilum Ta0583, an active ATPase at physiological temperatures, which has a propensity to form filaments.	1.72445e-51
NZ_CP031201.1\|WP_134787804.1\|15004_15792_-\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	6.26096e-20
NZ_CP031201.1\|WP_046870788.1\|19121_20039_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	2.74185e-62

>NZ_CP031201.1|WP_010014831.1|5750_6032_-|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MAVKEKKRVQVQIDKELADNTEAVLSQLGLNPTTAINMFYKRIVADAALPFKPALSEAERANLSLLKATKETPVTEFKDAKEVADWLNDPDED
>NZ_CP031201.1|WP_086989838.1|4840_5521_-|AAA-family-ATPase
MIDKPQYIIVAGINGAGKSTLYDTFPILFDKTKRINADELLRQMGGDWHKDSDNLKAMKEEIKQLHYALDHQQSIHVETTLAGRGKAQLNLIDKAHKNGFEVTLLYVALRDENLAIQRVNERVQKGGHGVPVATIKKRYQQSKHNLPLVAFKSDKVMIYDNSEKFTSVYAREKGQVFKNDLRHFPWINQNITYPEKVQKQLQNFADQNPEVKPKNDSENKNDRPSY
>NZ_CP031201.1|WP_057707345.1|4572_4851_+|hypothetical-protein
MSNQYEKLVEQQARLKQKIEREDFKLRQSKYYENRQARKARSRRLIQKGALLEKYFQANNLSVEQTEELLKTFADYVNAHKPNKLKNDQPNN
>NZ_CP031201.1|WP_065937755.1|4340_4550_+|hypothetical-protein
MSQSNLEKQEAKLKALNQKIKDEKNNIEQRIGKQIISQSNLDYANLSNDQIKILAKQFSEFLKVKSVDH
>NZ_CP031201.1|WP_043023414.1|3504_4092_+|site-specific-integrase
MQQVVLPIKDSNVLKEVQDTLLNNFKAGRRNYTIFQVGKATLLRVSDVMGLKQADIFNPDGSIKQNAFIHDRKTGKPNTLYLKPVQTELLLYRQWLLDHKLDSEWLFPSIQHPERHITEKQFYKIMSKVGDLLGINYLGTHTMRKTGAYRVYTQSNYNIGLVMHLLNHSSEAMTLAYLGLDQASTESMLDQIDFG
>NZ_CP031201.1|WP_139592731.1|3122_3401_-|RelB
MSNTIIKNKTISTRVTPDISERAKANLAKQGLTVSEYIRLSLVKAANNEVRLVSFLDSSEALAAKKEAETGQVKNIGSLTDFEDWIDKLDAN
>NZ_CP031201.1|WP_005917927.1|2830_3133_-|type-II-toxin-antitoxin-system-YafQ-family-toxin
MQIKQTKSFERELKKLVKKHFPITVLKPCLEAIVEQDVLVLKQIKDHALKGNWRGYREFHPARYGNYGKNYDNWIVIYQLDHDELILLLVATGSHEILNQ
>NZ_CP031201.1|WP_080475109.1|2306_2492_-|hypothetical-protein
MVDCKINPNSVRINFTIYHITSPSFQNDLILRAINNLICQCITFQIKLPLSYNNHIERRSI
>NZ_CP031201.1|WP_139592739.1|1839_2307_-|DNA-starvation/stationary-phase-protection-protein
MKYTKTKAVLNQLVADLSQMSMIIHQTHWYMRGPNFLKLHPLMDEFMEEIDSQLDVISERLIALDGSPYSTLKEMAENTKIQDWPGEWDKTTPERLVHLVDGYRYLEDLYQHGIEVSDVEKDFSTQDIFIGLKTAIEKKIWMIQAELGSAPEIDE
>NZ_CP031201.1|WP_139592738.1|1235_1802_+|DUF536-domain-containing-protein
MGKTIRQLSEEFKLSKQAINQRINSINGFRSKHTYKVKNHLEIDNQGVKMLANFDKQKRQERQPNRQAENDKDKNIDQILLKQLDVKDQQIANLQQALDQQQKLQIATVAENHRLKEHVQKLSGLFESSSATHQQQLNDKGDTLTNSSNTSHIKDKNDNQNENKAAEYGNRQKKTFKNNTNNSWWHFW
>NZ_CP031201.1|WP_003625713.1|8073_8349_-|hypothetical-protein
MGKVKTLNVRLNPEKIVDKEILDYFDKSLIPKTTLVKTALIHEIERLKAQGDPYVKDELKAPEAPKNSTESPSDSKERLQGGFNAFSDNDI
>NZ_CP031201.1|WP_086989834.1|8351_9401_-|ParM/StbA-family-protein
MDIFSLDLGNKQTKLKSSKAEYVLPSRYLNQADMPMSVGNSTMNNDLHTYSVPFSDDKYVWGRDIDRLHLDEYLADTIMYGARYNSEAFKLLANFALGLLASDFKAAKDQVLEVVVTAGLPTGDYAEQGQLKALLKVLEGQHQVTIDDKIVTVRVRKVYILPQPIGTLYNELLDDEGFIQNKDLLDEKVGIVDVGGGTILIDTILNFELSGKNRHQFNTGVNDLYEAIANGINGDTSLYQLEKDLRKGNQQHHWSYRFSKNRQDDITDLVCKEIDRFTRRLVANVTSTLKNLNSIDTLFFTGGGANLLNQKILNTTFTNAVIVKNTEVANVNGFYKYGLSQQAQNEGSK
>NZ_CP031201.1|WP_086989831.1|9656_9908_+|transposase
MPTRYDKEFKQNIINLYKQGESAAQLAREYGIGYSTVHKWIQGQAKTQSGKSPDEIKAMEKRLASLSEENEILKKAMGFLTQK
>NZ_CP031201.1|WP_139592740.1|10001_10736_+|IS3-family-transposase
MFAEFKQRYGVMKIHHEWNLELQPLQRPCSPRRISRLMKELDIHSVTVNKWKAASASKTKVEQRPNLLKQDFSTTGLNQKWTADMTYIQTKRNGWCYLSTIMDLHSRRIIGYSFSKKMATDLVLKTLESAVKNRTITGDLIIHTDLGSQYTSDDYNQRLTELHIRHSYSRKGCPYDNAPMESFHASLKKECVYPVPVFENYETAAAVLFEYVHAFYNRKRIHSSLGYQTPLQVEIATLTSQMAA
>NZ_CP031201.1|WP_054712831.1|11120_11519_-|hypothetical-protein
MQRLRYQDILAMFIGGCFGGIACWEIGLWLNDADTMLGTTAVNLIGRFLLEFVTYGLAVYIDLPGWLILALGTGFVGAFTTFSTMVPNLYKNVGESPVYEIRIFLLELLVGLGAAFSGYLCAEAWGRRRQTW
>NZ_CP031201.1|WP_086989997.1|11826_13116_+|phosphopyruvate-hydratase
MMSVVIESVKAREIFDSRGNPTVEADVNLSDGTLGRAEVPSGASTGEKEAVELRDGGDRLQGKGVSKAVANVNTEINKALHGTDPFNQAHIDQLMIDLDGTPNKARLGANAILGVSMATARAAANALHTPLYRYLGGTDLELPQTFHNVINGGEHADNGIDIQEFMITPVDRSSFRDGFEKIANTYHTLKKVIEEAGYTTGLGDEGGFAPDLKNSEDALQMLHDAIIKAGYTPGKEIAIAFDAAASYFYNRDTKNYDFEGKTYTPAELGEYYIHLLDKFPEIISIEDPYGEEDWGHFADFTKKYGDRVQLVADDPVCTNPALIKDAIKRGMANSILIKLNQIGTVTETLEAIRLARKNGYTTMMSHRSGETGDTFVADFTVATNTAQLKSGAPARSERVEKYNQLLRIEEELGADGTRLAHFPDSVDFD
>NZ_CP031201.1|WP_134787804.1|15004_15792_-|IS5-family-transposase
MKNYPSNITRQQFELIRPALENFRKRTKPRKYDLYEVFCAVLYVLKTGCQWRQVPGDFPEWRSVYNYYKIWSTKAEPTADSLLEQVFKKIVIARRTYQGRSALTSFIIVDAQSVKNTATAENKGYDAGKKISGIKRHLAVDINGFPQAIHMTRANVSDRDGASAMIALHAMHLRQVQNVLVDGGYSGVNFQLDIASNLNATVQVAKRNELHRFEVMPQRWVVERSFSWLENCRRLWKNCERQLTTSLQMVVLAFLALLLKRF
>NZ_CP031201.1|WP_080945479.1|16304_16877_-|TetR/AcrR-family-transcriptional-regulator
MFGEKEELMTDLRNKRTEMLIENSFIQLVRQQGFNNVSVIDISNKALINRQTFYRHYQDKYHLAAKMIQDFVSTYDSVLKKRSNLNKQNQNFLSITSILAPDIKNLLIKQREKILALRSIQLDSKDLSSEIKRVLRNNLVSMLEEKPDKFEMSLLTSLILGSFNYLIDEQELPDTSQIQHAITGILCLLS
>NZ_CP031201.1|WP_139592741.1|17017_18304_+|ABC-transporter-permease
MFDVIRSKRYWLALLLVGAIIGIVSFAFIGIRNSVKVKQIPVALVNEDKGALSNKIESKLRKKFNGKDSKIKWVSPQKDGFNDQKYYGAFIIRSGFSKELQQQNESLKAQIISQKLTTLQKKEKLPDSAKSKLLQAKFKSQLLQAKFVTQKPVHPAQIKISINQGMNAQISQLLSQALPKIANALSSRISAQQQSVLSKNKINLSAKSWDLVSTPISVSTHESNKIEKNTVNGTAPMLLVALAWFSALIPSLILWREHTKRSASKFLNATTITSQLITGLVASILSATVGFLFVNVCFNLTIPNPINFIGLMSISIFVFYLIITCVLDWLGFAFYPLLLVVWLLAISVISYAPETLDPLYRKGIYSWVPMRFSMQTLTNTLYFHNGSSTTMSSLLVLLIIGFVAAILMYSSGYLKHYLFTVRPHRKIK
>NZ_CP031201.1|WP_046870788.1|19121_20039_-|IS30-family-transposase
MTSLSSQERTVIQTLLELNYSIRAIARFINRSPATVSVEIHQVTPYKADIAHALALKKRHLRGRHHTLTPAIAVFLNEHIGILKWSPETAAHVLGLPFKTIYNWLNAGRLKLSLADLPDKGIRQKRQSDGRRQVFVHGRSIESRPKSVQARQDFGHFEVDTMQSGKKRGEVLVTITERLSRQHIVRQVSGRNSQAVTPVLIHFFQGIENAKSITVDRGREFVKYDEIEQKLGIPVYFAHPYSPEERGSNEILNRYVRRFIPKERKIETVSAKELDQINHWINARPMKTLNWQSPRKVFQQFAVFG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP031201_1	1.1\|6993\|32\|NZ_CP031201\|CRISPRCasFinder	6993-7024	32	NZ_CP014927	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-3, complete sequence	35572-35603	0	1.0
NZ_CP031201_1	1.1\|6993\|32\|NZ_CP031201\|CRISPRCasFinder	6993-7024	32	NZ_CP014928	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence	27239-27270	0	1.0
NZ_CP031201_1	1.1\|6993\|32\|NZ_CP031201\|CRISPRCasFinder	6993-7024	32	NZ_CP014932	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-8, complete sequence	38856-38887	0	1.0
NZ_CP031201_1	1.1\|6993\|32\|NZ_CP031201\|CRISPRCasFinder	6993-7024	32	NZ_CP014918	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-3, complete sequence	5597-5628	0	1.0
NZ_CP031201_1	1.1\|6993\|32\|NZ_CP031201\|CRISPRCasFinder	6993-7024	32	NZ_CP017263	Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.22, complete sequence	23046-23077	0	1.0
NZ_CP031201_1	1.1\|6993\|32\|NZ_CP031201\|CRISPRCasFinder	6993-7024	32	NC_022114	Lactobacillus paracasei subsp. paracasei 8700:2 plasmid 1, complete sequence	633-664	0	1.0
NZ_CP031201_1	1.1\|6993\|32\|NZ_CP031201\|CRISPRCasFinder	6993-7024	32	NZ_CP031201	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_C, complete sequence	6993-7024	0	1.0
NZ_CP031201_1	1.1\|6993\|32\|NZ_CP031201\|CRISPRCasFinder	6993-7024	32	NZ_CP019324	Lactobacillus allii strain WiKim39 plasmid pWIKIM01, complete sequence	27911-27942	0	1.0
NZ_CP031201_1	1.1\|6993\|32\|NZ_CP031201\|CRISPRCasFinder	6993-7024	32	NZ_CP018330	Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-6, complete sequence	18421-18452	2	0.938

1. spacer 1.1|6993|32|NZ_CP031201|CRISPRCasFinder matches to NZ_CP014927 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-3, complete sequence) position: , mismatch: 0, identity: 1.0

tttgagcgtccttttcaacggtgtcatgctga	CRISPR spacer
tttgagcgtccttttcaacggtgtcatgctga	Protospacer
********************************

2. spacer 1.1|6993|32|NZ_CP031201|CRISPRCasFinder matches to NZ_CP014928 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence) position: , mismatch: 0, identity: 1.0

tttgagcgtccttttcaacggtgtcatgctga	CRISPR spacer
tttgagcgtccttttcaacggtgtcatgctga	Protospacer
********************************

3. spacer 1.1|6993|32|NZ_CP031201|CRISPRCasFinder matches to NZ_CP014932 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-8, complete sequence) position: , mismatch: 0, identity: 1.0

tttgagcgtccttttcaacggtgtcatgctga	CRISPR spacer
tttgagcgtccttttcaacggtgtcatgctga	Protospacer
********************************

4. spacer 1.1|6993|32|NZ_CP031201|CRISPRCasFinder matches to NZ_CP014918 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-3, complete sequence) position: , mismatch: 0, identity: 1.0

tttgagcgtccttttcaacggtgtcatgctga	CRISPR spacer
tttgagcgtccttttcaacggtgtcatgctga	Protospacer
********************************

5. spacer 1.1|6993|32|NZ_CP031201|CRISPRCasFinder matches to NZ_CP017263 (Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.22, complete sequence) position: , mismatch: 0, identity: 1.0

tttgagcgtccttttcaacggtgtcatgctga	CRISPR spacer
tttgagcgtccttttcaacggtgtcatgctga	Protospacer
********************************

6. spacer 1.1|6993|32|NZ_CP031201|CRISPRCasFinder matches to NC_022114 (Lactobacillus paracasei subsp. paracasei 8700:2 plasmid 1, complete sequence) position: , mismatch: 0, identity: 1.0

tttgagcgtccttttcaacggtgtcatgctga	CRISPR spacer
tttgagcgtccttttcaacggtgtcatgctga	Protospacer
********************************

7. spacer 1.1|6993|32|NZ_CP031201|CRISPRCasFinder matches to NZ_CP031201 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_C, complete sequence) position: , mismatch: 0, identity: 1.0

tttgagcgtccttttcaacggtgtcatgctga	CRISPR spacer
tttgagcgtccttttcaacggtgtcatgctga	Protospacer
********************************

8. spacer 1.1|6993|32|NZ_CP031201|CRISPRCasFinder matches to NZ_CP019324 (Lactobacillus allii strain WiKim39 plasmid pWIKIM01, complete sequence) position: , mismatch: 0, identity: 1.0

tttgagcgtccttttcaacggtgtcatgctga	CRISPR spacer
tttgagcgtccttttcaacggtgtcatgctga	Protospacer
********************************

9. spacer 1.1|6993|32|NZ_CP031201|CRISPRCasFinder matches to NZ_CP018330 (Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-6, complete sequence) position: , mismatch: 2, identity: 0.938

tttgagcgtccttttcaacggtgtcatgctga	CRISPR spacer
tttgagcgcccttctcaacggtgtcatgctga	Protospacer
********.****.******************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP031200

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP031198

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP031199

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP031201

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection