CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP040746	Bacillus altitudinis strain HQ-51-Ba plasmid punnamed1, complete sequence	0 crisprs	NA	0	0	0
NZ_CP040747	Bacillus altitudinis strain HQ-51-Ba chromosome, complete genome	1 crisprs	csa3,DEDDh,WYL,DinG,cas3	2	2	9
NZ_CP040745	Bacillus altitudinis strain HQ-51-Ba plasmid punnamed2, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040747_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040747_1

776315-776537

Orphan

Consensus_repeat	Method
AGGCGCCACAGGTGCGACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP040747_1

>merge|NZ_CP040747|1|776315-776537|PILER-CR
ACCGGAGCCACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAGGAACAGGCGCCACGGGAGCAACCGGTGCAACAGGCGCCACAGGTGCGACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAGGAACAGGCGCCACGGGAGCAACCGGTGCAACAGGCGCCACAGGTGCGACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAG

>NZ_CP040747|1|1|776315-776537|PILER-CR
ACCGGAGCCACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAGGAACAGG	CGCCACGGGAGCAACCGGTGCAACAGGCGCC
ACAGGTGCGACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAGGAACAGG	CGCCACGGGAGCAACCGGTGCAACAGGCGCC
ACAGGTGCGACAGGTGTAACAGGAGATACGGGTGCAACAGGGGCTACAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040747.1\|WP_138825339.1\|770687_771491_+\|SUMF1/EgtB/PvdO-family-nonheme-iron-enzyme	unknown	unknown	gnl\|CDD\|335469
NZ_CP040747.1\|WP_008341777.1\|783897_784383_-\|phenolic-acid-decarboxylase	unknown	unknown	gnl\|CDD\|368644
NZ_CP040747.1\|WP_008343192.1\|762655_764209_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP040747.1\|WP_138825335.1\|764361_765504_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223587
NZ_CP040747.1\|WP_050827051.1\|778843_779542_+\|response-regulator	unknown	unknown	gnl\|CDD\|226931
NZ_CP040747.1\|WP_025206916.1\|785158_786265_+\|nitric-oxide-synthase-oxygenase	unknown	unknown	gnl\|CDD\|376957
NZ_CP040747.1\|WP_138825341.1\|773534_774617_+\|bifunctional-diaminohydroxyphosphoribosylaminopyrimidine-deaminase/5-amino-6-(5-phosphoribosylamino)uracil-reductase-RibD	unknown	unknown	gnl\|CDD\|273015
NZ_CP040747.1\|WP_057078335.1\|786805_787078_-\|acylphosphatase	unknown	unknown	gnl\|CDD\|237710
NZ_CP040747.1\|WP_017366799.1\|766667_767045_-\|YfmB-family-protein	unknown	unknown	gnl\|CDD\|288356
NZ_CP040747.1\|WP_017358773.1\|784496_785054_+\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP040747.1\|WP_007496775.1\|767267_767615_+\|general-stress-protein	unknown	unknown	gnl\|CDD\|378584
NZ_CP040747.1\|WP_035391378.1\|771495_773253_+\|WD40-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|238121
NZ_CP040747.1\|WP_138825343.1\|777244_778840_+\|GHKL-domain-containing-protein	unknown	unknown	gnl\|CDD\|225827
NZ_CP040747.1\|WP_008341779.1\|780713_782012_+\|citrate-transporter	unknown	unknown	gnl\|CDD\|162036
NZ_CP040747.1\|WP_138825345.1\|779544_780522_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|225722
NZ_CP040747.1\|WP_007496773.1\|768755_769412_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379312
NZ_CP040747.1\|WP_138825337.1\|765541_766546_-\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176190
NZ_CP040747.1\|WP_025206917.1\|786365_786791_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040747.1\|WP_138825347.1\|782193_783825_+\|peptidase-M14	unknown	unknown	gnl\|CDD\|349461
NZ_CP040747.1\|WP_017360404.1\|769929_770655_+\|GTP-cyclohydrolase-II	unknown	unknown	gnl\|CDD\|238348

Protein	Function_ID	Function_description	E-value
NZ_CP040747.1\|WP_138825339.1\|770687_771491_+\|SUMF1/EgtB/PvdO-family-nonheme-iron-enzyme	gnl\|CDD\|335469	pfam03781, FGE-sulfatase, Sulfatase-modifying factor enzyme 1. This domain is found in eukaryotic proteins required for post-translational sulfatase modification (SUMF1). These proteins are associated with the rare disorder multiple sulfatase deficiency (MSD). The protein product of the SUMF1 gene is FGE, formylglycine (FGly),-generating enzyme, which is a sulfatase. Sulfatases are enzymes essential for degradation and remodelling of sulfate esters, and formylglycine (FGly), the key catalytic in the active site, is unique to sulfatases. FGE is localized to the endoplasmic reticulum (ER) and interacts with and modifies the unfolded form of newly synthesized sulfatases. FGE is a single-domain monomer with a surprising paucity of secondary structure that adopts a unique fold which is stabilized by two Ca2+ ions. The effect of all mutations found in MSD patients is explained by the FGE structure, providing a molecular basis for MSD. A redox-active disulfide bond is present in the active site of FGE. An oxidized cysteine residue, possibly cysteine sulfenic acid, has been detected that may allow formulation of a structure-based mechanism for FGly formation from cysteine residues in all sulfatases. In Mycobacteria and Treponema denticola this enzyme functions as an iron(II)-dependent oxidoreductase.	7.53832e-35
NZ_CP040747.1\|WP_008341777.1\|783897_784383_-\|phenolic-acid-decarboxylase	gnl\|CDD\|368644	pfam05870, PA_decarbox, Phenolic acid decarboxylase (PAD). This family consists of several bacterial phenolic acid decarboxylase proteins. Phenolic acids, also called substituted cinnamic acids, are important lignin-related aromatic acids and natural constituents of plant cell walls. These acids (particularly ferulic, p-coumaric, and caffeic acids) bind the complex lignin polymer to the hemicellulose and cellulose in plants. The Phenolic acid decarboxylase (PAD) gene (pad) is transcriptionally regulated by p-coumaric, ferulic, or caffeic acid; these three acids are the three substrates of PAD.	4.54686e-102
NZ_CP040747.1\|WP_008343192.1\|762655_764209_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	0
NZ_CP040747.1\|WP_138825335.1\|764361_765504_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|223587	COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis].	3.81077e-107
NZ_CP040747.1\|WP_050827051.1\|778843_779542_+\|response-regulator	gnl\|CDD\|226931	COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms].	3.45144e-88
NZ_CP040747.1\|WP_025206916.1\|785158_786265_+\|nitric-oxide-synthase-oxygenase	gnl\|CDD\|376957	pfam02898, NO_synthase, Nitric oxide synthase, oxygenase domain.	0
NZ_CP040747.1\|WP_138825341.1\|773534_774617_+\|bifunctional-diaminohydroxyphosphoribosylaminopyrimidine-deaminase/5-amino-6-(5-phosphoribosylamino)uracil-reductase-RibD	gnl\|CDD\|273015	TIGR00326, eubact_ribD, riboflavin biosynthesis protein RibD. This model describes the ribD protein as found in Escherichia coli. The N-terminal domain includes the conserved zinc-binding site region captured in the model dCMP_cyt_deam and shared by proteins such as cytosine deaminase, mammalian apolipoprotein B mRNA editing protein, blasticidin-S deaminase, and Bacillus subtilis competence protein comEB. The C-terminal domain is homologous to the full length of yeast HTP reductase, a protein required for riboflavin biosynthesis. A number of archaeal proteins believed related to riboflavin biosynthesis contain only this C-terminal domain and are not found as full-length matches to this model. [Biosynthesis of cofactors, prosthetic groups, and carriers, Riboflavin, FMN, and FAD].	9.0212e-128
NZ_CP040747.1\|WP_057078335.1\|786805_787078_-\|acylphosphatase	gnl\|CDD\|237710	PRK14420, PRK14420, acylphosphatase; Provisional.	3.0954e-30
NZ_CP040747.1\|WP_017366799.1\|766667_767045_-\|YfmB-family-protein	gnl\|CDD\|288356	pfam11486, DUF3212, Protein of unknown function (DUF3212). Members in this family of proteins are annotated as YfmB however currently no function for this protein is known.	7.34325e-67
NZ_CP040747.1\|WP_017358773.1\|784496_785054_+\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	5.40648e-22
NZ_CP040747.1\|WP_007496775.1\|767267_767615_+\|general-stress-protein	gnl\|CDD\|378584	pfam11181, YflT, Heat induced stress protein YflT. YflT is a heat induced protein.	9.52497e-34
NZ_CP040747.1\|WP_035391378.1\|771495_773253_+\|WD40-repeat-domain-containing-protein	gnl\|CDD\|238121	cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.	2.79896e-51
NZ_CP040747.1\|WP_138825343.1\|777244_778840_+\|GHKL-domain-containing-protein	gnl\|CDD\|225827	COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms].	2.1568e-152
NZ_CP040747.1\|WP_008341779.1\|780713_782012_+\|citrate-transporter	gnl\|CDD\|162036	TIGR00784, Mg2+/citrate_complex_secondary_transporter, citrate transporter, CitMHS family. This family includes two characterized citrate/proton symporters from Bacillus subtilis. CitM transports citrate complexed to Mg2+, while the CitH apparently transports citrate without Mg2+. The family also includes uncharacterized transporters, including a third paralog in Bacillus subtilis. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	0
NZ_CP040747.1\|WP_138825345.1\|779544_780522_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|225722	COG3181, COG3181, Uncharacterized protein conserved in bacteria [Function unknown].	2.61132e-64
NZ_CP040747.1\|WP_007496773.1\|768755_769412_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.35262e-16
NZ_CP040747.1\|WP_138825337.1\|765541_766546_-\|zinc-binding-dehydrogenase	gnl\|CDD\|176190	cd05288, PGDH, Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.	0
NZ_CP040747.1\|WP_138825347.1\|782193_783825_+\|peptidase-M14	gnl\|CDD\|349461	cd06242, M14-like, Peptidase M14-like domain; uncharacterized subgroup. Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Two major subfamilies of the M14 family, defined based on sequence and structural homology, are the A/B and N/E subfamilies. Enzymes belonging to the A/B subfamily are normally synthesized as inactive precursors containing preceding signal peptide, followed by an N-terminal pro-region linked to the enzyme; these proenzymes are called procarboxypeptidases. The A/B enzymes can be further divided based on their substrate specificity; Carboxypeptidase A-like (CPA-like) enzymes favor hydrophobic residues while carboxypeptidase B-like (CPB-like) enzymes only cleave the basic residues lysine or arginine. The A forms have slightly different specificities, with Carboxypeptidase A1 (CPA1) preferring aliphatic and small aromatic residues, and CPA2 preferring the bulky aromatic side chains. Enzymes belonging to the N/E subfamily enzymes are not produced as inactive precursors and instead rely on their substrate specificity and subcellular compartmentalization to prevent inappropriate cleavages. They contain an extra C-terminal transthyretin-like domain, thought to be involved in folding or formation of oligomers. MCPs can also be classified based on their involvement in specific physiological processes; the pancreatic MCPs participate only in alimentary digestion and include carboxypeptidase A and B (A/B subfamily), while others, namely regulatory MCPs or the N/E subfamily, are involved in more selective reactions, mainly in non-digestive tissues and fluids, acting on blood coagulation/fibrinolysis, inflammation and local anaphylaxis, pro-hormone and neuropeptide processing, cellular response and others. Another MCP subfamily, is that of succinylglutamate desuccinylase /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate (NAA), and deficiency in which is the established cause of Canavan disease. Another subfamily (referred to as subfamily C) includes an exceptional type of activity in the MCP family, that of dipeptidyl-peptidase activity of gamma-glutamyl-(L)-meso-diaminopimelate peptidase I which is involved in bacterial cell wall metabolism.	7.46164e-85
NZ_CP040747.1\|WP_017360404.1\|769929_770655_+\|GTP-cyclohydrolase-II	gnl\|CDD\|238348	cd00641, GTP_cyclohydro2, GTP cyclohydrolase II (RibA). GTP cyclohydrolase II catalyzes the conversion of GTP to 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5' phosphate, formate, pyrophosphate (APy), and GMP in the biosynthetic pathway of riboflavin. Riboflavin is the precursor molecule for the synthesis of the coenzymes flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) which are essential to cell metabolism. The enzyme is present in plants and numerous pathogenic bacteria, especially gram negative organisms, who are dependent on endogenous synthesis of the vitamin because they lack an appropriate uptake system. For animals and humans, which lack this biosynthetic pathway, riboflavin is the essential vitamin B2. GTP cyclohydrolase II requires magnesium ions for activity and has a bound catalytic zinc. The functionally active form is thought to be a homodimer. A paralogous protein is encoded in the genome of Streptomyces coelicolor, which converts GTP to 2-amino-5-formylamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate (FAPy), an activity that has otherwise been reported for unrelated GTP cyclohydrolases III.	2.51622e-69

>NZ_CP040747.1|WP_138825341.1|773534_774617_+|bifunctional-diaminohydroxyphosphoribosylaminopyrimidine-deaminase/5-amino-6-(5-phosphoribosylamino)uracil-reductase-RibD
MKDDVFYMKLAIANAKAMKGQTSPNPLVGAVIVQSGEIVGIGAHMKAGEPHAEIHALQMAGEKAKGADMYVTLEPCTHHGKTGPCTEAIIKSGVKKVLIATQDPNPVVAGKGIAFLKKAGIEVEQGICKQEADRLNAPFFHLMQTNLPYVILKSAISIDGKIATADQESKWITGIEARTEVQRLRQEVDAVLTGVETIIQDDAGLIVKDSFNHQPIRVILDSTLRIPLHAKCLTDHRAETIICTSQDYDHQKYQQLIQKGHQVFVTSGEHRTDLQDVLHLLKKRSVMSVLVEAGGSVSASFLKASLVNEAVIYMAPLLIGGKDAPTFFEGEGVKKLKKAIRPADIEYSMVGKDLKMTMTF
>NZ_CP040747.1|WP_035391378.1|771495_773253_+|WD40-repeat-domain-containing-protein
MHRGPITSVLSTQHDQIVYTGGYDRCIYKWDRATGEGTFIGSHEHIINSLSLSENGTYLASASSDYTIQLYDTSTHTRIRTLYGHADDVEAVAFAKQDTLLVSVSRDRRCLVWDIETGAILREFHGHSKDVLAVWIHEDKAYTTGDDGYVLVWLYETGEIVGEIGPFDYELDTISGSNQKEVFALGRDDGTVIIYDAATLQEKKIIKAHLQGVKRVNFSPSGNYLLTAGYDHLIKLWNYETGDLIDTLLPHKYQWERSLVWTEDEQAILGASFGKTYCEWSIQEGKVISDEQELATPSINDIALTEAGDIITASDDGKFRKNGIEIAKSTGVLTNGVAVARDGSYYAWGDHASQVHIVHESLQQMVSFDLNTGPVNSVYFHEEDRQFYIGTYGGYVHVISTEHLKEIGRSKAHDCAVKALKVEGDHIITAAVEGTICLLDKKSLSLTAEYIGATELLNDVFIDSKRDRIAIVSRDKNVRLFDLHTGRILNQHNEHQYSIKSITVTDSGYIVSGDYWGYIVVWNPELDVNTGPIRIAKNGISAIRQLGNDVYASSYDGGIYHIREDGTHTEVLRLFEQFPKEVISH
>NZ_CP040747.1|WP_138825339.1|770687_771491_+|SUMF1/EgtB/PvdO-family-nonheme-iron-enzyme
MKPDINWIQIPSGYATIGSNEEDMKKASEFWKDKLLNPAYGREKKFQKWLYKEFPSYQPYMSEFFISDTVVTNEWYQSYCDETGKPYPESFTNLELGGGKDHPAWGMDIEEAFSFCQWLSGKLGYEVSIPTEEEWEYAARGNTRHQYPWGDEFDPSYCNTHESNIEKTTPVRHYEKGRSLFGLYDMGGNVEEWVNTKYHIYEGGIEVVDDLTETLGSDYYILKGGSFARGGDLCRVARRHGKHPDPVFRFTGFRVVTRQKQHIKVGV
>NZ_CP040747.1|WP_017360404.1|769929_770655_+|GTP-cyclohydrolase-II
MNKFVAELQSMIHHFTFQEKHYLLVGPVNLPISIEHEEVQFTWYAFASVEADTTPTVESIVQMSTEQQTFSSCLLFGDFENEVPPLVRIHSVCQTGDVFGSLKCDCGPQLASSLKKITDYGKGMLVYMANQEGRSIGLMAKAFTYKLQEMKLDTFEANRLIGCGDDDRHYEEAAAVLHYLNKGKPLHLLTNNPDKVDSIAAYGLPVLRFDHTVEASLYNEAYLKAKAASGHMVDEKKLINQ
>NZ_CP040747.1|WP_007496773.1|768755_769412_+|methyltransferase-domain-containing-protein
MKKALYHEDSGLYLEKMRMAFQEHYEQRTDMWSTDPSLTDAAVMSLKAWRSREKDALASVLDIGCGNGRALEHLQGLSAYTGIDLYEHEEWQGLKKRKEVPVHFYHQDFMSWSMDQGRELTFDLILDHGCFHHQHPDDHERYLKQISSLLHEGGVFSLVVWGEEWKTGLIGEDGRFHFSFSDTQLGEKICTSGLELVSITPLQAKAGISQHHVIAVKI
>NZ_CP040747.1|WP_007496775.1|767267_767615_+|general-stress-protein
MKPVVREYSNDETLQRDVEQLKQLGVAREDIYVLSHDDDRTERIASNADANTIGPKEVGLKHAVGNIFSKKGDELRNKIHEIGFSKEEAETFEEHLDEGKVLLFVTDHEKVKNWA
>NZ_CP040747.1|WP_017366799.1|766667_767045_-|YfmB-family-protein
MYYFSAEQQFNAWVVSDLVKQLFQKWNPEESKAKPLTLFAEQHFHICIDYLFSIIINIGDIESIEQDPQDLLSSYLNILFPFVTHDMMKASMQNANEYLLKERDADEYQLFGCLPPLLSVSLQKK
>NZ_CP040747.1|WP_138825337.1|765541_766546_-|zinc-binding-dehydrogenase
MSQQKQIQLAKRPKGLPTKDVFHFETVDIPTPQDGEVLIQTKYVSVDPYMRGRMQDTKSYTPPFKLNEVIQGGVVGEVVESKSPQFEKGDFVLGFLGWQEYSTAKAESLTKIDPSIAPLSYYLGILGMPGQTAYFGLLAIGQPKEGETVVISGAAGAVGSVVGQIAKIKGAHVVGIAGSDDKLAYLKELGFDETINYKTTNDLDDAIAKACPNGVDVYFDNVGGEISDAVMNHLNRFARIPVCGAISSYNISASEDIGPRVQTKLIKTSALMQGFIVANYSDRFEEAAKDLAQWVKEDKLTYKETIIEGFDNIPDAFLGLFKGENVGKQLVKIS
>NZ_CP040747.1|WP_138825335.1|764361_765504_+|DEAD/DEAH-box-helicase
MTENWAFLKEAKPFIQQNFEAAGFEKPTAIQEQTAEWITEKRDVIAESPTGTGKTLAYVLPLLNKIDVSIKHPQVLILAPSRELVMQIFDVVQEFKQGSDIKAISLIGGANIKKQQEKLKKHPNIVVATPGRVQELIKIKKLKMHEVKTIVLDEADQLLVPEHMKTIQAIIKSTLKERQILCFSATLKEETVQLIKEMTTEPEVLKIARSEEEAQKVSHYYLLCDQRDKVKLLQKLSRLEDMQALVFVRDITNLSIYAEKLAYHHVDLGVLHSEAKKAERAVILKAFEQREFPLLLATDIAARGIDIDDLPYVIHADMPNEEGYIHRSGRTGRAGKEGAVISLVTPQEQSMLKKMAKKLNLSLEEIVYKQGQLHLAPKQA
>NZ_CP040747.1|WP_008343192.1|762655_764209_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MILSVKDLSHGFGDRAIFHEVSFRLLKGEHVGLIGANGEGKSTFMNIITGKLEPDAGKVEWAKNVRVGYLDQHTVLEKGRTIREVLQDAFHYLFSMEAAMNDIYEKMGEADPDELEKLLEEVGVIQDALTNNDFYIIDSKVEEIARGLGLTDLGLDRDVTELSGGQRTKVLLAKLLLEKPEILLLDEPTNYLDEQHIEWLKRYLQEYENAFILISHDIPFLNSVINLIYHVENQELTRYVGDYDQFKQVYEVKKQQLEAAYKRQQQEVAELKDFVARNKARVSTRNMAMSRQKKLDKMDMIELAAEKPKPEFHFKPARTSGKLIFETKDLVIGYDEPLSRPLNLKMERGQKIALYGANGIGKTTLLRSLLGEISPISGEVERGEFLHIGYFEQEVKEQNSNTCIEEVWSTFPSYTQYEVRAALAKCGLTTKHIESRVSVLSGGEKAKVRLCKLINEETNLLVLDEPTNHLDVDAKEELKRALKEYKGSVLLISHEPEFYQDVATETWNCESWTTKVL
>NZ_CP040747.1|WP_138825343.1|777244_778840_+|GHKL-domain-containing-protein
MGKRKVTLQTKILGLIIGLLLVVIALLTICFGFLQTSERQSQAEQLAVQTARTISYMPPIKTSVATGDSQNEEQAVLEQMKEQVRAHAIFITNQKGKVLFHTNHEDVGKTISVSEGRSTLLFGGTSISTGDSDGEIVVRGSAPIMKETGSHEEIIGTVSVEFLKRDIDQATAHQLFKLSYIALLVLLPGVFGAIFLTRSIRKDILGLEPHEIASLYREREAMLHAIKEGIIAFDRKGAITMMNTSAEQMLRVSSTLPLHIDQVLPNANLLSYLKEEMIEPNIESVVNDKTFVLNVKKVVQDNRVFGGIVSFREKTELTKLLDTLTEVSQYSEDLRAQTHEFSNKLYAILGLLELKQVDEAIELIKEEYTLQNRQHDLLMKQIRSPKIQAILLGKLGKASEKKVHFHIDENSSLEPLPAHLSLSHFITIIGNLVDNAFEAVLNKEKREVSLFITDIGFDIIIEVSDSGDGVDEGAISQLFTRGHSSKGEGRGYGLANVKEVLDELGGWIEVANQKEGGAIFTVYIPKGTKGE
>NZ_CP040747.1|WP_050827051.1|778843_779542_+|response-regulator
MIKVLIAEDDFRIAAIHESYIQKVQGFQVAGKAKSAKDLWGALQKEQVDLILLDVYMPDELGTNLLPLLRERHPEVDVIIITAATETMLLRDALHYGVVHYLIKPVTAQKFTQVLTEYKEKRELINSKDEVNQTMIDLFFGQIQEESQQKDERDLPTGINSLTLDKVKTFMAAEMNGITAEELGEKMGASRTTARRYVEYLVTTGECRAELAYGIIGRPERKYYPAKKQTES
>NZ_CP040747.1|WP_138825345.1|779544_780522_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKKGILLLILVCLCTTLTFNEKTAKDSFLEHSPLYIVVSGVPDGGFDQTAQVMKTVLEQEKLVEEPVHILYQRGGTVDKGWTYMMERDANYISLNSSLLLSRNLLGSSNVTMNDVTPLAILAEEWQVVAVPVDSPFSNGKELLHALKKKPDSLKIGFAPDFGNDDQISFARAAEMAGIDPYRIQFLKFDSADDLFQALIDHEVDAATTTITEVRHDYEKKRLKLVATTTNQRLDGFKDVPTWKEQGIPLIFSHWRGVMGPKQMNQHDIRAWDQLLQKMTQTKSWKKQLKQKGWTGRYMNSKEAKVFMEDQLRRYEQFIQGEQAVK
>NZ_CP040747.1|WP_008341779.1|780713_782012_+|citrate-transporter
MLAILGFLMMIVFMVLIMTKRMSVLTALVLTPIAFALIAGFHFTEISDMIVKGVQQVAPTAVMIMFAILYFGIMIDAGLFDPMVAKILKIVKGDPLKIVVGTAVLTMLVALDGDGTTTYMITTTAMLPLFTLLGIRPIILAGIAGVGMGIMNTIPWGGATPRAASALGVDPSLLFGPMIPVIGAGVLSMIVVAYFLGKSERKRLGVIELEQPIHANEMAAALQDDIKRPKLWWFNLTLTLLLVLLLVSGKVSLTVLFVLAFCVAIIVNYPNLEQQRERIAAHSTNVLAIASMIFAAGVFTGILTGTKMVDEMAISIVSAIPEQLGGFIPVIVALTSGIFTFFMPNDAYFYGVLPILSETAAAYGVDKIEIARASIIGQPIHMLSPLVPSTHLLVGLVGVSLDQHQKFGMKWAVLAVVAMTVMAVLIGAISIW
>NZ_CP040747.1|WP_138825347.1|782193_783825_+|peptidase-M14
MSKQKSTILFAAVCLMAGSLSMVTPASANAETPYYGKSYEQPASVQKLYPEPDETFDTPAFQKKGKAFTTQEELQDFLRDIVSKSPYATQKQIGTSIEGRSIPALYFTKDRHISPLSKKPTIWLQAQIHGNEPASGESALVIAKRLAGDEGERILSHVNVIIVPRINPDGSYAFDRRLANGMDGNRDHMTLESPELTALHQEFNRYAPEVVIDAHEYDVGQKQFEDIGAIGALKYHDLLILSGKNLNIPESIRFTSNELYVNGVREALTNKGFSNDLYYTNTRGKDGKIDLYEGGTDARIGRNALALSPALSFLVESRGIGIGREDFTRRVAAQVTTHEKIIETTVKHAKQVKQQMVTERLKLVKKGLQPNDDDQVVIQDAFKAPVNDSLEMVDIEKGQTTNVPVRFHSASDAVPVLTRERPTAYLILPGHEGVDRKLRTLGLKSVTLPVGMKVPVQAYEVTKRVETSKTDIQLETRLVEKKRQLPKGTKVYVTAQPETNLLSLALEPESKDSYMSSGFIASKVGDELPVYRFLLSQKTLGMK
>NZ_CP040747.1|WP_008341777.1|783897_784383_-|phenolic-acid-decarboxylase
MDQFVGLHMIYTYENGWEYEIYIKNDHTIDYRIHSGMVGGRWVRDQEVNIVKLTKGVYKVSWTEPTGTDVSLNFMPEEKRMHGVIFFPKWVHERPDITVCYQNDYIDLMKESREKYETYPKYVVPEFADITYIHHAGVNDETIIAEAPYEGMTDEIRAGRK
>NZ_CP040747.1|WP_017358773.1|784496_785054_+|PadR-family-transcriptional-regulator
MRVLKYAILGLLDQRELTGYDMKKHFEDSLGQFWSAKHSQIYPELKRLTEEGFIEFDIHIQGKKLEKKVYQITDAGKRELHEWLREKGPIPDTTKDEFMLKTFFISSMDQKEAAGLFAHQLLERTKKVEMLKQKLNILTEEDPSAQSLHSTQFGHYLVLTRAIEREKGYVRWLQKTLEVIDSSIV
>NZ_CP040747.1|WP_025206916.1|785158_786265_+|nitric-oxide-synthase-oxygenase
MSNQEALWNEAEAFISVCYEELGKSNEEKAARLHEIKKEIESDGMYTHTQEELAHGAKMAWRNSNRCIGRLFWSTLHVHDCRHVTTEDEVKEALFHHIEYATNGGKIKPSITIFPPENKGRKEVVIYNHQLVRYAGYESEYGIIGDEASLELTKLCEAHGWKGEGTHFDLLPLMFQLKDQPPVLYDLPKEIVQEVEITHPEYDGFGDLGLKWYAVPIIADMKLEIGGIHYNAAPFNGWYMGTEIGARNLADENRYNMLKKVASILGLDTTKNSSLWKDKAIVELNVAVLHSYREAGVTIVDHHTAAHQFKQFEKQEEKADRKLTGDWTWLIPPISPAATHIFHRHYDNTIVKPNYFYQEKPYHGTERA
>NZ_CP040747.1|WP_025206917.1|786365_786791_+|hypothetical-protein
MKKMTLLIFLAVFSFNGFLPLGDERAKATTGAMVQNDIDLKVTTDRSTYTSLHPQVNVNMTAITNETLYYTAAIRKLTFPVTPVFTHEGSISGQNAFAAPTRLLLPNSGSVNYDVHVSLYKDASRTTLIGYYVANPFTVVK
>NZ_CP040747.1|WP_057078335.1|786805_787078_-|acylphosphatase
MVHYHAIVKGRVQGVGFRYFVQGEAVNRGMKGWVRNTDEGHVELKVEGEQQEVFDFLETVRKGSPFSKVTHLDMEPLTKFAHYQDFRIKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP040747_1	1.1\|776371\|31\|NZ_CP040747\|PILER-CR	776371-776401	31	NZ_CP040747.1	776538-776568	1	0.968
NZ_CP040747_1	1.2\|776458\|31\|NZ_CP040747\|PILER-CR	776458-776488	31	NZ_CP040747.1	776538-776568	1	0.968

1. spacer 1.1|776371|31|NZ_CP040747|PILER-CR matches to position: 776538-776568, mismatch: 1, identity: 0.968

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
gaacaggtgccacgggagcaaccggtgcaac	Protospacer
*******.***********************

2. spacer 1.2|776458|31|NZ_CP040747|PILER-CR matches to position: 776538-776568, mismatch: 1, identity: 0.968

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
gaacaggtgccacgggagcaaccggtgcaac	Protospacer
*******.***********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040747_1	1.1\|776371\|31\|NZ_CP040747\|PILER-CR	776371-776401	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531071-531101	6	0.806
NZ_CP040747_1	1.1\|776371\|31\|NZ_CP040747\|PILER-CR	776371-776401	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531179-531209	6	0.806
NZ_CP040747_1	1.1\|776371\|31\|NZ_CP040747\|PILER-CR	776371-776401	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531287-531317	6	0.806
NZ_CP040747_1	1.1\|776371\|31\|NZ_CP040747\|PILER-CR	776371-776401	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531503-531533	6	0.806
NZ_CP040747_1	1.1\|776371\|31\|NZ_CP040747\|PILER-CR	776371-776401	31	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	126-156	6	0.806
NZ_CP040747_1	1.1\|776371\|31\|NZ_CP040747\|PILER-CR	776371-776401	31	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	553196-553226	6	0.806
NZ_CP040747_1	1.1\|776371\|31\|NZ_CP040747\|PILER-CR	776371-776401	31	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	648033-648063	6	0.806
NZ_CP040747_1	1.2\|776458\|31\|NZ_CP040747\|PILER-CR	776458-776488	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531071-531101	6	0.806
NZ_CP040747_1	1.2\|776458\|31\|NZ_CP040747\|PILER-CR	776458-776488	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531179-531209	6	0.806
NZ_CP040747_1	1.2\|776458\|31\|NZ_CP040747\|PILER-CR	776458-776488	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531287-531317	6	0.806
NZ_CP040747_1	1.2\|776458\|31\|NZ_CP040747\|PILER-CR	776458-776488	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531503-531533	6	0.806
NZ_CP040747_1	1.2\|776458\|31\|NZ_CP040747\|PILER-CR	776458-776488	31	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	126-156	6	0.806
NZ_CP040747_1	1.2\|776458\|31\|NZ_CP040747\|PILER-CR	776458-776488	31	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	553196-553226	6	0.806
NZ_CP040747_1	1.2\|776458\|31\|NZ_CP040747\|PILER-CR	776458-776488	31	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	648033-648063	6	0.806
NZ_CP040747_1	1.1\|776371\|31\|NZ_CP040747\|PILER-CR	776371-776401	31	MN694114	Marine virus AFVG_250M252, complete genome	19687-19717	7	0.774
NZ_CP040747_1	1.2\|776458\|31\|NZ_CP040747\|PILER-CR	776458-776488	31	MN694114	Marine virus AFVG_250M252, complete genome	19687-19717	7	0.774
NZ_CP040747_1	1.1\|776371\|31\|NZ_CP040747\|PILER-CR	776371-776401	31	NZ_CP034331	Tabrizicola piscis strain K13M18 plasmid unnamed3, complete sequence	1409-1439	9	0.71
NZ_CP040747_1	1.1\|776371\|31\|NZ_CP040747\|PILER-CR	776371-776401	31	NZ_CP027170	Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence	63973-64003	9	0.71
NZ_CP040747_1	1.1\|776371\|31\|NZ_CP040747\|PILER-CR	776371-776401	31	NZ_CP029094	Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence	294972-295002	9	0.71
NZ_CP040747_1	1.1\|776371\|31\|NZ_CP040747\|PILER-CR	776371-776401	31	NZ_CP041223	Porphyrobacter sp. YT40 plasmid pYT40, complete sequence	27600-27630	9	0.71
NZ_CP040747_1	1.2\|776458\|31\|NZ_CP040747\|PILER-CR	776458-776488	31	NZ_CP034331	Tabrizicola piscis strain K13M18 plasmid unnamed3, complete sequence	1409-1439	9	0.71
NZ_CP040747_1	1.2\|776458\|31\|NZ_CP040747\|PILER-CR	776458-776488	31	NZ_CP027170	Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence	63973-64003	9	0.71
NZ_CP040747_1	1.2\|776458\|31\|NZ_CP040747\|PILER-CR	776458-776488	31	NZ_CP029094	Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence	294972-295002	9	0.71
NZ_CP040747_1	1.2\|776458\|31\|NZ_CP040747\|PILER-CR	776458-776488	31	NZ_CP041223	Porphyrobacter sp. YT40 plasmid pYT40, complete sequence	27600-27630	9	0.71

1. spacer 1.1|776371|31|NZ_CP040747|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

2. spacer 1.1|776371|31|NZ_CP040747|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

3. spacer 1.1|776371|31|NZ_CP040747|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

4. spacer 1.1|776371|31|NZ_CP040747|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

5. spacer 1.1|776371|31|NZ_CP040747|PILER-CR matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

6. spacer 1.1|776371|31|NZ_CP040747|PILER-CR matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

7. spacer 1.1|776371|31|NZ_CP040747|PILER-CR matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

8. spacer 1.2|776458|31|NZ_CP040747|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

9. spacer 1.2|776458|31|NZ_CP040747|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

10. spacer 1.2|776458|31|NZ_CP040747|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

11. spacer 1.2|776458|31|NZ_CP040747|PILER-CR matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

12. spacer 1.2|776458|31|NZ_CP040747|PILER-CR matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

13. spacer 1.2|776458|31|NZ_CP040747|PILER-CR matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

14. spacer 1.2|776458|31|NZ_CP040747|PILER-CR matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 6, identity: 0.806

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgaccggcgccacaggagcaaccggtgatac	Protospacer
 .** ********.*************  **

15. spacer 1.1|776371|31|NZ_CP040747|PILER-CR matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 7, identity: 0.774

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgcagggcgcaacgggagcaaccggcgcaac	Protospacer
 .  .***** **************.*****

16. spacer 1.2|776458|31|NZ_CP040747|PILER-CR matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 7, identity: 0.774

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
cgcagggcgcaacgggagcaaccggcgcaac	Protospacer
 .  .***** **************.*****

17. spacer 1.1|776371|31|NZ_CP040747|PILER-CR matches to NZ_CP034331 (Tabrizicola piscis strain K13M18 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tctccggcgtcacgggagcaaccggagccgt	Protospacer
   * ****.*************** ** ..

18. spacer 1.1|776371|31|NZ_CP040747|PILER-CR matches to NZ_CP027170 (Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tttctggcgtcacgggagcaaccggggccgt	Protospacer
   * ****.*************** ** ..

19. spacer 1.1|776371|31|NZ_CP040747|PILER-CR matches to NZ_CP029094 (Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tttctggcgtcacgggagcaaccggggccgt	Protospacer
   * ****.*************** ** ..

20. spacer 1.1|776371|31|NZ_CP040747|PILER-CR matches to NZ_CP041223 (Porphyrobacter sp. YT40 plasmid pYT40, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tttctggcgtcacgggagcaaccggagccgt	Protospacer
   * ****.*************** ** ..

21. spacer 1.2|776458|31|NZ_CP040747|PILER-CR matches to NZ_CP034331 (Tabrizicola piscis strain K13M18 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tctccggcgtcacgggagcaaccggagccgt	Protospacer
   * ****.*************** ** ..

22. spacer 1.2|776458|31|NZ_CP040747|PILER-CR matches to NZ_CP027170 (Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tttctggcgtcacgggagcaaccggggccgt	Protospacer
   * ****.*************** ** ..

23. spacer 1.2|776458|31|NZ_CP040747|PILER-CR matches to NZ_CP029094 (Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tttctggcgtcacgggagcaaccggggccgt	Protospacer
   * ****.*************** ** ..

24. spacer 1.2|776458|31|NZ_CP040747|PILER-CR matches to NZ_CP041223 (Porphyrobacter sp. YT40 plasmid pYT40, complete sequence) position: , mismatch: 9, identity: 0.71

gaacaggcgccacgggagcaaccggtgcaac	CRISPR spacer
tttctggcgtcacgggagcaaccggagccgt	Protospacer
   * ****.*************** ** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

22177 : 30891

uncultured_Mediterranean_phage(16.67%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008342028.1\|22177_23452_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.7e-95	50.1
WP_008342025.1\|23553_24381_+	chemotaxis sensory transducer	A0A2H4J162	uncultured_Caudovirales_phage	7.1e-10	54.4
WP_024719578.1\|24690_25350_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	1.1e-21	33.2
WP_017366700.1\|25346_25970_-	deoxynucleoside kinase	A0A1G5SAJ8	Enterococcus_phage	2.0e-12	28.8
WP_138824853.1\|26049_27351_-	LysM peptidoglycan-binding domain-containing protein	A0A2P1CIG4	Microbacterium_phage	1.4e-07	34.8
WP_060831987.1\|27396_27951_-	cysteine hydrolase	NA	NA	NA	NA
WP_008342015.1\|28030_28507_+	nucleoside deaminase	NA	NA	NA	NA
WP_065461502.1\|29178_30891_+	DNA polymerase III subunit gamma/tau	D9ZNI9	Clostridium_phage	6.8e-55	34.4

DBSCAN-SWA_2

592748 : 669330

uncultured_Caudovirales_phage(40.82%)

terminase,portal,tail,protease,holin,integrase,head,tRNA,coat

attL 593653:593667|attR 621997:622011

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046527695.1\|592748_593225_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_035703483.1\|593205_593895_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
593653:593667	attL	NA	NA	NA	NA
WP_008344382.1\|593920_594349_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_019743791.1\|594341_595370_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	2.7e-67	42.7
WP_046527001.1\|595844_597767_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.8e-56	28.9
WP_008344376.1\|597905_598397_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_008355687.1\|598412_599066_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_008344374.1\|599093_599273_+	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_090756407.1\|599279_600044_+	twin-arginine translocase subunit TatC	NA	NA	NA	NA
WP_138825150.1\|600083_600710_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_017366710.1\|600767_600962_-	YdiK family protein	NA	NA	NA	NA
WP_008344365.1\|600958_601693_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003214120.1\|601922_602207_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	3.7e-19	50.5
WP_007496015.1\|602263_603898_+	chaperonin GroEL	A0A240F779	uncultured_virus	2.6e-157	55.2
WP_138825152.1\|603974_605183_-\|integrase	tyrosine-type recombinase/integrase	S6C485	Thermus_phage	2.8e-87	44.7
WP_138825154.1\|605196_605670_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_136945033.1\|606180_606744_-	DUF4352 domain-containing protein	A0A2H4PQN2	Staphylococcus_phage	4.7e-29	48.9
WP_138825156.1\|607042_607414_-	helix-turn-helix domain-containing protein	A0A0B5CYL9	Listeria_phage	1.1e-10	36.8
WP_138825158.1\|607582_607825_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_007496139.1\|607836_608142_+	hypothetical protein	A0A2H4JDL0	uncultured_Caudovirales_phage	1.1e-13	42.6
WP_138825160.1\|608138_608885_+	phage regulatory protein	A0A2H4J4N4	uncultured_Caudovirales_phage	3.5e-125	94.0
WP_138825162.1\|608943_609513_+	helix-turn-helix domain-containing protein	A0A2H4J884	uncultured_Caudovirales_phage	2.1e-82	80.4
WP_138825164.1\|609509_609788_+	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	4.0e-34	83.7
WP_138825166.1\|609993_610173_+	hypothetical protein	A0A2H4JCC7	uncultured_Caudovirales_phage	2.3e-27	98.3
WP_138825168.1\|610174_611125_+	hypothetical protein	A0A2H4JA52	uncultured_Caudovirales_phage	6.4e-172	97.5
WP_138825170.1\|611124_611964_+	recombinase RecT	A0A2H4JCY8	uncultured_Caudovirales_phage	1.4e-151	97.1
WP_106030331.1\|611941_612121_+	hypothetical protein	A0A2P1JTZ9	Anoxybacillus_phage	4.7e-12	60.0
WP_138825172.1\|612125_612785_+	DnaD domain protein	A0A2H4J6G9	uncultured_Caudovirales_phage	3.8e-75	75.5
WP_138825174.1\|612687_613620_+	ATP-binding protein	A6XMI1	Bacillus_virus	2.0e-40	38.2
WP_138825176.1\|613891_614338_+	hypothetical protein	S5MUL4	Brevibacillus_phage	2.0e-22	40.8
WP_138825178.1\|614452_614743_+	hypothetical protein	A0A2H4J4P5	uncultured_Caudovirales_phage	4.2e-42	83.0
WP_138825180.1\|614732_615188_+	DUF1064 domain-containing protein	A0A2H4J891	uncultured_Caudovirales_phage	9.4e-73	94.0
WP_138825182.1\|615530_615737_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	6.7e-26	87.7
WP_138825184.1\|615754_616006_+	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	3.2e-30	83.1
WP_138825186.1\|616033_616495_+	hypothetical protein	NA	NA	NA	NA
WP_138825188.1\|616511_616895_+	hypothetical protein	A0A2H4J4Q6	uncultured_Caudovirales_phage	3.1e-61	89.2
WP_138825190.1\|617054_617534_+	hypothetical protein	A0A2H4JDM6	uncultured_Caudovirales_phage	1.2e-70	89.4
WP_138825192.1\|617549_617960_+	hypothetical protein	A0A2H4J8A0	uncultured_Caudovirales_phage	1.2e-10	38.3
WP_138825194.1\|617956_618193_+	hypothetical protein	NA	NA	NA	NA
WP_138825196.1\|618189_618438_+	hypothetical protein	A0A2H4J4N6	uncultured_Caudovirales_phage	1.9e-35	82.9
WP_138825198.1\|618442_618625_+	hypothetical protein	NA	NA	NA	NA
WP_138825200.1\|618981_619470_+	Fis family transcriptional regulator	A0A2H4J6J3	uncultured_Caudovirales_phage	2.4e-66	80.9
WP_138825202.1\|619473_619929_+	sigma-70 family RNA polymerase sigma factor	A0A2H4J4R7	uncultured_Caudovirales_phage	2.0e-78	94.0
WP_138825205.1\|620083_620413_+	hypothetical protein	NA	NA	NA	NA
WP_138825207.1\|620549_620987_+\|terminase	terminase small subunit	S5MA50	Brevibacillus_phage	7.2e-46	65.7
WP_138825209.1\|620973_622278_+\|terminase	PBSX family phage terminase large subunit	Q4ZCF2	Staphylococcus_virus	4.4e-155	63.3
621997:622011	attR	NA	NA	NA	NA
WP_138825211.1\|622274_622550_+	hypothetical protein	NA	NA	NA	NA
WP_138825213.1\|622552_624007_+\|portal	phage portal protein	A0A1Q1PVT0	Bacillus_phage	1.9e-122	49.5
WP_138825215.1\|623993_624914_+\|head	phage head morphogenesis protein	A0A1Q1PVS4	Bacillus_phage	2.1e-71	47.5
WP_138825217.1\|624917_625166_+	hypothetical protein	NA	NA	NA	NA
WP_138825219.1\|625188_625425_+	hypothetical protein	NA	NA	NA	NA
WP_138825221.1\|625574_626240_+	scaffolding protein	A0A1Z1LZK8	Bacillus_phage	1.1e-13	34.8
WP_111927146.1\|626252_627239_+\|coat	coat protein	D2J006	Enterococcus_phage	3.0e-47	37.2
WP_080673871.1\|627198_627501_+	fibronectin type III domain-containing protein	Q0PDK9	Bacillus_phage	1.0e-22	64.2
WP_110487464.1\|627501_627696_+	hypothetical protein	NA	NA	NA	NA
WP_138825223.1\|627700_627997_+	hypothetical protein	Q4ZC67	Staphylococcus_virus	1.0e-11	38.0
WP_138825225.1\|627990_628332_+\|head	phage head closure protein	NA	NA	NA	NA
WP_138825227.1\|628324_628744_+	HK97 gp10 family phage protein	O48447	Bacillus_phage	3.6e-34	53.7
WP_017360256.1\|628759_629158_+	DUF3168 domain-containing protein	W8EK61	Geobacillus_phage	4.9e-25	43.1
WP_111289986.1\|629171_629693_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_138826830.1\|629640_629955_+	fibronectin type III domain-containing protein	Q0PDK9	Bacillus_phage	4.1e-27	69.8
WP_138825229.1\|630023_630533_+	hypothetical protein	A0A1W6JQN4	Staphylococcus_phage	9.1e-16	36.1
WP_138825231.1\|630550_630859_+	hypothetical protein	NA	NA	NA	NA
WP_138825233.1\|630863_636068_+	hypothetical protein	A8ATV9	Listeria_phage	3.2e-31	44.4
WP_138825235.1\|636064_636832_+\|tail	phage tail family protein	NA	NA	NA	NA
WP_138825236.1\|636846_640137_+	hypothetical protein	Q5YA57	Bacillus_phage	2.2e-131	48.2
WP_138825239.1\|640153_640567_+	hypothetical protein	NA	NA	NA	NA
WP_138825241.1\|640668_640878_+	hypothetical protein	NA	NA	NA	NA
WP_138825244.1\|640942_641221_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	7.8e-38	88.0
WP_138825246.1\|641240_641504_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.2e-26	70.1
WP_138825248.1\|641557_642364_+	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	7.5e-65	71.3
WP_138825251.1\|642552_643017_+	hypothetical protein	NA	NA	NA	NA
WP_138825253.1\|643187_643523_-	YolD-like family protein	O64030	Bacillus_phage	7.6e-11	38.7
WP_007496981.1\|644219_644672_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_138825255.1\|644694_645306_+	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
WP_138825257.1\|645341_646220_-	SH3 domain-containing protein	NA	NA	NA	NA
WP_007496975.1\|646427_646850_+	hypothetical protein	NA	NA	NA	NA
WP_138825259.1\|646898_647249_-	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	1.8e-26	58.3
WP_100325609.1\|647386_647854_-	hypothetical protein	NA	NA	NA	NA
WP_138825261.1\|648175_648850_-	hypothetical protein	NA	NA	NA	NA
WP_003213878.1\|649060_649429_+	hypothetical protein	NA	NA	NA	NA
WP_138825263.1\|649502_650552_+	hypothetical protein	NA	NA	NA	NA
WP_007496965.1\|650770_651145_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_138825265.1\|651412_652942_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_024719380.1\|653039_654428_-	GABA permease	NA	NA	NA	NA
WP_025206838.1\|654910_655810_+	cation transporter	NA	NA	NA	NA
WP_017366721.1\|655912_656875_+	MoxR family ATPase	NA	NA	NA	NA
WP_025206839.1\|656871_658062_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_056705771.1\|658073_660272_+	DUF4129 domain-containing protein	NA	NA	NA	NA
WP_017359841.1\|660456_661998_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	3.4e-21	29.9
WP_138825267.1\|662097_662583_-	YbaK/EbsC family protein	NA	NA	NA	NA
WP_138825269.1\|662598_663681_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_138825271.1\|663681_665343_-	2-isopropylmalate synthase	NA	NA	NA	NA
WP_138825273.1\|666072_666945_+	helix-turn-helix domain-containing protein	A0A1B0RXG1	Streptococcus_phage	8.9e-11	35.6
WP_008344332.1\|666958_667531_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_138825275.1\|667647_668580_-	hypothetical protein	NA	NA	NA	NA
WP_039962697.1\|668601_669330_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

681683 : 691579

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_138825287.1\|681683_682979_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.5e-18	26.9
WP_007496901.1\|683051_683774_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.8e-46	43.7
WP_003214349.1\|683766_684021_+	phosphoribosylformylglycinamidine synthase subunit PurS	A0A0E3FKD5	Synechococcus_phage	1.2e-05	33.3
WP_017359821.1\|684017_684701_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_008344291.1\|684684_686916_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	2.9e-159	42.0
WP_017359819.1\|686891_688322_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.3e-51	32.9
WP_017366751.1\|688418_689459_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.1e-65	43.8
WP_056705691.1\|689455_690025_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.9e-31	39.5
WP_138825289.1\|690040_691579_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	4.8e-76	51.8

DBSCAN-SWA_4

1693077 : 1699326

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017359034.1\|1693077_1693470_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	8.8e-27	56.5
WP_017359033.1\|1693429_1695532_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	82.8
WP_008344010.1\|1695549_1696530_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	4.2e-150	80.6
WP_046343578.1\|1696614_1697232_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.7e-45	45.3
WP_138825793.1\|1697287_1698046_-	N-acetylmuramoyl-L-alanine amidase	A0T2N4	Geobacillus_phage	5.8e-51	48.7
WP_008344008.1\|1698366_1699326_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	3.9e-52	39.6

DBSCAN-SWA_5

2056493 : 2064201

Ostreococcus_lucimarinus_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017359757.1\|2056493_2057585_-	3-dehydroquinate synthase	E5ERI4	Ostreococcus_lucimarinus_virus	3.1e-21	27.2
WP_138825992.1\|2057584_2058757_-	chorismate synthase	A0A291AU41	Pandoravirus	3.4e-42	35.2
WP_138825994.1\|2058833_2059610_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_003216015.1\|2059754_2060201_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	1.5e-27	42.3
WP_007500951.1\|2060330_2061293_-	heptaprenyl diphosphate synthase component II	A0A1V0SE37	Indivirus	1.7e-07	26.0
WP_007500957.1\|2061317_2062022_-	demethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_007500958.1\|2062025_2062793_-	heptaprenyl diphosphate synthase component 1	NA	NA	NA	NA
WP_008344541.1\|2062908_2063139_-	trp RNA-binding attenuation protein MtrB	NA	NA	NA	NA
WP_003215789.1\|2063162_2063732_-	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	1.8e-49	57.3
WP_003215863.1\|2063922_2064201_-	non-specific DNA-binding protein Hbs	A7KV42	Bacillus_phage	5.6e-28	74.2

DBSCAN-SWA_6

2102260 : 2108646

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_138826018.1\|2102260_2103412_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.4e-24	37.7
WP_017359783.1\|2103526_2104006_-	DUF3907 family protein	NA	NA	NA	NA
WP_008344462.1\|2104119_2104713_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	9.0e-15	36.0
WP_007501021.1\|2104702_2105461_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	6.5e-10	36.8
WP_008359694.1\|2105672_2105765_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_035391617.1\|2105853_2106378_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_007501029.1\|2106402_2106756_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_007501031.1\|2106869_2107334_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	2.1e-43	66.0
WP_017359786.1\|2107360_2107984_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	2.6e-57	58.6
WP_052320973.1\|2107995_2108646_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.7e-41	40.8

DBSCAN-SWA_7

2749279 : 2774049

Bacillus_phage(26.09%)

terminase,plate,portal,tail,holin,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_138826327.1\|2749279_2750101_-	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	8.8e-61	68.3
WP_008361671.1\|2750120_2750384_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	5.9e-27	69.0
WP_008344062.1\|2750396_2750609_-	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.0e-13	56.5
WP_138826862.1\|2750667_2750808_-	XkdX family protein	NA	NA	NA	NA
WP_039963887.1\|2750807_2751182_-	hypothetical protein	M4ZR44	Bacillus_phage	9.3e-10	39.8
WP_138826329.1\|2751187_2752312_-	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	7.1e-37	61.7
WP_116306108.1\|2752329_2752713_-	hypothetical protein	NA	NA	NA	NA
WP_138826331.1\|2752724_2753648_-	DUF2313 domain-containing protein	A0A0A7RTT8	Clostridium_phage	2.7e-10	27.8
WP_138826333.1\|2753634_2754681_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	8.6e-69	43.2
WP_024719684.1\|2754673_2755096_-	DUF2634 domain-containing protein	NA	NA	NA	NA
WP_017358996.1\|2755110_2755377_-	DUF2577 family protein	S6C459	Thermus_phage	4.7e-08	37.5
WP_138826335.1\|2755373_2756384_-\|portal	phage portal protein	H7BV96	unidentified_phage	3.0e-34	28.2
WP_007500584.1\|2756395_2757064_-	LysM peptidoglycan-binding domain-containing protein	A0A0K2SUI2	Clostridium_phage	2.9e-22	29.6
WP_138826337.1\|2757056_2761049_-	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	6.2e-43	42.3
WP_138826864.1\|2761104_2761242_-	hypothetical protein	NA	NA	NA	NA
WP_008344099.1\|2761283_2761724_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.7e-10	35.8
WP_074041930.1\|2761875_2761965_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_003213309.1\|2762242_2762686_-\|tail	phage tail tube protein	A0A0A7RVP1	Clostridium_phage	7.6e-27	46.5
WP_041091932.1\|2762687_2764034_-\|portal	phage portal protein	A0A0A7RTT5	Clostridium_phage	1.3e-77	40.5
WP_008344108.1\|2764037_2764250_-	hypothetical protein	NA	NA	NA	NA
WP_025207872.1\|2764236_2764692_-	hypothetical protein	NA	NA	NA	NA
WP_025207873.1\|2764696_2765194_-	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	5.3e-37	46.2
WP_017367938.1\|2765190_2765547_-	YqbH/XkdH family protein	NA	NA	NA	NA
WP_129547786.1\|2765543_2765927_-	DUF3199 family protein	NA	NA	NA	NA
WP_008344119.1\|2765940_2766864_-\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	3.3e-109	64.3
WP_039169992.1\|2766886_2767978_-\|terminase	terminase	A0A1B1P7E4	Bacillus_phage	3.1e-61	40.9
WP_138826339.1\|2768013_2769471_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.1e-138	53.0
WP_034647736.1\|2769467_2770781_-\|terminase	PBSX family phage terminase large subunit	M4ZRM5	Bacillus_phage	9.2e-153	62.0
WP_007500563.1\|2770777_2771425_-\|terminase	terminase small subunit	A0A2P1JTW4	Anoxybacillus_phage	1.1e-42	44.1
WP_024719695.1\|2771577_2772096_-	sigma-70 family RNA polymerase sigma factor	A0A2H4J6J3	uncultured_Caudovirales_phage	2.0e-34	46.9
WP_008344129.1\|2772220_2772427_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	9.0e-15	68.5
WP_138826341.1\|2772423_2772828_-	holliday junction resolvase	NA	NA	NA	NA
WP_017358978.1\|2772930_2773113_-	hypothetical protein	NA	NA	NA	NA
WP_007500560.1\|2773671_2774049_+	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.6e-17	45.4

DBSCAN-SWA_8

3101101 : 3110108

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_138826488.1\|3101101_3102478_+	peptidase C40	A0A0A0RVE6	Bacillus_phage	1.1e-26	54.3
WP_024719880.1\|3102712_3103663_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	4.8e-87	53.1
WP_008348133.1\|3104020_3104485_+	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
WP_138826490.1\|3104488_3105412_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	4.5e-05	26.3
WP_046527625.1\|3105412_3106372_+	YvcK family protein	A1IMD5	Streptococcus_phage	2.4e-62	40.4
WP_008348125.1\|3106389_3107340_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	4.3e-51	38.1
WP_008348124.1\|3107366_3107624_+	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_138826492.1\|3107662_3108406_+	arylamine N-acetyltransferase	NA	NA	NA	NA
WP_017368105.1\|3108458_3108947_-	ribonuclease	NA	NA	NA	NA
WP_098680737.1\|3109127_3110108_-	D-glycerate dehydrogenase	M1HTA3	Paramecium_bursaria_Chlorella_virus	4.9e-18	26.9

DBSCAN-SWA_9

3354868 : 3403571

Escherichia_phage(25.0%)

coat,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046526741.1\|3354868_3355531_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_008343530.1\|3355638_3355824_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_046526742.1\|3355876_3356695_-	peptidase M84	NA	NA	NA	NA
WP_046526743.1\|3357069_3358398_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_008343536.1\|3358437_3359322_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_046526744.1\|3359472_3360024_+	NADPH-dependent FMN reductase	NA	NA	NA	NA
WP_019743233.1\|3360007_3361033_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_025208152.1\|3361032_3361287_+	glutaredoxin family protein	NA	NA	NA	NA
WP_046526745.1\|3361321_3361885_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_008343545.1\|3361898_3362660_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_099496908.1\|3362677_3363520_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_138826627.1\|3363536_3364247_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_052320439.1\|3364243_3364987_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-33	39.2
WP_024719448.1\|3365091_3365592_-	YwgA family protein	NA	NA	NA	NA
WP_007497716.1\|3365622_3366924_-	HD domain-containing protein	A0A1V0SGM3	Hokovirus	1.6e-24	30.3
WP_003215259.1\|3367094_3367316_-	DUF1450 domain-containing protein	NA	NA	NA	NA
WP_007497717.1\|3367558_3368359_+	RsfA family transcriptional regulator	A0A1D6X8E5	Bacillus_phage	6.0e-06	48.0
WP_008343557.1\|3368394_3368628_-	hypothetical protein	NA	NA	NA	NA
WP_138826629.1\|3368624_3370901_-	glycosyltransferase	NA	NA	NA	NA
WP_138826631.1\|3371004_3371490_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_008343563.1\|3371529_3372375_-	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_017368244.1\|3372608_3373004_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_024719453.1\|3373036_3373312_-	hypothetical protein	NA	NA	NA	NA
WP_138826633.1\|3373377_3373650_-	hypothetical protein	NA	NA	NA	NA
WP_017360093.1\|3373678_3374041_-	hypothetical protein	NA	NA	NA	NA
WP_138826635.1\|3374056_3375727_-\|transposase	transposase	NA	NA	NA	NA
WP_008343583.1\|3375738_3376017_-	YwqI/YxiC family protein	NA	NA	NA	NA
WP_138826637.1\|3376021_3376420_-	DUF5082 family protein	NA	NA	NA	NA
WP_046526753.1\|3376594_3376861_-	hypothetical protein	NA	NA	NA	NA
WP_007497735.1\|3376874_3378209_-	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_138826639.1\|3378252_3379131_-	prephenate dehydrogenase/arogenate dehydrogenase family protein	NA	NA	NA	NA
WP_017360099.1\|3379142_3379814_-	S-adenosylmethionine--2-demethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_052320446.1\|3379956_3380808_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_008343597.1\|3380944_3381916_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_017360102.1\|3382155_3382926_+	heme-dependent peroxidase	NA	NA	NA	NA
WP_017360103.1\|3382993_3384154_+	MFS transporter	NA	NA	NA	NA
WP_008343601.1\|3384169_3384649_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_039963017.1\|3384794_3386027_+	MFS transporter	NA	NA	NA	NA
WP_081114236.1\|3386176_3386782_+	bacilysin biosynthesis protein BacA	NA	NA	NA	NA
WP_065461270.1\|3386783_3387491_+	cupin domain-containing protein	NA	NA	NA	NA
WP_008343608.1\|3387487_3388249_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	8.5e-26	33.5
WP_138826641.1\|3388263_3389691_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_138826643.1\|3389705_3390902_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_058213479.1\|3390917_3391715_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_008343612.1\|3391801_3392257_-\|coat	spore coat protein	NA	NA	NA	NA
WP_008343613.1\|3392249_3393104_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	3.3e-34	36.8
WP_058213477.1\|3393107_3394073_-	dTDP-glucose 4,6-dehydratase	K7QJG5	Escherichia_phage	5.5e-78	45.6
WP_138826645.1\|3394069_3394810_-	NTP transferase domain-containing protein	G3MA50	Bacillus_virus	1.4e-44	41.2
WP_017368265.1\|3394812_3395841_-\|coat	spore coat protein	NA	NA	NA	NA
WP_017360114.1\|3395837_3396578_-	glycosyltransferase family protein	NA	NA	NA	NA
WP_138826647.1\|3396567_3397692_-\|coat	spore coat protein	A0A1B1IVE2	uncultured_Mediterranean_phage	5.8e-23	29.9
WP_138826649.1\|3397693_3398569_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_138826651.1\|3398565_3399744_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_138826653.1\|3399765_3401178_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_123766730.1\|3401184_3401964_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_008343625.1\|3402130_3402805_+	hypothetical protein	NA	NA	NA	NA
WP_007497781.1\|3403028_3403571_+\|coat	spore coat protein GerQ	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage