CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP022577	Mycobacterium tuberculosis strain WC078 chromosome, complete genome	16 crisprs	cas3,c2c9_V-U4,cas6,cas10,csm2gr11,csm3gr7,csa3,DEDDh,cas4,WYL,DinG	15	53	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022577_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_1

575654-576801

TypeIII

II-B,III-A

Consensus_repeat	Method
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CRT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	PILER-CR
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CRISPRCasFinder

15 spacers

csm3gr7,csm2gr11,cas10,cas6

The CRISPR arrays of NZ_CP022577_1

>merge|NZ_CP022577|1|575654-576801|CRT,PILER-CR,CRISPRCasFinder
GGACATGCCGGGGCGGTTCAGAGAGGGGACGGAAACCTGCATCCGGAAAGTCCGTACGCTCGAAACGCTTCCAACGTGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACTCGAAATCCAGCACCACATCCGCAGCTGCGGCATGCTCCCGAAGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACGCGAGGAACCGTCCCACCTGGGCCTGCCCCCAGCGGGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACTCAATAACACTTTTTTTGAGCGTGGCGCGGTTGAGAGTGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACACGGAAACGCAGCACCAGCCTGACAATCTTATTCTCGCGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACATTTTGAGCGCGAACTCGTCCACAGTCCCCCTTTCAGGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACGCCCCGTGGATGGCGGATGCGTTGTGCGCGCAAGTGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACCCGACGATGGCCAGTAAATCGGCGTGGGTAACCGATCCGGGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACTAGTACGCCATCTGTGCCTCATACAGGTCCAGTGCCCTGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACCTGACGGCACGGAGCTTTCCGGCTTCTATCAGGTAGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACCCTCATGGTGGGACATGGACGAGCGCGACTATCGGGGTCGTCGGACCCAAAACCCCGAGAGGGGACGGAAACTGGACGCAGAATCGCACCGGGTGCGGGAGGTGCAGCAGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAACGCATATCGCCCGCCACACCACAGCCACGCTACTGCTCCATGTCCTCAGACCCAAAACCCCGAGAGGGGACGGAAACACACCGCCGATGACAGCTATGTCCGAGTGACATCCTCCCAGTCGTCAGACCCAAAACCACGAGAGGGGACGGAAACTTGAACCGCCCTTCGCGCGGTGTTTCGGCCGTGCCCGAGTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC

>NZ_CP022577|1|1|575654-576801|CRT
GGACATGCCGGGGCGGTTCAGAGAGGGGACGGAAAC	CTGCATCCGGAAAGTCCGTACGCTCGAAACGCTTCCAACGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TCGAAATCCAGCACCACATCCGCAGCTGCGGCATGCTCCCGAA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCGAGGAACCGTCCCACCTGGGCCTGCCCCCAGCGG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TCAATAACACTTTTTTTGAGCGTGGCGCGGTTGAGAGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ACGGAAACGCAGCACCAGCCTGACAATCTTATTCTCGC
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ATTTTGAGCGCGAACTCGTCCACAGTCCCCCTTTCAG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCCCCGTGGATGGCGGATGCGTTGTGCGCGCAAGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CCGACGATGGCCAGTAAATCGGCGTGGGTAACCGATCCGG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TAGTACGCCATCTGTGCCTCATACAGGTCCAGTGCCCT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CTGACGGCACGGAGCTTTCCGGCTTCTATCAGGTA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CCTCATGGTGGGACATGGACGAGCGCGACTATCGGG
GTCGTCGGACCCAAAACCCCGAGAGGGGACGGAAAC	TGGACGCAGAATCGCACCGGGTGCGGGAGGTGCAGCA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCATATCGCCCGCCACACCACAGCCACGCTACTGCTCCAT
GTCCTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ACACCGCCGATGACAGCTATGTCCGAGTGACATCCTCCCA
GTCGTCAGACCCAAAACCACGAGAGGGGACGGAAAC	TTGAACCGCCCTTCGCGCGGTGTTTCGGCCGTGCCCGA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC

>NZ_CP022577|1|1|575731-576801|PILER-CR
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TCGAAATCCAGCACCACATCCGCAGCTGCGGCATGCTCCCGAA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCGAGGAACCGTCCCACCTGGGCCTGCCCCCAGCGG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TCAATAACACTTTTTTTGAGCGTGGCGCGGTTGAGAGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ACGGAAACGCAGCACCAGCCTGACAATCTTATTCTCGC
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ATTTTGAGCGCGAACTCGTCCACAGTCCCCCTTTCAG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCCCCGTGGATGGCGGATGCGTTGTGCGCGCAAGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CCGACGATGGCCAGTAAATCGGCGTGGGTAACCGATCCGG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TAGTACGCCATCTGTGCCTCATACAGGTCCAGTGCCCT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CTGACGGCACGGAGCTTTCCGGCTTCTATCAGGTA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CCTCATGGTGGGACATGGACGAGCGCGACTATCGGG
GTCGTCGGACCCAAAACCCCGAGAGGGGACGGAAAC	TGGACGCAGAATCGCACCGGGTGCGGGAGGTGCAGCA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCATATCGCCCGCCACACCACAGCCACGCTACTGCTCCAT
GTCCTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ACACCGCCGATGACAGCTATGTCCGAGTGACATCCTCCCA
GTCGTCAGACCCAAAACCACGAGAGGGGACGGAAAC	TTGAACCGCCCTTCGCGCGGTGTTTCGGCCGTGCCCGA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC

>NZ_CP022577|1|1|575731-576801|CRISPRCasFinder
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TCGAAATCCAGCACCACATCCGCAGCTGCGGCATGCTCCCGAA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCGAGGAACCGTCCCACCTGGGCCTGCCCCCAGCGG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TCAATAACACTTTTTTTGAGCGTGGCGCGGTTGAGAGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ACGGAAACGCAGCACCAGCCTGACAATCTTATTCTCGC
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ATTTTGAGCGCGAACTCGTCCACAGTCCCCCTTTCAG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCCCCGTGGATGGCGGATGCGTTGTGCGCGCAAGT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CCGACGATGGCCAGTAAATCGGCGTGGGTAACCGATCCGG
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	TAGTACGCCATCTGTGCCTCATACAGGTCCAGTGCCCT
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CTGACGGCACGGAGCTTTCCGGCTTCTATCAGGTA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	CCTCATGGTGGGACATGGACGAGCGCGACTATCGGG
GTCGTCGGACCCAAAACCCCGAGAGGGGACGGAAAC	TGGACGCAGAATCGCACCGGGTGCGGGAGGTGCAGCA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	GCATATCGCCCGCCACACCACAGCCACGCTACTGCTCCAT
GTCCTCAGACCCAAAACCCCGAGAGGGGACGGAAAC	ACACCGCCGATGACAGCTATGTCCGAGTGACATCCTCCCA
GTCGTCAGACCCAAAACCACGAGAGGGGACGGAAAC	TTGAACCGCCCTTCGCGCGGTGTTTCGGCCGTGCCCGA
GTCGTCAGACCCAAAACCCCGAGAGGGGACGGAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003414184.1\|582526_582718_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003414181.1\|582714_583119_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003414414.1\|566757_567645_+\|type-IV-toxin-antitoxin-system-AbiEi-family-antitoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|370470
NZ_CP022577.1\|WP_014584866.1\|568803_569349_+\|DUF1802-family-protein	unknown	unknown	gnl\|CDD\|226743
NZ_CP022577.1\|WP_003414489.1\|565641_565911_+\|DUF2277-family-protein	unknown	unknown	gnl\|CDD\|227839
NZ_CP022577.1\|WP_003414296.1\|572902_573277_+\|type-III-A-CRISPR-associated-protein-Csm2	csm2gr11	cd09647_csm2gr11_CAS-III-A	gnl\|CDD\|273844
NZ_CP022577.1\|WP_003414195.1\|579238_579847_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003899491.1\|576949_577762_-\|ExeA-family-protein	unknown	unknown	gnl\|CDD\|225806
NZ_CP022577.1\|WP_003912014.1\|569748_570471_+\|CRISPR-associated-endoribonuclease-Cas6	cas6	COG5551_cas6_CAS-III	gnl\|CDD\|227838
NZ_CP022577.1\|WP_003900580.1\|570467_572906_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	cas10	COG1353_cas10_CAS-III	gnl\|CDD\|187811
NZ_CP022577.1\|WP_106420767.1\|567647_568532_+\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	unknown	unknown	gnl\|CDD\|225162
NZ_CP022577.1\|WP_003414198.1\|577758_579168_-\|DDE-type-integrase/transposase/recombinase	unknown	unknown	gnl\|CDD\|366234
NZ_CP022577.1\|WP_003917684.1\|583266_583521_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_087902221.1\|574360_575622_-\|IS3-like-element-IS987-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP022577.1\|WP_003910939.1\|565907_566453_+\|DUF1802-family-protein	unknown	unknown	gnl\|CDD\|226743
NZ_CP022577.1\|WP_003899489.1\|580682_580940_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003899488.1\|581173_582328_-\|DDE-type-integrase/transposase/recombinase	unknown	unknown	gnl\|CDD\|366234
NZ_CP022577.1\|WP_003414292.1\|573286_573997_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	gnl\|CDD\|187815
NZ_CP022577.1\|WP_003414190.1\|580266_580578_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003911993.1\|583696_583972_-\|DUF1778-domain-containing-protein	unknown	unknown	gnl\|CDD\|226860

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003414414.1\|566757_567645_+\|type-IV-toxin-antitoxin-system-AbiEi-family-antitoxin-domain-containing-protein	gnl\|CDD\|370470	pfam09407, AbiEi_1, AbiEi antitoxin C-terminal domain. AbiEi_1 is the cognate antitoxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	2.43998e-38
NZ_CP022577.1\|WP_014584866.1\|568803_569349_+\|DUF1802-family-protein	gnl\|CDD\|226743	COG4293, COG4293, Uncharacterized protein conserved in bacteria [Function unknown].	2.51205e-85
NZ_CP022577.1\|WP_003414489.1\|565641_565911_+\|DUF2277-family-protein	gnl\|CDD\|227839	COG5552, COG5552, Uncharacterized conserved protein [Function unknown].	9.26436e-31
NZ_CP022577.1\|WP_003414296.1\|572902_573277_+\|type-III-A-CRISPR-associated-protein-Csm2	gnl\|CDD\|273844	TIGR01870, CRISPR_type_III-associated_protein_Csm2, CRISPR type III-A/MTUBE-associated protein Csm2. These proteins are found adjacent to a characteristic short, palidromic repeat cluster termed CRISPR, a probable mobile DNA element. This model represents the C-terminal domain of a minor family of CRISPR-associated protein from the Mtube subtype of CRISPR/Cas locus. The family is designated Csm2, for CRISPR/Cas Subtype Mtube Protein 2.	4.56134e-21
NZ_CP022577.1\|WP_003899491.1\|576949_577762_-\|ExeA-family-protein	gnl\|CDD\|225806	COG3267, ExeA, Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion].	3.94464e-110
NZ_CP022577.1\|WP_003912014.1\|569748_570471_+\|CRISPR-associated-endoribonuclease-Cas6	gnl\|CDD\|227838	COG5551, COG5551, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	1.14295e-72
NZ_CP022577.1\|WP_003900580.1\|570467_572906_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	gnl\|CDD\|187811	cd09680, Cas10_III, CRISPR/Cas system-associated protein Cas10. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Multidomain protein with permuted HD nuclease domain, palm domain and Zn-ribbon; signature gene for type III; also known as Csm1 family.	0
NZ_CP022577.1\|WP_106420767.1\|567647_568532_+\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	gnl\|CDD\|225162	COG2253, COG2253, Uncharacterized conserved protein [Function unknown].	2.52052e-105
NZ_CP022577.1\|WP_003414198.1\|577758_579168_-\|DDE-type-integrase/transposase/recombinase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.41102e-28
NZ_CP022577.1\|WP_087902221.1\|574360_575622_-\|IS3-like-element-IS987-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	4.28492e-102
NZ_CP022577.1\|WP_003910939.1\|565907_566453_+\|DUF1802-family-protein	gnl\|CDD\|226743	COG4293, COG4293, Uncharacterized protein conserved in bacteria [Function unknown].	1.22881e-84
NZ_CP022577.1\|WP_003899488.1\|581173_582328_-\|DDE-type-integrase/transposase/recombinase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.94329e-16
NZ_CP022577.1\|WP_003414292.1\|573286_573997_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	gnl\|CDD\|187815	cd09684, Csm3_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	4.36536e-99
NZ_CP022577.1\|WP_003911993.1\|583696_583972_-\|DUF1778-domain-containing-protein	gnl\|CDD\|226860	COG4453, COG4453, Uncharacterized protein conserved in bacteria [Function unknown].	1.95042e-26

>NZ_CP022577.1|WP_087902221.1|574360_575622_-|IS3-like-element-IS987-family-transposase
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASGFLRGRARPASTLITRFIADHQGHREGPDGLRWGVESICTQLTELGVPIAPSTYYDHINREPSRRELRDGELKEHISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLGLSGTTRGKARRTTIADPATARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSERLAEAGIQPSVGAVGSSYDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHRRLYQYCGDVPPVELEAAYYAQRQRPAAG
>NZ_CP022577.1|WP_003414292.1|573286_573997_+|type-III-A-CRISPR-associated-RAMP-protein-Csm3
MTTSYAKIEITGTLTVLTGLQIGAGDGFSAIGAVDKPVVRDPLSRLPMIPGTSLKGKVRTLLSRQYGADTETFYRKPNEDHAHIRRLFGDTEEYMTGRLVFRDTKLTNKDDLEARGAKTLTEVKFENAINRVTAKANLRQMERVIPGSEFAFSLVYEVSFGTPGEEQKASLPSSDEIIEDFNAIARGLKLLELDYLGGSGTRGYGQVKFSNLKARAAVGALDGSLLEKLNHELAAV
>NZ_CP022577.1|WP_003414296.1|572902_573277_+|type-III-A-CRISPR-associated-protein-Csm2
MSVIQDDYVKQAEVIRGLPKKKNGFELTTTQLRVLLSLTAQLFDEAQQSANPTLPRQLKEKVQYLRVRFVYQSGREDAVKTFVRNAKLLEALEGIGDSRDGLLRFCRYMEALAAYKKYLDPKDK
>NZ_CP022577.1|WP_003900580.1|570467_572906_+|type-III-A-CRISPR-associated-protein-Cas10/Csm1
MNPQLIEAIIGCLLHDIGKPVQRAALGYPGRHSAIGRAFMKKVWLRDSRNPSQFTDEVDEADIGVSDRRILDAISYHHSSALRTAAENGRLAADAPAYIAYIADNIAAGTDRRKADSDDGHGASTWDPDTPLYSMFNRFGSGTANLAFAPEMLDDRKPINIPSPRRIEFDKDRYAAIVNKLKAILVDLERSDTYLASLLNVLEATLSFVPSSTDASEVVDVSLFDHLKLTGALGACIWHYLQATGQSDFKSALFDKQDTFYNEKAFLLTTFDVSGIQDFIYTIHSSGAAKMLRARSFYLEMLTEHLIDELLARVGLSRANLNYSGGGHAYLLLPNTESARKSVEQFEREANDWLLENFATRLFIATGSVPLAANDLMRRPNESASQASNRALRYSGLYRELSEQLSAKKLARYSADQLRELNSRDHDGQKGDRECSVCHTVNRTVSADDEPKCSLCQALTAASSQIQSESRRFLLISDGATKGLPLPFGATLTFCSRADADKALQQPQTRRRYAKNKFFAGECLGTGLWVGDYVAQMEFGDYVKRASGIARLGVLRLDVDNLGQAFTHGFMEQGNGKFNTISRTAAFSRMLSLFFRQHINYVLARPKLRPITGDDPARPREATIIYSGGDDVFVVGAWDDVIEFGIELRERFHEFTQGKLTVSAGIGMFPDKYPISVMAREVGDLEDAAKSLPGKNGVALFDREFTFGWDELLSKVIEEKYRHIADYFSGNEERGMAFIYKLLELLAERDDRITKARWVYFLTRMRNPTGDTAPFQQFANRLHQWFQDPTDAKQLKTALHLYIYRTRKEESE
>NZ_CP022577.1|WP_003912014.1|569748_570471_+|CRISPR-associated-endoribonuclease-Cas6
MATLGPHLHGVLMESIPADYVQTLHTVPVNPYSQYALARSTTSLEWKISTLTNEARQQIVGPINDAAFAGFRLRASGIATQVTSRSLEQNPLSQFARIFYARPETRKFRVEFLTPTAFKQSGEYVFWPDPRLVFQSLAQKYGAIVDGEEPDPGLIAEFGQSVRLSAFRVASAPFAVGAARVPGFTGSATFTVRGVDTFASYIAALLWFGEFSGCGIKASMGMGAIRVQPLAPREKCVPKP
>NZ_CP022577.1|WP_014584866.1|568803_569349_+|DUF1802-family-protein
MTPALKEWSAAVHALLDGRQTVLLRKGGIGEKRFEVAAHEFLLFPTVAHSHAERVRPEHRDLLGPAAADSTDECVLLRAAAKVVAALPVNRPEGLDAIEDLHIWTAESVRADRLDFRPKHKLAVLVVCAIPLAEPVRLARRPEYGGCTSWVQLPVTPTLAAPVHDEAALAEVAARVREAVG
>NZ_CP022577.1|WP_106420767.1|567647_568532_+|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein
MAGLTRALVARHALGRAEAYDAALLDVAQDHLLYLLSQTVQFGDNRLVFKGGTSLRKCRLGNVGRFSTDLDFSAPDDEVVLEVCELIDGARVGGFEFGVQSTRGDGRHWQLRVRHTELGEPRIVASVEFARRPLALPSELLAFIQLPIHKAYGFGLPTLPVVAEAEACAEKIARYRRVALARDLYDLNHFASRTIDEPLVRRLWVLKVWGDVVDDRRGTRPLRVEDVLAARSEHDFQPDSIGVLTRPVAMAAWEARVRKRFAFLTDLDADEQRWAACDERHRREVENALAVLRS
>NZ_CP022577.1|WP_003414414.1|566757_567645_+|type-IV-toxin-antitoxin-system-AbiEi-family-antitoxin-domain-containing-protein
MVSPAGADRRIPTWASRVVSGLARDRPVVVTKEDLTQRLTEAGCGRDPDSAIRELRRIGWLVQLPVKGTWAFIPPGEAAISDPYLPLRSWLARDQNAGFMLAGASAAWHLGYLDRQPDGRIPIWLPPAKRLPDGLASYVSVVRIPWNAADTALLAPRPALLVRRRLDLVAWATGLPALGPEALLVQIATRPASFGPWADLVPHLDDLVADCSDERLERLLSGRPTSAWQRASYLLDSGGEPARGQALLAKRHTEVMPVTRFTTAHSRDRGESVWAPEYQLVDELVVPLLRVIGKA
>NZ_CP022577.1|WP_003910939.1|565907_566453_+|DUF1802-family-protein
MTPALKEWSAAVHALLDGRQTVLLRKGGIGEKRFEVAAHEFLLFPTVAHSHAERVRPEHRDLLGPAAADSTDECVLLRAAAKVVAALPVNRPEGLDAIEDLHIWTAESVRADRLDFRPKHRLAVLVVCAIPLAEPVRLARRPEYGGCTSWVQLPVTPTLAAPVHDEAALAEVAARVREAVG
>NZ_CP022577.1|WP_003414489.1|565641_565911_+|DUF2277-family-protein
MCRNITELRGLQPPATPVEIAAAARQYVRKVSGITHPSAATAEAFEAAVAEVTATTTRLLDALPPRRQPPKTVPPLRRPDVAARLAGSR
>NZ_CP022577.1|WP_003899491.1|576949_577762_-|ExeA-family-protein
MMHKLISYYGFSRMPFGRDLAPGMLHRHSAHNEAVARIGWCIADRRIGVITGEVGAGKTVAVRAALASLDRSRHTIIYLPDPTVGVQGIHHRIVASLGGQPLTHHATLAPQAADALAAEQAERGRTPVVVVEEAHLLGYDQLEALRLLTNHDLDSSSPFACLLIGQPTLRRRMKLGVLAALDQRIGLRYAMPPMTDTNTGSYLRHHLKLAGRDDALFSDDAIGLIHQTSRGYPRAVNNLALQALVAAFAADKAIVDESTTRTAIAEVTAD
>NZ_CP022577.1|WP_003414198.1|577758_579168_-|DDE-type-integrase/transposase/recombinase
MAVGDDEEKVRAERARAIGLFRYQLIWEAADAAHSTKQRGKMVRELASREHTDPFGRRVRISRQTIDRWIRGWRAGGFDALVPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQLGWAPDERTLQRNFHRLGLTGATTGSAPAVFGRFEAEHPNALWTGDVLHGIRIDLRKTYLFAFLDDHSRLVPGYRWGHAEDTVRLAAALRPALASRGVPNAVYVDNGSPYVDAWLLRACAKLGVRLVHSTPGRPQGRGKIERFFRTVREQFLVEITGEPDVVGRHYVADLAELNRLFTAWVETVYHRSVHSETGQTPLARWSAGGPIPLPAPETLTEAFLWEEHRRVTKTATVSLHGNRYEIDPALVGRKVELVFDPFDLTRIEVRLAGAPMGRAIPYHIGRHSHPKAKPETPTAPPKPSGIDYAQLIETAHAAELARGVNYTALTGAADQIPGQLDLLTGQEAQPK
>NZ_CP022577.1|WP_003414195.1|579238_579847_-|hypothetical-protein
MVTVEADVDQVERRLAAGELSCPSCGGVLAGWGRARSRQLRGPAGPVELCPRRSRCTGCGVTHVLLPVSALLRRADTAAVIVSALAAKATSRVGFRRIATDVARPAETVRGWLRRFAERVEAVRSVFTVWLCAVDADPVMPDAGGGGFVDAVVAIGALAAAIGRRFSLPTVSLAETAVAVSGGRLLAPGWPGEWVQHESTLP
>NZ_CP022577.1|WP_003414190.1|580266_580578_-|hypothetical-protein
MTYAARDDTTLPKLLAQMRWVVLVDKRQLAVLLLENEGPVASATDTLDTRGDSDYENQPVDAVERLCRRLADQAVRQWGFMQGLKQKLGPGVDVRMKLVEWNR
>NZ_CP022577.1|WP_003899489.1|580682_580940_-|hypothetical-protein
MSNVLDAISTEHRPVIEQELENRNPALFDELRRTEKPTNEQSDAVIDVLSDALMKTFGPDWVPNDYGLKIERAIDAYLETWPIYR
>NZ_CP022577.1|WP_003899488.1|581173_582328_-|DDE-type-integrase/transposase/recombinase
MVSTTGMGRSTARRMLTGPGLPEPAEQVDGRRLRARGFSDDARALLEHVWALMGMPCGKYLVVMLELWLPLVAAAGDLDKPFATEAAVAELKAMSAATVDRYLKPARERMRIKGISTTKPSPLLRNSITIHTCSDEAPKVPGVIEADTVAHCGPSLIGEFARTLTMTDLVTGWTENASIRNNAAKWILEGIKECQQRFPFPMTVFDSDCGGEFINHDVAGWLQARDIAQTRSRPYQKNDQAHVESKNNHVVRKHAFYWRYDTGEELELLNRLWPLVSLRCNFFTPTKKPVGYTSTVNGRRKRIYDKPATPWQRLQASGVLDAQQLSTVAARIEGFNPADLTRQINAIQMQLLDLAKTKTEALATARHIDLQSLQPSINRLAKAK
>NZ_CP022577.1|WP_003414184.1|582526_582718_-|hypothetical-protein
MKTNPRYGPAFYSVMTVLFLALFVLNVCTHGSTLGLISTGGLAVLMGYIGYRGWSGKRHINRQ
>NZ_CP022577.1|WP_003414181.1|582714_583119_-|hypothetical-protein
MGRDNGKILDPVVATTGMGRSTARQMLTGPRLPGPAEQVDGRSLRPRGFSDEARALLEHVWALMGMPCGKYLVVMHDLWLPLLTAAGDLDKPLVTEASVAELKATALPGANRMPHWAAGTLPDGFPARAVRTRT
>NZ_CP022577.1|WP_003917684.1|583266_583521_+|hypothetical-protein
MTVELGGAVVDGVDDQGAGAVVPGTGHGSDEGIEEKIATETGALLLPVERQASEDEHWDRVGSGWPRPGRDGTRIRSMLPMASA
>NZ_CP022577.1|WP_003911993.1|583696_583972_-|DUF1778-domain-containing-protein
MPETLTGRLNFRLSPEQEQALRHAAALTGQSLSGFVLSAAVDHAHDLLARANRIELSEAAFRRFVAALDEPDEAAPELVRLARRKSRIPPH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_2

1534945-1535086

Orphan

Consensus_repeat	Method
TGAGTATTCCGTCGGTGACGGTTCCGCCGATCACGATTCCGGCTGGCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022577_2

>merge|NZ_CP022577|2|1534945-1535086|CRISPRCasFinder
TTGATTTGCCGGGGTTGACGGTGCCGTCGTTGACGATTCCAGCTACAACAACACCAGCCAACATCACGGTAGGTGCGTTTAACTTGCCTCAGTTGAGTATTCCGTCGGTGACGGTTCCGCCGATCACGATTCCGGCTGGCAC

>NZ_CP022577|2|2|1534945-1535086|CRISPRCasFinder
TTGATTTGCCGGGGTTGACGGTGCCGTCGTTGACGATTCCAGCTACAAC	AACACCAGCCAACATCACGGTAGGTGCGTTTAACTTGCCTCAGT
TGAGTATTCCGTCGGTGACGGTTCCGCCGATCACGATTCCGGCTGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_014585239.1\|1552628_1553093_+\|DUF4262-domain-containing-protein	unknown	unknown	gnl\|CDD\|379457
NZ_CP022577.1\|WP_003409568.1\|1548354_1548960_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	unknown	unknown	gnl\|CDD\|224793
NZ_CP022577.1\|WP_003899082.1\|1532452_1532917_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
NZ_CP022577.1\|WP_003409574.1\|1546398_1547151_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293840
NZ_CP022577.1\|WP_003409584.1\|1543578_1545879_-\|isocitrate-lyase-family-protein	unknown	unknown	gnl\|CDD\|215482
NZ_CP022577.1\|WP_003409566.1\|1549042_1549636_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	unknown	unknown	gnl\|CDD\|224793
NZ_CP022577.1\|WP_003899076.1\|1549749_1550193_+\|transcriptional-repressor	unknown	unknown	gnl\|CDD\|223806
NZ_CP022577.1\|WP_087902221.1\|1538325_1539587_+\|IS3-like-element-IS987-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP022577.1\|WP_003409667.1\|1528795_1529911_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP022577.1\|WP_003409666.1\|1530182_1531454_+\|haloacid-dehalogenase-like-hydrolase	unknown	unknown	gnl\|CDD\|273654
NZ_CP022577.1\|WP_003409577.1\|1546013_1546421_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003905688.1\|1523531_1524305_-\|YqjF-family-protein	unknown	unknown	gnl\|CDD\|225897
NZ_CP022577.1\|WP_003901288.1\|1531491_1532355_-\|acyltransferase-family-protein	unknown	unknown	gnl\|CDD\|153249
NZ_CP022577.1\|WP_003409684.1\|1524541_1525021_+\|immunoprotective-protein-Mpt63	unknown	unknown	gnl\|CDD\|370335
NZ_CP022577.1\|WP_106420781.1\|1547250_1548255_+\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176236
NZ_CP022577.1\|WP_003900433.1\|1527464_1528805_-\|lipase-LipD	unknown	unknown	gnl\|CDD\|365903
NZ_CP022577.1\|WP_003409686.1\|1522760_1523528_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|135631
NZ_CP022577.1\|WP_003900434.1\|1527047_1527428_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003901285.1\|1550230_1552453_+\|catalase/peroxidase-HPI	unknown	unknown	gnl\|CDD\|237891
NZ_CP022577.1\|WP_003902177.1\|1525028_1526891_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|171527

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003409568.1\|1548354_1548960_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	gnl\|CDD\|224793	COG1881, COG1881, Phospholipid-binding protein [General function prediction only].	1.29998e-51
NZ_CP022577.1\|WP_003899082.1\|1532452_1532917_+\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	1.38133e-21
NZ_CP022577.1\|WP_003409574.1\|1546398_1547151_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293840	cd16282, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	1.95555e-42
NZ_CP022577.1\|WP_003409566.1\|1549042_1549636_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	gnl\|CDD\|224793	COG1881, COG1881, Phospholipid-binding protein [General function prediction only].	4.33831e-50
NZ_CP022577.1\|WP_003899076.1\|1549749_1550193_+\|transcriptional-repressor	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	4.92282e-41
NZ_CP022577.1\|WP_087902221.1\|1538325_1539587_+\|IS3-like-element-IS987-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	4.28492e-102
NZ_CP022577.1\|WP_003409667.1\|1528795_1529911_-\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	8.61879e-60
NZ_CP022577.1\|WP_003409666.1\|1530182_1531454_+\|haloacid-dehalogenase-like-hydrolase	gnl\|CDD\|273654	TIGR01490, Uncharacterized_protein_Rv3661/MT3761, HAD-superfamily subfamily IB hydrolase, TIGR01490. This hypothetical equivalog is a member of the IB subfamily (TIGR01488) of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. The sequences modelled here are all bacterial. The IB subfamily includes the enzyme phosphoserine phosphatase (TIGR00338). Due to this relationship, several of these sequences have been annotated as "phosphoserine phosphatase related proteins," or "Phosphoserine phosphatase-family enzymes." There is presently no evidence that any of the enzymes in this model possess PSPase activity. OMNI\|NTL01ML1250 is annotated as a "possible transferase," however this is due to the C-terminal domain found on this sequence which is homologous to a group of glycerol-phosphate acyltransferases (between trusted and noise to TIGR00530). A subset of these sequences including OMNI\|CC1962, the Caulobacter crescentus CicA protein cluster together and may represent a separate equivalog. [Unknown function, Enzymes of unknown specificity].	4.7592e-11
NZ_CP022577.1\|WP_003409684.1\|1524541_1525021_+\|immunoprotective-protein-Mpt63	gnl\|CDD\|370335	pfam09167, DUF1942, Domain of unknown function (DUF1942). Members of this family of bacterial proteins assume a beta-sandwich structure consisting of two antiparallel beta-sheets similar to an immunoglobulin-like fold, with an additional small, antiparallel beta-sheet. The longer-stranded beta-sheet is made up of four antiparallel beta-strands. The shorter-stranded beta-sheet consists of five beta-strands, four of these beta-strands form an antiparallel beta-sheet. The exact function of this family of proteins is unknown, though a putative role includes involvement in host-bacterial interactions involved in endocytosis or phagocytosis, possibly during bacterial internalisation.	3.87872e-58
NZ_CP022577.1\|WP_003905688.1\|1523531_1524305_-\|YqjF-family-protein	gnl\|CDD\|225897	COG3361, COG3361, Uncharacterized conserved protein [Function unknown].	2.68592e-126
NZ_CP022577.1\|WP_003901288.1\|1531491_1532355_-\|acyltransferase-family-protein	gnl\|CDD\|153249	cd07987, LPLAT_MGAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: MGAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this suubgroup are such LPLATs as 2-acylglycerol O-acyltransferase (MGAT), and similar proteins.	4.71059e-64
NZ_CP022577.1\|WP_003409686.1\|1522760_1523528_+\|SDR-family-oxidoreductase	gnl\|CDD\|135631	PRK05867, PRK05867, SDR family oxidoreductase.	8.21275e-152
NZ_CP022577.1\|WP_106420781.1\|1547250_1548255_+\|zinc-binding-dehydrogenase	gnl\|CDD\|176236	cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	2.56379e-154
NZ_CP022577.1\|WP_003900433.1\|1527464_1528805_-\|lipase-LipD	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	7.07573e-54
NZ_CP022577.1\|WP_003409584.1\|1543578_1545879_-\|isocitrate-lyase-family-protein	gnl\|CDD\|215482	PLN02892, PLN02892, isocitrate lyase.	2.96208e-144
NZ_CP022577.1\|WP_014585239.1\|1552628_1553093_+\|DUF4262-domain-containing-protein	gnl\|CDD\|379457	pfam14081, DUF4262, Domain of unknown function (DUF4262). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and viruses. Proteins in this family are typically between 147 and 227 amino acids in length. Some members may be incorrectly annotated as the KatG protein.	7.86857e-31
NZ_CP022577.1\|WP_003901285.1\|1550230_1552453_+\|catalase/peroxidase-HPI	gnl\|CDD\|237891	PRK15061, PRK15061, catalase/peroxidase.	0
NZ_CP022577.1\|WP_003902177.1\|1525028_1526891_-\|AMP-binding-protein	gnl\|CDD\|171527	PRK12476, PRK12476, putative fatty-acid--CoA ligase; Provisional.	0

>NZ_CP022577.1|WP_003899082.1|1532452_1532917_+|SRPBCC-family-protein
MSGRKFSFEVTKTSSAPAATLFRLVTDGGNWATWAKPIVAQSSWARRGDPAPGGIGAIRKLGMWPVFVQEETVEYEQDRRHVYKLVGARTPVQDYFGEVVLTPNASGGTDLRWSGSFTEKVRGTGPVMRAALGGAVRFFAGQLVKAAEREAVRR
>NZ_CP022577.1|WP_003901288.1|1531491_1532355_-|acyltransferase-family-protein
MFPRWPQQAHNHEVSRADTVSVPRAPTQAEVAAVLRIMTPLRKVIKPKVYGIENVPTERALLVGNHNTLGLVDAPLLAAELWERGRIVRSLGDHAHFKIPGWRDALTRTGVVEGTREITSELMRRGELVMVFPGGAREVNKRKNERYKLVWKNRLGFARLAIQHGYPIVPFASVGAEHGIDIVLDNESPLLAPVQFLAEKLLGTKDGPALVRGVGLTPVPRPERQYYWFGEPIDTTEFMGQQADDNAARRVRARAAAAIEHGIELMLAERAADPNRSLVGRLLRSDA
>NZ_CP022577.1|WP_003409666.1|1530182_1531454_+|haloacid-dehalogenase-like-hydrolase
MVRLIPSLLAMATVLGGVIGCSAHQPPTPASGCRQLDAFLKWHHGVREFLQSAIDANSRCTGTADGSARKVAIFDWDNTVVKNDIGYATNYYMLQHSLVLQPANQDWHAASRYLTDAAANALSVACGKVVPAGKPLPTGSNALCANEILSLLDGETTTGQPAFVGNNVRRLAGPYAWSNALSAGYTAEELAGFADQAKKQNLAADVGATQQVGTQQVDGYIRVYPQMKDLIGTLQAHGIDTWVVSASPEPIVKVWAGEVGLDDQHVVGVRSVADQSGKLTAHLVGCGGVRDGDDSVMTYLDGKRCWANQVIFGVTGPQAFNQLAADRRQVLAAGDSNSDATFVGDATVVSLVINRNQDDLMCRAYDGLFTRGGKWAINPMFIDPLPQHAPYVCGEAFINPDGSKQPVLRNDGTPIPDQVDSVF
>NZ_CP022577.1|WP_003409667.1|1528795_1529911_-|serine-hydrolase
MDSTVTASIRRMLGLLAATLLLGGCTGQHTTRTAASTTYTPHIKASSQDVLDGAINADEPGCSAAVGVEGKVIWSGVRGIADLASGAKITTDTVFDIASVSKQFTATAILLLVEAGKLTLDDPISQYVPELPDWAQTVTVEQLMHQTSGIPDYVALLAARGYQVSDRTIEAEARQALAAAPELQFKPGTRFDYSNSNYLLLGEIVHRASGQPLPEFLSAEIFQPLGLAMVVDPVGKVPNKAVSYEKGTGGNRSEYRVGNPAWEQIGDGGIQTTPSQLARWADNYRTGSVGGLKLLEAQLAGAVETEPGGGDRYGAGIVSRADGTLDHAGAWAGFVTAFHISSDRRTSVAISCNTDKPDPVAMADALGRLWM
>NZ_CP022577.1|WP_003900433.1|1527464_1528805_-|lipase-LipD
MDVAGLPRLAAGTQAAIIHGMAQPPSLLTTDNGLPFGVQGACDSRFTGVIRAFAGLYPGRKFGGGALSVYIDGRQVVDVWTGWSDRQGKVPWTADTGAMVFSATKGLAATVIHRLVDRGLLSYDAPVAEYWPEFGANGKSEVTVSDVLRHRSGLAHLKGVDKDEVMDHLLMEQKLAAAPLDRQHGKLAYHAVTYGWLLSGLARAVTGKGMRELFREELARPLNTDGIHLGRPPADSPTKAAQTLLPQAKVPTPLLDFIAPKVAGLSFSGLLGAVYFPGILSLLQDDMPFLDGEVPAVNGVVTARALAKTYGALANDGVIDGTRLLSSQAVRGLTGKSELWPDLNLGLPFTYHQGYQSSPVPGLLEGYGHIGLGGTIGWADPETGSAFGYVHNRLLTLLLFDIGSFAGLAALLNSAVVAARRDDPLEVPHFGAPYSEPRHEQAASGA
>NZ_CP022577.1|WP_003900434.1|1527047_1527428_+|hypothetical-protein
MDPADVINPTSTRDAALARVLAYRQRVRARPLLIRATLAVVGGGLFVVSLPMIVLLPELGIPALLVAFRLLAVEAQWAVRAYAWTDWRFTQLREWFHRQVLVTRAAILVGLFLAAVALVWLLVYEF
>NZ_CP022577.1|WP_003902177.1|1525028_1526891_-|AMP-binding-protein
MNDGSRQELRVRSGLLQIEDCLDADGGIALPAGTTLISLIERNIKYVGDLVAYRYLDHARSAAGCALEVTWTQFGMRLAAIGAHVQRFAGPGDCVAILAPQGIDYVCGFYAAIKAGTVAVPLFAPELPGHAERLDTALRDSEPAVILTTAAAKNAVEGFLNNVPRLRKPTVLVIDQIPDREGELFVPVELDIDAVSHLQYTSGSTRPPVGVEITHRAVGTNLVQMILSIDLLNRNTHGVSWLPLYHDMGLSMIGFPAVYGGHSTLMSPTAFVRRPLRWIQALSEGSRTGRVVTAAPNFAYEWAAQRGLPAQGDDVDLSNVVLIIGSEPVSIDAVTTFNKAFAPYGLPRTAFKPSYGIAEATLLVATIDHAAEPTVVYLDPEQLGAGHATRVAPDAPNAVVHVSCGHVARSLWAVIVDPDTGPEAGAELPDGEIGEVWLQGDNVARGYWGRPEETRMTFGARLQSPLAEGSHADGSAIDDTWLRTGDLGVYLDGELYITGRIADLLTIDGRNHYPQDIEATAAEASPMVRRGYITAFTVPASDGDDRNQRLVIIAERAAGTSRSDPRPALDAIRAAVCNRHGLSVADLSFLPAGAIPRTTSGKLARQACRAQYLSGRLGVH
>NZ_CP022577.1|WP_003409684.1|1524541_1525021_+|immunoprotective-protein-Mpt63
MKLTTMIKTAVAVVAMAAIATFAAPVALAAYPITGKLGSELTMTDTVGQVVLGWKVSDLKSSTAVIPGYPVAGQVWEATATVNAIRGSVTPAVSQFNARTADGINYRVLWQAAGPDTISGATIPQGEQSTGKIYFDVTGPSPTIVAMNNGMEDLLIWEP
>NZ_CP022577.1|WP_003905688.1|1523531_1524305_-|YqjF-family-protein
MTAIPGPSGAEPGESRALAGYPVTPPALPRPVIFDQRWTDLTFIHWPVLPDSVAGSYPPGTRPDVFADGMTYVGLVPFRMSSTKLGTALPIPYVGTFPETNVRLYSIDNAGRHGVLFRSLETARLTVVPLTRIGLGIPYAWSRMRMMRSGKHITYHSVRRWPRRGLRSLLTITIGDLVEPTPLEVWLTARWGAHTRKAGRTWWVPNEHKPWPLRAAEIAELNDELIDASGVQPTGDRLRALFSPGVHARFGRPCVVQ
>NZ_CP022577.1|WP_003409686.1|1522760_1523528_+|SDR-family-oxidoreductase
MSVLDLFDLHGKRALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSGGKVVPVCCDVSQHQQVTSMLDQVTAELGGIDIAVCNAGIITVTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKAMVKQGQGGVIINTASMSGHIINVPQQVSHYCASKAAVIHLTKAMAVELAPHKIRVNSVSPGYILTELVEPYTEYQPLWEPKIPLGRLGRPEELAGLYLYLASEASSYMTGSDIVIDGGYTCP
>NZ_CP022577.1|WP_087902221.1|1538325_1539587_+|IS3-like-element-IS987-family-transposase
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASGFLRGRARPASTLITRFIADHQGHREGPDGLRWGVESICTQLTELGVPIAPSTYYDHINREPSRRELRDGELKEHISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLGLSGTTRGKARRTTIADPATARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSERLAEAGIQPSVGAVGSSYDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHRRLYQYCGDVPPVELEAAYYAQRQRPAAG
>NZ_CP022577.1|WP_003409584.1|1543578_1545879_-|isocitrate-lyase-family-protein
MAIAETDTEVHTPFEQDFEKDVAATQRYFDSSRFAGIIRLYTARQVVEQRGTIPVDHIVAREAAGAFYERLRELFAARKSITTFGPYSPGQAVSMKRMGIEAIYLGGWATSAKGSSTEDPGPDLASYPLSQVPDDAAVLVRALLTADRNQHYLRLQMSERQRAATPAYDFRPFIIADADTGHGGDPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNAARFQLDIMRVPGIIVARTDAEAANLIDSRADERDQPFLLGATKLDVPSYKSCFLAMVRRFYELGVKELNGHLLYALGDSEYAAAGGWLERQGIFGLVSDAVNAWREDGQQSIDGIFDQVESRFVAAWEDDAGLMTYGEAVADVLEFGQSEGEPIGMAPEEWRAFAARASLHAARAKAKELGADPPWDCELAKTPEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADARQFAEAIHAEFPDQMLAYNLSPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGGHQIDGVAAEEFATALRQDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQHLVQTEVPRKLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELGIHGESDDKLANVIFQPIQDRRGRTILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAVHYVTPTDDNLYQTSKMKSHGIFTEVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKEA
>NZ_CP022577.1|WP_003409577.1|1546013_1546421_+|hypothetical-protein
MVLSRTSTGRVILVPTQLRFDRWFLPLAVPLGLGPKNSELWVGAGSLHVKMGWAFAADIPLTSITKAEATNARVYAAGVHFGFGRWLVNGSRKGLVALTIDPPEQAKMWKKSMTVRELWVSVTDPDALVTACTAK
>NZ_CP022577.1|WP_003409574.1|1546398_1547151_-|MBL-fold-metallo-hydrolase
MHFDWERLTDSVHRCRLPFCDVTVGLVRGRTGILLVDTGTTLGEATAIAADVKQIAGCQVTHVVLTHKHFDHVLGSSVFDQAEVFCAPEVVEYLRSATDRLREDALSYGADTAEVDRAIAALKPPQHGIYDAAVDLGDRTVTITHPGSGHTTADLVVVAPATGHADGPTVVFTGDLVEESADPDIDADSDLAAWPATLDRVLAIGGPDASYVPGHGKVVDAQFVRRQRAWLRTRASRQPRETPATLPCKR
>NZ_CP022577.1|WP_106420781.1|1547250_1548255_+|zinc-binding-dehydrogenase
MRAVVITKHGDPSVLQVRQRPDPPPPGPGQLRVAVRAAGVNFADHLARVGLYPDAPKLPAVVGYEVAGTVEAVGDGVDPNRVGERVLAGTRFGGYCEIVNVAATDSVVLPDALSFEQGAAIPVNYATAWAALHGYGSLRAGERVLIHAAAGGVGIAAVQFAKAAKAEVHGTASPQKHQKLAEFGVDRAIDYRRDGWWQGLGPYDVVLDALGGTSLRRSYTLLRPGGRLVGYGISNMQHGEKRSMRRVAPHALSMLRGFNLMKQLEESKTVIGLNMLRLWDDRRTLEPWIAPLTKALNDGTILPIVHAIVPFAEAPEAHRILAARENVGKVVLVP
>NZ_CP022577.1|WP_003409568.1|1548354_1548960_+|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein
MTSTLHRTPLATAGLALVVALGGCGGGGGDSRETPPYVPKATTVDATTPAPAAEPLTIASPMFADGAPIPVQFSCKGANVAPPLTWSSPAGAAELALVVDDPDAVGGLYVHWIVTGIAPGSGSTADGQTPAGGHSVPNSGGRQGYFGPCPPAGTGTHHYRFTLYHLPVALQLPPGATGVQAAQAIAQAASGQARLVGTFEG
>NZ_CP022577.1|WP_003409566.1|1549042_1549636_+|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein
MAHAFHRFALAILGLALPVALVAYGGNGDSRKAAPLAPKAAALGRSMPETPTGDVLTISSPAFADGAPIPEQYTCKGANIAPPLTWSAPFGGALVVDDPDAPREPYVHWIVIGIAPGAGSTADGETPGGGISLPNSSGQPAYTGPCPPAGTGTHHYRFTLYHLPAVPPLAGLAGTQAARVIAQAATMQARLIGTYEG
>NZ_CP022577.1|WP_003899076.1|1549749_1550193_+|transcriptional-repressor
MSSIPDYAEQLRTADLRVTRPRVAVLEAVNAHPHADTETIFGAVRFALPDVSRQAVYDVLHALTAAGLVRKIQPSGSVARYESRVGDNHHHIVCRSCGVIADVDCAVGEAPCLTASDHNGFLLDEAEVIYWGLCPDCSISDTSRSHP
>NZ_CP022577.1|WP_003901285.1|1550230_1552453_+|catalase/peroxidase-HPI
MPEQHPPITETTTGAASNGCPVVGHMKYPVEGGGNQDWWPNRLNLKVLHQNPAVADPMGAAFDYAAEVATIDVDALTRDIEEVMTTSQPWWPADYGHYGPLFIRMAWHAAGTYRIHDGRGGAGGGMQRFAPLNSWPDNASLDKARRLLWPVKKKYGKKLSWADLIVFAGNCALESMGFKTFGFGFGRVDQWEPDEVYWGKEATWLGDERYSGKRDLENPLAAVQMGLIYVNPEGPNGNPDPMAAAVDIRETFRRMAMNDVETAALIVGGHTFGKTHGAGPADLVGPEPEAAPLEQMGLGWKSSYGTGTGKDAITSGIEVVWTNTPTKWDNSFLEILYGYEWELTKSPAGAWQYTAKDGAGAGTIPDPFGGPGRSPTMLATDLSLRVDPIYERITRRWLEHPEELADEFAKAWYKLIHRDMGPVARYLGPLVPKQTLLWQDPVPAVSHDLVGEAEIASLKSQILASGLTVSQLVSTAWAAASSFRGSDKRGGANGGRIRLQPQVGWEVNDPDGDLRKVIRTLEEIQESFNSAAPGNIKVSFADLVVLGGCAAIEKAAKAAGHNITVPFTPGRTDASQEQTDVESFAVLEPKADGFRNYLGKGNPLPAEYMLLDKANLLTLSAPEMTVLVGGLRVLGANYKRLPLGVFTEASESLTNDFFVNLLDMGITWEPSPADDGTYQGKDGSGKVKWTGSRVDLVFGSNSELRALVEVYGADDAQPKFVQDFVAAWDKVMNLDRFDVR
>NZ_CP022577.1|WP_014585239.1|1552628_1553093_+|DUF4262-domain-containing-protein
MCDHPEATAEEYLDEVYGIMLMHGWAVQHVECERRPFAYTVGLTRRGLPELVVTGLSPRRGQRLLNIAARRALVGDLLTPGMQTTLPAGPLVETVQVTHPDAHLYCAIAIFGDKVTALQLVWADRRGRWPWAADFDEGRGTQPVLGMRATRRSA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_3

1644083-1645078

Orphan

Consensus_repeat	Method
GNCGGCGGGGCCGGCGGC	CRT

16 spacers

The CRISPR arrays of NZ_CP022577_3

>merge|NZ_CP022577|3|1644083-1645078|CRT
AACGGCGGGGCCGGCGGCTCCGGCGCGGCCGGCATGCCCGGGGGCAACGGCGGAGCCGCTGGCCTGTTCGGCAACGGCGGGGCCGGCGGCGCCGGGGGGAACGTAGCGTCCGGCACCGCAGGGTTCGGCGGGGCCGGCGGGGCCGGCGGGCTGCTCTACGGCGCCGGCGGGGCCGGCGGCGCCGGCGGACGCGCCGGTGGTGGGGTGGGCGGTATTGGTGGGGCCGGCGGGGCCGGCGGCAATGGCGGGCTGCTGTTCGGCGCCGGCGGGGCCGGCGGCGTCGGCGGACTCGCGGCCGACGCCGGTGACGGCGGGGCCGGCGGAGACGGCGGGTTGTTCTTCGGCGTGGGCGGTGCCGGCGGGGCCGGCGGCACCGGCACTAATGTCACCGGCGGTGCCGGCGGGGCCGGCGGCAATGGCGGGCTCCTGTTCGGCGCCGGCGGGGTGGGCGGTGTTGGCGGTGACGGTGTGGCATTCCTGGGCACCGCCCCCGGCGGGCCCGGTGGTGCCGGCGGGGCCGGTGGGCTGTTCGGCGTCGGTGGGGCCGGCGGCGCCGGCGGAATCGGATTGGTCGGGAACGGCGGTGCCGGGGGGTCCGGCGGGTCCGCCCTGCTCTGGGGCGACGGCGGTGCCGGCGGCGCGGGTGGGGTCGGGTCCACTACCGGCGGTGCCGGCGGGGCGGGCGGCAACGCCGGCCTGCTGGTAGGCGCCGGCGGGGCCGGCGGCGCCGGCGCACTCGGCGGTGGCGCTACCGGGGTGGGCGGCGCCGGCGGAAACGGCGGCACTGCGGGCCTGCTGTTTGGTGCCGGCGGCGCCGGCGGCGCCGGCGGATTCGGCTTCGGCGGTGCCGGGGGCGCCGGTGGGCTCGGCGGCAAAGCCGGGCTGATCGGCGACGGCGGTGACGGCGGCGCCGGAGGAAACGGCACCGGTGCCAAGGGCGGTGACGGCGGCGCTGGCGGCGGTGCCATCCTGGTCGGCAACGGCGGCAACGGCGGC

>NZ_CP022577|3|2|1644083-1645078|CRT
AACGGCGGGGCCGGCGGC	TCCGGCGCGGCCGGCATGCCCGGGGGCAACGGCGGAGCCGCTGGCCTGTTCGGC
AACGGCGGGGCCGGCGGC	GCCGGGGGGAACGTAGCGTCCGGCACCGCAGGG
TTCGGCGGGGCCGGCGGG	GCCGGCGGGCTGCTCTACGGC
GCCGGCGGGGCCGGCGGC	GCCGGCGGACGCGCCGGTGGTGGGGTGGGCGGTATTGGTGGG
GCCGGCGGGGCCGGCGGC	AATGGCGGGCTGCTGTTCGGC
GCCGGCGGGGCCGGCGGC	GTCGGCGGACTCGCGGCCGACGCCGGT
GACGGCGGGGCCGGCGGA	GACGGCGGGTTGTTCTTCGGCGTGGGCGGT
GCCGGCGGGGCCGGCGGC	ACCGGCACTAATGTCACCGGCGGT
GCCGGCGGGGCCGGCGGC	AATGGCGGGCTCCTGTTCGGC
GCCGGCGGGGTGGGCGGT	GTTGGCGGTGACGGTGTGGCATTCCTGGGCACCGCC
CCCGGCGGGCCCGGTGGT	GCCGGCGGGGCCGGTGGGCTGTTCGGCGTCGGTGGG
GCCGGCGGCGCCGGCGGA	ATCGGATTGGTCGGGAACGGCGGTGCCGGGGGGTCCGGCGGGTCCGCCCTGCTCTGGGGC
GACGGCGGTGCCGGCGGC	GCGGGTGGGGTCGGGTCCACTACCGGCGGTGCCGGCGGGGCGGGCGGCAACGCCGGCCTGCTGGTAGGC
GCCGGCGGGGCCGGCGGC	GCCGGCGCACTCGGCGGTGGCGCTACCGGGGTGGGCGGCGCCGGCGGAAACGGCGGCACTGCGGGCCTGCTGTTTGGT
GCCGGCGGCGCCGGCGGC	GCCGGCGGATTCGGCTTCGGCGGTGCCGGGGGCGCCGGTGGGCTCGGCGGCAAAGCCGGGCTGATCGGC
GACGGCGGTGACGGCGGC	GCCGGAGGAAACGGCACCGGTGCCAAGGGCGGTGACGGCGGCGCTGGCGGCGGTGCCATCCTGGTCGGC
AACGGCGGCAACGGCGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003901259.1\|1648922_1649825_-\|sterol-desaturase-family-protein	unknown	unknown	gnl\|CDD\|225546
NZ_CP022577.1\|WP_003409227.1\|1636627_1637257_-\|CDP-alcohol-phosphatidyltransferase-family-protein	unknown	unknown	gnl\|CDD\|223632
NZ_CP022577.1\|WP_003900416.1\|1641608_1643528_+\|vitamin-B12-ABC-transporter-ATP-binding-protein-BacA	unknown	unknown	gnl\|CDD\|226646
NZ_CP022577.1\|WP_003899030.1\|1653657_1655064_-\|PPE-family-protein	unknown	unknown	gnl\|CDD\|366325
NZ_CP022577.1\|WP_003409199.1\|1650233_1650665_+\|DUF4189-domain-containing-protein	unknown	unknown	gnl\|CDD\|372741
NZ_CP022577.1\|WP_003409239.1\|1632512_1633256_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133378
NZ_CP022577.1\|WP_003409218.1\|1639894_1641538_-\|acetolactate-synthase	unknown	unknown	gnl\|CDD\|235629
NZ_CP022577.1\|WP_003905659.1\|1637453_1639880_-\|accessory-Sec-system-translocase-SecA2	unknown	unknown	gnl\|CDD\|237060
NZ_CP022577.1\|WP_003409207.1\|1645287_1646751_-\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|180854
NZ_CP022577.1\|WP_003905660.1\|1635711_1636635_-\|DUF881-domain-containing-protein	unknown	unknown	gnl\|CDD\|226396
NZ_CP022577.1\|WP_003409204.1\|1648152_1648818_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003899032.1\|1652198_1652903_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP022577.1\|WP_003409188.1\|1653056_1653413_-\|DUF732-domain-containing-protein	unknown	unknown	gnl\|CDD\|368380
NZ_CP022577.1\|WP_003899038.1\|1634422_1635301_-\|DUF881-domain-containing-protein	unknown	unknown	gnl\|CDD\|226396
NZ_CP022577.1\|WP_003901258.1\|1655195_1656425_-\|PPE-family-protein	unknown	unknown	gnl\|CDD\|366325
NZ_CP022577.1\|WP_003901263.1\|1633980_1634385_-\|glycine-cleavage-system-protein-GcvH	unknown	unknown	gnl\|CDD\|234918
NZ_CP022577.1\|WP_003899041.1\|1633252_1633741_-\|glycogen-accumulation-regulator-GarA	unknown	unknown	gnl\|CDD\|224630
NZ_CP022577.1\|WP_003409193.1\|1650986_1652189_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224172
NZ_CP022577.1\|WP_003409205.1\|1647385_1648090_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379115
NZ_CP022577.1\|WP_003899037.1\|1635317_1635683_-\|small-basic-family-protein	unknown	unknown	gnl\|CDD\|226374

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003901259.1\|1648922_1649825_-\|sterol-desaturase-family-protein	gnl\|CDD\|225546	COG3000, ERG3, Sterol desaturase [Lipid metabolism].	1.47599e-56
NZ_CP022577.1\|WP_003409227.1\|1636627_1637257_-\|CDP-alcohol-phosphatidyltransferase-family-protein	gnl\|CDD\|223632	COG0558, PgsA, Phosphatidylglycerophosphate synthase [Lipid metabolism].	2.43578e-28
NZ_CP022577.1\|WP_003900416.1\|1641608_1643528_+\|vitamin-B12-ABC-transporter-ATP-binding-protein-BacA	gnl\|CDD\|226646	COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only].	0
NZ_CP022577.1\|WP_003899030.1\|1653657_1655064_-\|PPE-family-protein	gnl\|CDD\|366325	pfam00823, PPE, PPE family. This family named after a PPE motif near to the amino terminus of the domain. The PPE family of proteins all contain an amino-terminal region of about 180 amino acids. The carboxyl terminus of this family are variable, and on the basis of this region fall into at least three groups. The MPTR subgroup has tandem copies of a motif NXGXGNXG. The second subgroup contains a conserved motif at about position 350. The third group are only related in the amino terminal region. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	3.25979e-58
NZ_CP022577.1\|WP_003409199.1\|1650233_1650665_+\|DUF4189-domain-containing-protein	gnl\|CDD\|372741	pfam13827, DUF4189, Domain of unknown function (DUF4189). This domain of unknown function contains six well-conserved cysteine residues.	4.20219e-12
NZ_CP022577.1\|WP_003409239.1\|1632512_1633256_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133378	cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	3.6505e-17
NZ_CP022577.1\|WP_003409218.1\|1639894_1641538_-\|acetolactate-synthase	gnl\|CDD\|235629	PRK05858, PRK05858, acetolactate synthase.	0
NZ_CP022577.1\|WP_003905659.1\|1637453_1639880_-\|accessory-Sec-system-translocase-SecA2	gnl\|CDD\|237060	PRK12326, PRK12326, preprotein translocase subunit SecA; Reviewed.	0
NZ_CP022577.1\|WP_003409207.1\|1645287_1646751_-\|FAD-binding-protein	gnl\|CDD\|180854	PRK07121, PRK07121, FAD-binding protein.	0
NZ_CP022577.1\|WP_003905660.1\|1635711_1636635_-\|DUF881-domain-containing-protein	gnl\|CDD\|226396	COG3879, COG3879, Uncharacterized protein conserved in bacteria [Function unknown].	2.02483e-84
NZ_CP022577.1\|WP_003899032.1\|1652198_1652903_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	7.54596e-69
NZ_CP022577.1\|WP_003409188.1\|1653056_1653413_-\|DUF732-domain-containing-protein	gnl\|CDD\|368380	pfam05305, DUF732, Protein of unknown function (DUF732). This family consists of several uncharacterized Mycobacterium tuberculosis and leprae proteins of unknown function.	2.00134e-24
NZ_CP022577.1\|WP_003899038.1\|1634422_1635301_-\|DUF881-domain-containing-protein	gnl\|CDD\|226396	COG3879, COG3879, Uncharacterized protein conserved in bacteria [Function unknown].	5.64423e-80
NZ_CP022577.1\|WP_003901258.1\|1655195_1656425_-\|PPE-family-protein	gnl\|CDD\|366325	pfam00823, PPE, PPE family. This family named after a PPE motif near to the amino terminus of the domain. The PPE family of proteins all contain an amino-terminal region of about 180 amino acids. The carboxyl terminus of this family are variable, and on the basis of this region fall into at least three groups. The MPTR subgroup has tandem copies of a motif NXGXGNXG. The second subgroup contains a conserved motif at about position 350. The third group are only related in the amino terminal region. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	2.95884e-56
NZ_CP022577.1\|WP_003901263.1\|1633980_1634385_-\|glycine-cleavage-system-protein-GcvH	gnl\|CDD\|234918	PRK01202, PRK01202, glycine cleavage system protein GcvH.	4.92814e-65
NZ_CP022577.1\|WP_003899041.1\|1633252_1633741_-\|glycogen-accumulation-regulator-GarA	gnl\|CDD\|224630	COG1716, COG1716, FOG: FHA domain [Signal transduction mechanisms].	3.81746e-35
NZ_CP022577.1\|WP_003409193.1\|1650986_1652189_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224172	COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion].	3.92596e-115
NZ_CP022577.1\|WP_003409205.1\|1647385_1648090_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379115	pfam13305, WHG, WHG domain. This presumed domain is around 80 amino acids in length. It is found to the C-terminus of a DNA-binding helix-turn-helix domain. This domain may be involved in binding to an as yet unknown ligand that allows a transcriptional regulation response to that molecule. The domain is named WHG after three conserved residues near the C-terminus of the domain.	2.04829e-11
NZ_CP022577.1\|WP_003899037.1\|1635317_1635683_-\|small-basic-family-protein	gnl\|CDD\|226374	COG3856, Sbp, Uncharacterized conserved protein (small basic protein) [Function unknown].	1.86148e-45

>NZ_CP022577.1|WP_003900416.1|1641608_1643528_+|vitamin-B12-ABC-transporter-ATP-binding-protein-BacA
MGPKLFKPSIDWSRAFPDSVYWVGKAWTISAICVLAILVLLRYLTPWGRQFWRITRAYFVGPNSVRVWLMLGVLLLSVVLAVRLNVLFSYQGNDMYTALQKAFEGIASGDGTVKRSGVRGFWMSIGVFSVMAVLHVTRVMADIYLTQRFIIAWRVWLTHHLTQDWLDGRAYYRDLFIDETIDNPDQRIQQDVDIFTAGAGGTPNAPSNGTASTLLFGAVQSIISVISFTAILWNLSGTLNIFGVSIPRAMFWTVLVYVFVATVISFIIGRPLIWLSFRNEKLNAAFRYALVRLRDAAEAVGFYRGERVEGTQLQRRFTPVIDNYRRYVRRSIAFNGWNLSVSQTIVPLPWVIQAPRLFAGQIDFGDVGQTATSFGNIHDSLSFFRNNYDAFASFRAAIIRLHGLVDANEKGRALPAVLTRPSDDESVELNDIEVRTPAGDRLIDPLDVRLDRGGSLVITGRSGAGKTTLLRSLAELWPYASGTLHRPGGENETMFLSQLPYVPLGTLRDVVCYPNSAAAIPDATLRDTLTKVALAPLCDRLDEERDWAKVLSPGEQQRVAFARILLTKPKAVFLDESTSALDTGLEFALYQLLRSELPDCIVISVSHRPALERLHENQLELLGGGQWRLAPVEAAPAEV
>NZ_CP022577.1|WP_003409218.1|1639894_1641538_-|acetolactate-synthase
MSTDTAPAQTMHAGRLIARRLKASGIDTVFTLSGGHLFSIYDGCREEGIRLIDTRHEQTAAFAAEGWSKVTRVPGVAALTAGPGITNGMSAMAAAQQNQSPLVVLGGRAPALRWGMGSLQEIDHVPFVAPVARFAATAQSAENAGLLVDQALQAAVSAPSGVAFVDFPMDHAFSMSSDNGRPGALTELPAGPTPAGDALDRAAGLLSTAQRPVIMAGTNVWWGHAEAALLRLVEERHIPVLMNGMARGVVPADHRLAFSRARSKALGEADVALIVGVPMDFRLGFGGVFGSTTQLIVADRVEPAREHPRPVAAGLYGDLTATLSALAGSGGTDHQGWIEELATAETMARDLEKAELVDDRIPLHPMRVYAELAALLERDALVVIDAGDFGSYAGRMIDSYLPGCWLDSGPFGCLGSGPGYALAAKLARPQRQVVLLQGDGAFGFSGMEWDTLVRHNVAVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVRALGGHGELVSVPAELRPALERAFASGLPAVVNVLTDPSVAYPRRSNLA
>NZ_CP022577.1|WP_003905659.1|1637453_1639880_-|accessory-Sec-system-translocase-SecA2
MNVHGCPRIAACRCTDTHPRGRPAFAYRWFVPKTTRAQPGRLSSRFWRLLGASTEKNRSRSLADVTASAEYDKEAADLSDEKLRKAAGLLNLDDLAESADIPQFLAIAREAAERRTGLRPFDVQLLGALRMLAGDVIEMATGEGKTLAGAIAAAGYALAGRHVHVVTINDYLARRDAEWMGPLLDAMGLTVGWITADSTPDERRTAYDRDVTYASVNEIGFDVLRDQLVTDVNDLVSPNPDVALIDEADSVLVDEALVPLVLAGTTHRETPRLEIIRLVAELVGDKDADEYFATDSDNRNVHLTEHGARKVEKALGGIDLYSEEHVGTTLTEVNVALHAHVLLQRDVHYIVRDDAVHLINASRGRIAQLQRWPDGLQAAVEAKEGIETTETGEVLDTITVQALINRYATMCGMTGTALAAGEQLRQFYQLGVSPIPPNKPNIREDEADRVYITTAAKNDGIVEHITEVHQRGQPVLVGTRDVAESEELHERLVRRGVPAVVLNAKNDAEEARVIAEAGKYGAVTVSTQMAGRGTDIRLGGSDEADHDRVAELGGLHVVGTGRHHTERLDNQLRGRAGRQGDPGSSVFFSSWEDDVVAANLDHNKLPMATDENGRIVSPRTGSLLDHAQRVAEGRLLDVHANTWRYNQLIAQQRAIIVERRNTLLRTVTAREELAELAPKRYEELSDKVSEERLETICRQIMLYHLDRGWADHLAYLADIRESIHLRALGRQNPLDEFHRMAVDAFASLAADAIEAAQQTFETANVLDHEPGLDLSKLARPTSTWTYMVNDNPLSDDTLSALSLPGVFR
>NZ_CP022577.1|WP_003409227.1|1636627_1637257_-|CDP-alcohol-phosphatidyltransferase-family-protein
MEPVLTQNRVLTVPNMLSVIRLALIPAFVYVVLSAHANGWGVAILVFSGVSDWADGKIARLLNQSSRLGALLDPAVDRLYMVTVPIVFGLSGIVPWWFVLTLLTRDALLAGTLPLLWSRGLSALPVTYVGKAATFGFMVGFPTILLGQCDPLWSHVLLACGWAFLIWGMYAYLWAFVLYAVQMTMVVRQMPKLKGRAHRPAAQNAGERG
>NZ_CP022577.1|WP_003905660.1|1635711_1636635_-|DUF881-domain-containing-protein
MAESDRLLGGYDPNAGYSAHAGAKPQRIPVPSLLRALLSEHLDAGYAAVAAERERAAAPRCWQARAVSWMWQALAATLVAAVFAAAVAQARSVAPGVRAAQQLLVASVRSTQAAATTLAQRRSTLSAKVDDVRRIVLADDAEGQRLLARLDVLSLAAASAPVVGPGLTVTVTDPGASPNLSDVSKQRVSGSQQIILDRDLQLVVNSLWESGAEAISIDGVRIGPNVTIRQAGGAILVDNNPTSSPYTILAVGPPHAMQDVFDRSAGLYRLRLLETSYGVGVSVNVGDGLALPAGATRDVKFAKQIGP
>NZ_CP022577.1|WP_003899037.1|1635317_1635683_-|small-basic-family-protein
MGSDTAWSPARMIGIAALAVGIVLGLVFHPGVPEVIQPYLPIAVVAALDAVFGGLRAYLERIFDPKVFVVSFVFNVLVAALIVYVGDQLGVGTQLSTAIIVVLGIRIFGNTAALRRRLFGA
>NZ_CP022577.1|WP_003899038.1|1634422_1635301_-|DUF881-domain-containing-protein
MSENRPEPVAAETSAATTARHSQADAGAHDAVRRGRHELPADHPRSKVGPLRRTRLTEILRGGRSRLVFGTLAILLCLVLGVAIVTQVRQTDSGDSLETARPADLLVLLDSLRQREATLNAEVIDLQNTLNALQASGNTDQAALESAQARLAALSILVGAVGATGPGVMITIDDPGPGVAPEVMIDVINELRAAGAEAIQINDAHRSVRVGVDTWVVGVPGSLTVDTKVLSPPYSILAIGDPPTLAAAMNIPGGAQDGVKRVGGRMVVQQADRVDVTALRQPKQHQYAQPVK
>NZ_CP022577.1|WP_003901263.1|1633980_1634385_-|glycine-cleavage-system-protein-GcvH
MSDIPSDLHYTAEHEWIRRSGDDTVRVGITDYAQSALGDVVFVQLPVIGTAVTAGETFGEVESTKSVSDLYAPISGKVSEVNSDLDGTPQLVNSDPYGAGWLLDIQVDSSDVAALESALTKLLDAEAYRGTLTE
>NZ_CP022577.1|WP_003899041.1|1633252_1633741_-|glycogen-accumulation-regulator-GarA
MTDMNPDIEKDQTSDEVTVETTSVFRADFLSELDAPAQAGTESAVSGVEGLPPGSALLVVKRGPNAGSRFLLDQAITSAGRHPDSDIFLDDVTVSRRHAEFRLENNEFNVVDVGSLNGTYVNREPVDSAVLANGDEVQIGKFRLVFLTGPKQGEDDGSTGGP
>NZ_CP022577.1|WP_003409239.1|1632512_1633256_-|MerR-family-transcriptional-regulator
MSAPDSPALAGMSIGAVLDLLRPDFPDVTISKIRFLEAEGLVTPRRASSGYRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPPFGSPYVLPRLVPVAGDSAGGVGSDTASVSLTGIRLSREDLLERSEVADELLTALLKAGVITTGPGGFFDEHAVVILQCARALAEYGVEPRHLRAFRSAADRQSDLIAQIAGPLVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRDVLHR
>NZ_CP022577.1|WP_003409207.1|1645287_1646751_-|FAD-binding-protein
MSTDIPATVSAETVTSWSDDVDVTVIGFGIAGGCAAVSAAAAGARVLVLERAAAAGGTTALAGGHFYLGGGTTVQLATGHPDSPEEMYKYLVAVSREPDHDKIRAYCDGSVEHFNWLEGLGFQFERSYFPGKAVIQPNTEGLMFTGNEKVWPFLELAVPAPRGHKVPVPGDTGGAAMVIDLLLKRAASLGIQIRYETGATELIVDGTGKVTGVMWKRFSETGAIKAKSVIIAAGGFVMNPDMVAKYTPKLAEKPFVLGNTYDDGLGIRLGVSAGGATQHMDQMFITAPPYPPSILLTGIIVNKLGQRFVAEDSYHSRTAGFIMEQPDSAAYLIVDEAHLEHPKMPLVPLIDGWETVVEMEAALGIPPGNLAATLDRYNAYAARGADPDFHKQPEFLAAQDNGPWGAFDMSLGKAMYAGFTLGGLATSVDGQVLRDDGAVVAGLYAVGACASNIAQDGKGYASGTQLGEGSFFGRRAGAHAAARAQGM
>NZ_CP022577.1|WP_003409205.1|1647385_1648090_-|TetR/AcrR-family-transcriptional-regulator
MCQTCRVGKRRDAREQIEAKIVELGRRQLLDHGAAGLSLRAIARNLGMVSSAVYRYVSSRDELLTLLLVDAYSDLADTVDRARDDTVADSWSDDVIAIARAVRGWAVTNPARWALLYGSPVPGYHAPPDRTAGVATRVVGAFFDAIAAGIATGDIRLTDDVAPQPMSSDFEKIRQEFGFPGDDRVVTKCFLLWAGVVGAISLEVFGQYGADMLTDPGVVFDAQTRLLVAVLAEH
>NZ_CP022577.1|WP_003409204.1|1648152_1648818_-|hypothetical-protein
MVRLVPRAFAATVALLAAGFSPATASADPVLVFPGMEIRQDNHVCTLGYVDPALKIAFTAGHCRGGGAVTSRDYKVIGHLRAFRDNTPSGSTVATHELIADYEAIVLADDVTASNILPSGRALESRPGVVLHPGQAVCHFGVSTGETCGTVESVNNGWFTMSHGVLSEKGDSGGPVYLAPDGGPAQIVGIFNSVWGGFPAAVSWRSTSEQVHADLGVTPLA
>NZ_CP022577.1|WP_003901259.1|1648922_1649825_-|sterol-desaturase-family-protein
MRDPVLFAIPCFLLLLILEWTAARKLESIETAATGQPRPASGAYLTRDSVASISMGLVSIATTAGWKSLALLGYAAIYAYLAPWQLSAHRWYTWVIAIVGVDLLYYSYHRIAHRVRLIWATHQAHHSSEYFNFATALRQKWNNSGEILMWVPLPLMGLPPWMVFCSWSLNLIYQFWVHTERIDRLPRWFEFVFNTPSHHRVHHGMDPVYLDKNYGGILIIWDRLFGSFQPELFRPHYGLTKRVDTFNIWKLQTREYVAIVRDWRSATRLRDRLGYVFGPPGWEPRTIDKSNAAASLVTSR
>NZ_CP022577.1|WP_003409199.1|1650233_1650665_+|DUF4189-domain-containing-protein
MITNLRRRTAMAAAGLGAALGLGILLVPTVDAHLANGSMSEVMMSEIAGLPIPPIIHYGAIAYAPSGASGKAWHQRTPARAEQVALEKCGDKTCKVVSRFTRCGAVAYNGSKYQGGTGLTRRAAEDDAVNRLEGGRIVNWACN
>NZ_CP022577.1|WP_003409193.1|1650986_1652189_+|NAD(P)/FAD-dependent-oxidoreductase
MTRVVVIGSGFAGLWAALGAARRLDELAVPAGTVDVMVVSNKPFHDIRVRNYEADLSACRIPLGDVLGPAGVAHVTAEVTAIDADGRRVTTSTGASYSYDRLVLASGSHVVKPALPGLAEFGFDVDTYDGAVRLQQHLQGLAGGPLTSAAATVVVVGAGLTGIETACELPGRLHALFARGDGVTPRVVLIDHNPFVGSDMGLSARPVIEQALLDNGVETRTGVSVAAVSPGGVTLSSGERLAAATVVWCAGMRASRLTEQLPVARDRLGRLQVDDYLRVIGVPAMFAAGDVAAARMDDEHLSVMSCQHGRPMGRYAGCNVINDLFDQPLLALRIPWYVTVLDLGSAGAVYTEGWERKVVSQGAPAKTTKQSINTRRIYPPLNGSRADLLAAAAPRVQPRP
>NZ_CP022577.1|WP_003899032.1|1652198_1652903_-|MgtC/SapB-family-protein
MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFVLYAVATEDSSPTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSAAVGVLAASGHLVFTLIGTGTIVAVHLLGRPLGRLVDRDNAVEDEGLQPYQVRVICRPKAETYVRAHIVQRTSSNDITLRGIRTGPAGDDNITLTAHLLMVGHTPAKLERLVAELSLQPGVYAVHWYAGEHAQAE
>NZ_CP022577.1|WP_003409188.1|1653056_1653413_-|DUF732-domain-containing-protein
MQLQRTMGQCRPMRMLVALLLSAATMIGLAAPGKADPTGDDAAFLAALDQAGITYADPGHAITAAKAMCGLCANGVTGLQLVADLRDYNPGLTMDSAAKFAAIASGAYCPEHLEHHPS
>NZ_CP022577.1|WP_003899030.1|1653657_1655064_-|PPE-family-protein
MDFGLQPPEITSGEMYLGPGAGPMLAAAVAWDGLAAELQSMAASYASIVEGMASESWLGPSSAGMAAAAAPYVTWMSGTSAQAKAAADQARAAVVAYETAFAAVVPPPQIAANRSQLISLVATNIFGQNTAAIAATEAEYGEMWAQDTMAMFGYASSSATASRLTPFTAPPQTTNPSGLAGQAAATGQATALASGTNAVTTALSSAAAQFPFDIIPTLLQGLATLSTQYTQLMGQLINAIFGPTGATTYQNLFVTAANVTKFSTWANDAMSAPNLGMTEFKVFWQPPPAPEIPKSSLGAGLGLRSGLSAGLAHAASAGLGQANLVGDLSVPPSWASATPAVRLVANTLPATSLAAAPATQIPANLLGQMALGSMTGGALGAAAPAIYTGSGARARANGGTPSAEPVKLEAVIAQLQKQPDAVRHWNVDKADLDGLLDRLSKQPGIHAVHVSNGDKPKVALPDTQLGSH
>NZ_CP022577.1|WP_003901258.1|1655195_1656425_-|PPE-family-protein
MDFGALPPEINSGRMYAGPGSGPLLAAAAAWDALAAELYSAAASYGSTIEGLTVAPWMGPSSITMAAAVAPYVAWISVTAGQAEQAGAQAKIAAGVYETAFAATVPPPVIEANRALLMSLVATNIFGQNTPAIAATEAHYAEMWAQDAAAMYGYAGSSATASQLAPFSEPPQTTNPSATAAQSAVVAQAAGAAASSDITAQLSQLISLLPSTLQSLATTATATSASAGWDTVLQSITTILANLTGPYSIIGLGAIPGGWWLTFGQILGLAQNAPGVAALLGPKAAAGALSPLAPLRGGYIADITPLGGGATGGIARAIYVGSLSVPQGWAEAAPVMRAVASVLPGTGAAPALAAEAPGALFGEMALSSLAGRALAGTAVRSGAGAARVAGGSVTEDVASTTTIIVIPAD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_4

2765661-2765822

Orphan

Consensus_repeat	Method
GCCGCCGGCCCCGCCAGC	CRT

3 spacers

csa3

The CRISPR arrays of NZ_CP022577_4

>merge|NZ_CP022577|4|2765661-2765822|CRT
CCCGCCGGCCCCGCCGGCCCCGCCGTTACCGCCGTTGCCGATCAGCCCGGCCTTGCCGCCGGCCCCGCCAGCGCCGCCGAGGTCGGTTCGGCCGGAGCCGCCGGCCCCGCCAGCGCCGCCGGAGCCGAACAGCAGGCCGGCGTCGCCGCCGGCCGCCCCAGG

>NZ_CP022577|4|3|2765661-2765822|CRT
CCCGCCGGCCCCGCCGGC	CCCGCCGTTACCGCCGTTGCCGATCAGCCCGGCCTT
GCCGCCGGCCCCGCCAGC	GCCGCCGAGGTCGGTTCGGCCGGA
GCCGCCGGCCCCGCCAGC	GCCGCCGGAGCCGAACAGCAGGCCGGCGTC
GCCGCCGGCCGCCCCAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_106420792.1\|2756719_2757532_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|316372
NZ_CP022577.1\|WP_003901917.1\|2775171_2776338_+\|tRNA-dihydrouridine-synthase-DusB	unknown	unknown	gnl\|CDD\|129820
NZ_CP022577.1\|WP_010950453.1\|2760176_2760899_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227186
NZ_CP022577.1\|WP_003898602.1\|2772128_2773184_-\|DUF2236-domain-containing-protein	unknown	unknown	gnl\|CDD\|226188
NZ_CP022577.1\|WP_003404376.1\|2755791_2756652_+\|proline-specific-peptidase-family-protein	unknown	unknown	gnl\|CDD\|188121
NZ_CP022577.1\|WP_003898600.1\|2776503_2778558_+\|LCP-family-protein	unknown	unknown	gnl\|CDD\|273029
NZ_CP022577.1\|WP_003404352.1\|2769108_2769924_+\|TIGR04255-family-protein	unknown	unknown	gnl\|CDD\|275082
NZ_CP022577.1\|WP_003404362.1\|2761511_2762156_-\|sensor-domain-containing-protein	unknown	unknown	gnl\|CDD\|372884
NZ_CP022577.1\|WP_003404349.1\|2769942_2770848_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|225852
NZ_CP022577.1\|WP_010886090.1\|2762623_2765272_+\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422
NZ_CP022577.1\|WP_003900218.1\|2770952_2771243_-\|transposase	unknown	unknown	gnl\|CDD\|223747
NZ_CP022577.1\|WP_003404368.1\|2759077_2760106_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227198
NZ_CP022577.1\|WP_003404335.1\|2771684_2772077_+\|Ni(II)/Co(II)-sensing-metalloregulatory-transcriptional-repressor-KmtR	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|197713
NZ_CP022577.1\|WP_003404379.1\|2755273_2755516_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003898607.1\|2760979_2761531_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003404321.1\|2774067_2775084_+\|acyl-ACP-desaturase-DesA1	unknown	unknown	gnl\|CDD\|153109
NZ_CP022577.1\|WP_003898609.1\|2757618_2758389_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|279735
NZ_CP022577.1\|WP_003901918.1\|2773264_2773906_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP022577.1\|WP_003404336.1\|2771204_2771627_+\|nucleoside-deaminase	unknown	unknown	gnl\|CDD\|223663
NZ_CP022577.1\|WP_003404382.1\|2753704_2754997_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_106420792.1\|2756719_2757532_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|316372	pfam13847, Methyltransf_31, Methyltransferase domain. This family appears to have methyltransferase activity.	7.36537e-31
NZ_CP022577.1\|WP_003901917.1\|2775171_2776338_+\|tRNA-dihydrouridine-synthase-DusB	gnl\|CDD\|129820	TIGR00737, Probable_tRNA-dihydrouridine_synthase, putative TIM-barrel protein, nifR3 family. This model represents one branch of COG0042 (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family). This branch includes NifR3 itself, from Rhodobacter capsulatus. It excludes a broadly distributed but more sparsely populated subfamily that contains sll0926 from Synechocystis PCC6803, HI0634 from Haemophilus influenzae, and BB0225 from Borrelia burgdorferi. It also excludes a shorter and more distant archaeal subfamily.The function of nifR3, a member of this family, is unknown, but it is found in an operon with nitrogen-sensing two component regulators in Rhodobacter capsulatus.Members of this family show a distant relationship to alpha/beta (TIM) barrel enzymes such as dihydroorotate dehydrogenase and glycolate oxidase. [Unknown function, General].	2.05801e-165
NZ_CP022577.1\|WP_003898602.1\|2772128_2773184_-\|DUF2236-domain-containing-protein	gnl\|CDD\|226188	COG3662, COG3662, Uncharacterized protein conserved in bacteria [Function unknown].	7.60533e-137
NZ_CP022577.1\|WP_003404376.1\|2755791_2756652_+\|proline-specific-peptidase-family-protein	gnl\|CDD\|188121	TIGR01250, Proline_iminopeptidase, proline-specific peptidase, Bacillus coagulans-type subfamily. This model describes a subfamily of the alpha/beta fold family of hydrolases. Characterized members include prolinases (Pro-Xaa dipeptidase, EC 3.4.13.8), prolyl aminopeptidases (EC 3.4.11.5), and a leucyl aminopeptidase.	8.19399e-156
NZ_CP022577.1\|WP_003404352.1\|2769108_2769924_+\|TIGR04255-family-protein	gnl\|CDD\|275082	TIGR04255, hypothetical_protein, TIGR04255 family protein. Members of this uncharacterized protein family are found broadly but sporadically among bacteria and archaea, including members of the genera Mycobacterium, Nostoc, Acinetobacter, Planctomyces, Geobacter, Streptomyces, Methanospirillum, etc. The function is unknown.	1.96412e-45
NZ_CP022577.1\|WP_003404362.1\|2761511_2762156_-\|sensor-domain-containing-protein	gnl\|CDD\|372884	pfam14032, PknH_C, PknH-like extracellular domain. This domain is functionally uncharacterized. It is found as the periplasmic domain of the bacterial protein kinase PknH. The domain is also found in isolation in numerous proteins, for example the lipoproteins lpqQ, lprH, lppH and lpqA from M. tuberculosis. This family of proteins is found in bacteria. Proteins in this family are typically between 214 and 268 amino acids in length. There are two completely conserved C residues that are likely to form a disulphide bond. A second pair of cysteines are less well conserved probably form a second disulphide bond. It seems likely that this domain functions to bind some as yet unknown ligand.	1.2663e-18
NZ_CP022577.1\|WP_003404349.1\|2769942_2770848_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|225852	COG3315, COG3315, O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism].	4.29544e-95
NZ_CP022577.1\|WP_010886090.1\|2762623_2765272_+\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	5.97682e-28
NZ_CP022577.1\|WP_003900218.1\|2770952_2771243_-\|transposase	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.02344e-12
NZ_CP022577.1\|WP_003404368.1\|2759077_2760106_+\|hypothetical-protein	gnl\|CDD\|227198	COG4861, COG4861, Uncharacterized protein conserved in bacteria [Function unknown].	5.33791e-171
NZ_CP022577.1\|WP_003404335.1\|2771684_2772077_+\|Ni(II)/Co(II)-sensing-metalloregulatory-transcriptional-repressor-KmtR	gnl\|CDD\|197713	smart00418, HTH_ARSR, helix_turn_helix, Arsenical Resistance Operon Repressor.	9.15024e-22
NZ_CP022577.1\|WP_010950453.1\|2760176_2760899_+\|hypothetical-protein	gnl\|CDD\|227186	COG4849, COG4849, Predicted nucleotidyltransferase [General function prediction only].	2.67323e-113
NZ_CP022577.1\|WP_003898600.1\|2776503_2778558_+\|LCP-family-protein	gnl\|CDD\|273029	TIGR00350, Transcriptional_regulator_LytR, cell envelope-related function transcriptional attenuator common domain. This model describes a domain of unknown function that is found in the predicted extracellular domain of a number of putative membrane-bound proteins. One of these is proteins psr, described as a penicillin binding protein 5 (PDP-5) synthesis repressor. Another is Bacillus subtilis LytR, described as a transcriptional attenuator of itself and the LytABC operon, where LytC is N-acetylmuramoyl-L-alanine amidase. A third is CpsA, a putative regulatory protein involved in exocellular polysaccharide biosynthesis. Besides the region of strong similarily represented by this model, these proteins share the property of having a short putative N-terminal cytoplasmic domain and transmembrane domain forming a signal-anchor. [Regulatory functions, Other].	3.89123e-67
NZ_CP022577.1\|WP_003404321.1\|2774067_2775084_+\|acyl-ACP-desaturase-DesA1	gnl\|CDD\|153109	cd01050, Acyl_ACP_Desat, Acyl ACP desaturase, ferritin-like diiron-binding domain. Acyl-Acyl Carrier Protein Desaturase (Acyl_ACP_Desat) is a mu-oxo-bridged diiron-carboxylate enzyme, which belongs to a broad superfamily of ferritin-like proteins and catalyzes the NADPH and O2-dependent formation of a cis-double bond in acyl-ACPs. Acyl-ACP desaturases are found in higher plants and a few bacterial species (Mycobacterium tuberculosis, M. leprae, M. avium and Streptomyces avermitilis, S. coelicolor). In plants, Acyl-ACP desaturase is a plastid-localized, covalently ACP linked, soluble desaturase that introduces the first double bound into saturated fatty acids, resulting in the corresponding monounsaturated fatty acid. Members of this class of soluble desaturases are specific for a particular substrate chain length and introduce the double bond between specific carbon atoms. For example, delta 9 stearoyl-ACP is specific for stearic acid and introduces a double bond between carbon 9 and 10 to yield oleic acid in the ACP-bound form. The enzymatic reaction requires molecular oxygen, NAD(P)H, NAD(P)H ferredoxin oxido-reductase and ferredoxin. The enzyme is active in the homodimeric form; the monomer consists mainly of alpha-helices with the catalytic diiron center buried within a four-helix bundle. Integral membrane fatty acid desaturases that introduce double bonds into fatty acid chains, acyl-CoA desaturases of animals, yeasts, and fungi, and acyl-lipid desaturases of cyanobacteria and higher plants, are distinct from soluble acyl-ACP desaturases, lack diiron centers, and are not included in this CD.	1.08695e-140
NZ_CP022577.1\|WP_003898609.1\|2757618_2758389_-\|hypothetical-protein	gnl\|CDD\|279735	pfam01427, Peptidase_M15, D-ala-D-ala dipeptidase.	1.08627e-95
NZ_CP022577.1\|WP_003901918.1\|2773264_2773906_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.27357e-08
NZ_CP022577.1\|WP_003404336.1\|2771204_2771627_+\|nucleoside-deaminase	gnl\|CDD\|223663	COG0590, CumB, Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis].	8.91868e-24
NZ_CP022577.1\|WP_003404382.1\|2753704_2754997_-\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.02174e-28

>NZ_CP022577.1|WP_010886090.1|2762623_2765272_+|PE-family-protein
MSFVIAAPDLVAMATEDLAGIGASLTAANAAAAVPTSGLLAAAGDEVSAAIAALFSSHGQQYQAMSAQAAAFHARFVQALAGAMGAYAAAEAANASPLQTLEQGLLGAINAPAAALSGRPFIGNGTNGAPGTGEAGGPGGWLLGNGGNGGSGAPGQTGGAGGAAGLLGHGGTGGAGGTGASGGKGGTGGWLWGSGGAGGAGGSGGGSGGAGGNALMFGIGGNGGAGGAASGVGNGGVGGAGGAGGALVAIGGAGGAGGAATTGTGGAGGAGSNALGLFLGLGGSGGQGGDSAMGSGGAGGAGGSGGAASPFGIDIGIGGAGGHGGAGTNGGAGGAGGAGGSSGTVFALDLSWGGAGGNGGAATTGTGGAGGTGGFAVAPDFIGFGAAYGGAGGLGGAATGAGGTGGTGGVGAGGFAALGVGVGGAGGAGGAATETGGIGGAGGLGVGLLGGAGGAGGPGGAASAGSGGHGGTGGDALGLIGAGIGGVGGVGGAATDTGGNGGAGGSGTGLLGGVGGAGGHGGGASVGTGGSGGAGGDGFGFVGAGGNGGNAGTGVGVNGANGGNGGSATGALAAVGGAGAAGGDATSGTGGFGGAGGSARGLIFALGGAGAAGGDASTGVGGPGGPGGTGTASSPFGIAIAIGGAGAQGGAGTSGATGGAGGDGVFEGIAVLGLGFGGAAGAGGAATGDGATGGAGGFGGAGAGIANFLGFSVLHGGAGGAGGTATGTGGNGGAGGGGGLSSPVILGIGIGGAGGDGGGALGVLGGMGGDGGDGGEAVAVGIAVGGAGGAGGAAPTGNGGAGGNGGDALGLVGVGGNGGNAGTGFGANTGGNGGDTTIVVNGMLAPSTLGYGGNGGNGVNGGAGGTGGKAGVFGAPGQNGLP
>NZ_CP022577.1|WP_003404362.1|2761511_2762156_-|sensor-domain-containing-protein
MCCSTAAKSAVIVCCAAIATTACSFQATSTQPSTAPPTSRVDSLIVSIEDVRRIANYEELAAHFQTDLREPPEADTNVPGPCRVVGSSDRTFGTDWSEFRSAGYHGVTDDLRPGGPVMVETVSQAIALYPDPSTARGVFHRLESSLAECAGLHDPYFDFILDRPDASTVRIGAAGWSHVYRLKSSVFISVGVLGIEPAEPIANVILQTISDRIQ
>NZ_CP022577.1|WP_003898607.1|2760979_2761531_+|hypothetical-protein
MKAATSWMQQQVLATATVVRWRLAWLSKPETWRRRKRRQSQKIRRSVQKQRRSTVWDNQRKTFGVVISPARLTAWIAASALILLTGTELFGTALSWVKLSPIWHVFSFAVDTRPIATLLDYASHPIDPRSYSSVAVTAVGAEATLLAFFFATVGVVASTALNTLRSSPPLLLSSPRLTTGCDR
>NZ_CP022577.1|WP_010950453.1|2760176_2760899_+|hypothetical-protein
MLVGAQCRDLLHWRFCRGVPPRATNDTDIAGTLNNWDHFEAIRATFRALGSTGHRFLIADRAVDALPFGEVESPTGTTRHPPGNQLMNVHGCTDAYLRADVLPLPGGLTVHLPQPPNYAVLKLHAWLDRSADHDYKDGPDLALVVHWYAGDLDRLYAKPDQWALRRHDFDLRTAAAALLGHDMRASVSAPEAAVLATRATQADHDLLAQHFAVGRPGWPTTTASRRPLVEALLDQLTPGS
>NZ_CP022577.1|WP_003404368.1|2759077_2760106_+|hypothetical-protein
MDQIGADLAEAVERHLTEYGVRVLGGLSALNSAHPESLDLEIDAHPLTITALYLPHLSATAALQAWDTAGAGSPLLVVGPRLHPSSAETLRARGLWYIDGAGNAYLRHQGGLLIDVRGRRSAVSAQPGTLGDGLHSDGPRNPFTPKRAQVVCVLLDAPQLVDAPLRAIAASAGVSVGMAKETMDTLRTTGFFEHLGSRRRLVRTDELLDLWAAAYPGGLGRANKLLVASGDIHTWSAPDGLAVAVSGEQALPDEIRNPESLMLYVDTPAPGLPADLLIHNRWHRDPHGSIVIRKLFWRNLPDEQPGLAPTALIYADLLASREPRQVEVAHLMRRQDERLARL
>NZ_CP022577.1|WP_003898609.1|2757618_2758389_-|hypothetical-protein
MRLIGRLRLLMVGLVVICGACACDRVSAGRWSESPSATSWPVRPVNTTTPSGPVPPVSEAARAAGLVDVRGVVPDAAIDLRYATANNFTGTQLYPPGARCLVHESMAEGLAAAAAVLRPHGQVLVFWDCYRPHDVQVRMFDVVPNPAWVARPGKYAHSHEAGRSVDVTFASAQRQCPSVRRSGELCLADMGTDFDDFSSRATAFATQGVSAEAQANRAHLRAAMQAGGLTVYSGEWWHFDGPGAGVDRPILEVPVD
>NZ_CP022577.1|WP_106420792.1|2756719_2757532_-|class-I-SAM-dependent-methyltransferase
MNDKRRAIYTHGYHESVLRSHRRRTAENSAGYLLPYLVPGLSVLDVGCGPGTITVDLAARVVPGSVTGVEPTDDALSLARAEAQLHRLSNISFTTSDVHKLDFPDDAFDVVHAHQVLQHVADPVRALQEMRRVCTPGGIVAARDADYSGFIWFPKLPALDRWLDLYERAARANGGEPDAGRRLLPWARAAGFDDVTPTASVWCFATASAREWWGLVWADRILQSDLAHQLVDSGLATAAQLEEISTAWREWAAAPDGWLAIPHGEILCRA
>NZ_CP022577.1|WP_003404376.1|2755791_2756652_+|proline-specific-peptidase-family-protein
MEGTIAVPGGRVWFQRIGGGPGRPLLVVHGGPGLPHNYLAPLRRLSDEREVIFWDQLGCGNSACPSDVDLWTMNRSVAEMATVAEALALTRFHIFSHSWGGMLAQQYVLDKAPDAVSLTIANSTASIPEFSASLVSLKSCLDVATRSAIDRHEAAGTTHSAEYQAAIRTWNETYLCRTRPWPRELTEAFANMGTEIFETMFGPSDFRIVGNVRDWDVVDRLADIAVPTLLVVGRFDECSPEHMREMQGRIAGSRLEFFESSSHMPFIEEPARFDRVMREFLRLHDI
>NZ_CP022577.1|WP_003404379.1|2755273_2755516_-|hypothetical-protein
MVAASIVHHSAAPANRGRYHGIWSMTPVVASVVVPIMASYGPIHGAHLLAAVVVGSAGAALCLPLARALRRPTPSAMTTD
>NZ_CP022577.1|WP_003404382.1|2753704_2754997_-|MFS-transporter
MRYTGPERCSGDGQVRAAGDRYSTVIWLLGGNLLVRSAGFGYPFLAYHVAGRGHGAGAVGAVVAAYGLGWAVGQLLCGWLVDRVGARVTLVSTMLVAAAVLVLMAGLHTVPGLLVGAMIAGLVCDAPRPVLGAVIAELVADPQRRAQLDGWRYGWVLNIGAAITGGVGGVVAGWLDTPVLYWINGIGCAIFAGLAGRCIPADVCRRTESGLRACTAMSKVGYRQALSDKRLVLLAVSGLATLTTLMGFFAAVPMLMSASGLGVGAYGWVQLINALAVVAVTPLLTPWLSKQLALGPRPDILAGAGVWVTLCMAAAGLARTTVGFSVAAAACSPGEIAWFVVAAGIVHRIAPPAHGGRYHGIWSMAVAASSVAAPILAAFNLANGGRLVLAATTVTVGFFGAALCLPLARVLAAASCGPLSSKEPSRDSYQ
>NZ_CP022577.1|WP_003404352.1|2769108_2769924_+|TIGR04255-family-protein
MLPETNQDEVQPNAPVALVTVEIRHPTTDSLTESANRELKHLLINDLPIERQAQDVSWGMTAPGGAPTPVADRFVRYVNRDNTTAASLKNQAIVVETTAYRSFEAFTDVVMRVVDARAQVSSIVGLERIGLRFVLEIRVPAGVDGRITWSNWIDEQLLGPQRFTPGGLVLTEWQGAAVYRELQPGKSLIVRYGPGMGQALDPNYHLRRITPAQTGPFFLLDIDSFWTPSGGSIPEYNRDALVSTFQDLYGPAQVVFQEMITSRLKDELLRQ
>NZ_CP022577.1|WP_003404349.1|2769942_2770848_-|class-I-SAM-dependent-methyltransferase
MVRADRDRWDLATSVGATATMVAAQRALAADPRYALIDDPYAAPLVRAVGMDVYTRLVDWQIPVEGDSEFDPQRMATGMACRTRFFDQFFLDATHSGIGQFVILASGLDARAYRLAWPVGSIVYEVDMPEVIEFKTATLSDLGAEPATERRTVAVDLRDDWATALQTAGFDPKVPAAWSAEGLLVYLPVEAQDALFDNITALSAPGSRLAFEFVPDTAIFADERWRNYHNRMSELGFDIDLNELVYHGQRGHVLDYLTRDGWQTSALTVTQLYEANGFAYPDDELATAFADLTYSSATLMR
>NZ_CP022577.1|WP_003900218.1|2770952_2771243_-|transposase
MGPSSKTCHACRHVQDIGWDEKWQCDGCSITHQRDDNAAINLARYEEPPSVVGPVGAAVKRGADRKTGPGPAGGREARKGTGHPAGEQPRDGVLVA
>NZ_CP022577.1|WP_003404336.1|2771204_2771627_+|nucleoside-deaminase
MPAGMAGFRRWAQTNDPTAHAESLAIRAACTKLGTEHLVGTTLNVLAHPCPMCYGSLYYCSPDEVVFLTSRDAYEPHYVDDRRYFEPATFYDEFAKEWQDRRLPMRQEHRPDIRAGAVDVYRFRQEPNGGERSAIAAPTG
>NZ_CP022577.1|WP_003404335.1|2771684_2772077_+|Ni(II)/Co(II)-sensing-metalloregulatory-transcriptional-repressor-KmtR
MYADSGPDPLPDDQVCLVVEVFRMLADATRVQVLWSLADREMSVNELAEQVGKPAPSVSQHLAKLRMARLVRTRRDGTTIFYRLENEHVRQLVIDAVFNAEHAGPGIPRHHRAAGGLQSVAKASATKDVG
>NZ_CP022577.1|WP_003898602.1|2772128_2773184_-|DUF2236-domain-containing-protein
MTQDTSATCPLTSTVQDSSPVAGQLGRPIGFRGLAGGCPVSPLGYESPPLPLGPDSLTWRYFGDWRGMLQGPWAGSMQNMHPQLGAAVEDHSTFFRERWPRLLRSLYPIGGVVFDGDRAPVTGVQVRDYHITIKGVDGAGRRYHALNPDVFYWAHATFFVGTLHVAERFCGGLTEAQRRQLFDEHVQWYRMYGMSMRPVPATWEEFQDYWDHMCRNVLENNFAARAVLDLTELPKPPFAQRVPDWLWAAPRKLLARFFVWLTVGLYDPPVRELMGYRWLRRDEWLHRRFGDIVRLVFALVPFRFRKHPRARAGWDRATGRIPADAPLVQTPARNLPPPDERDNPTHYCPKV
>NZ_CP022577.1|WP_003901918.1|2773264_2773906_+|TetR/AcrR-family-transcriptional-regulator
MQTGQNRGRWSGVPLESRHALRRDNLVAAGVQLLGGAGGPALTVRAVCRHAGLTERYFYESFADREHCVRAVYDDVCTRAMATLTSAQTPREAVEQFVELMVDDPVRGRVLLLAPAVEPALTRSGAEWMPNFIELLQRKLSRIVDPVLQKLVATSLIGALTGLFTAYLNGRLGATRKQFIDYCVNMLLSTAATYAPHRERGESEHSIPAGPHN
>NZ_CP022577.1|WP_003404321.1|2774067_2775084_+|acyl-ACP-desaturase-DesA1
MSAKLTDLQLLHELEPVVEKYLNRHLSMHKPWNPHDYIPWSDGKNYYALGGQDWDPDQSKLSDVAQVAMVQNLVTEDNLPSYHREIAMNMGMDGAWGQWVNRWTAEENRHGIALRDYLVVTRSVDPVELEKLRLEVVNRGFSPGQNHQGHYFAESLTDSVLYVSFQELATRISHRNTGKACNDPVADQLMAKISADENLHMIFYRDVSEAAFDLVPNQAMKSLHLILSHFQMPGFQVPEFRRKAVVIAVGGVYDPRIHLDEVVMPVLKKWRIFEREDFTGEGAKLRDELALVIKDLELACDKFEVSKQRQLDREARTGKKVSAHELHKTAGKLAMSRR
>NZ_CP022577.1|WP_003901917.1|2775171_2776338_+|tRNA-dihydrouridine-synthase-DusB
MSRRRAIQPSPALRIGPIELASPVVLAPMAGVTNVAFRALCRQLEQSKVGTVSGLYVCEMVTARALIERHPVTMHMTTFSADESPRSLQLYTVDPDTTYAAARMIAGEGLADHIDMNFGCPVPKVTKRGGGAALPFKRRLFGQIVAAAVRATEGTDIPVTVKFRIGIDDAHHTHLDAGRIAEAEGAAAVALHARTAAQRYSGTADWEQIARLKQHVRTIPVLGNGDIYDAGDALAMMSTTGCDGVVIGRGCLGRPWLFAELSAAFTGSPAPTPPTLGEVADIIRRHGTLLAAHFGEDKGMRDIRKHIAWYLHGFPAGSARRALAMVKTFDELDCLLDRLDGTVPFPDSATGARGRQGSPARVALPDGWLTDPDDCRVPEGADAMGSGG
>NZ_CP022577.1|WP_003898600.1|2776503_2778558_+|LCP-family-protein
MSDGESAAPWARLSESAFPDGVDRWITVPPATWVAAQGPRDTQNVGCHATGAVSVADLIARLGPAFPDLPTHRHVAPEPEPSGRGPKVHDDADDQQDTEAIAIPAHSLEFLSELPDLRAANYPRADHARREPELPGKQLTGSARVRPLRIRRTSPAPAKPAPNSGRRPMVLAARSLAALFAALALALTGGAWQWSASKNSRLNMVSALDPHSGDIVNPSGQHGDENFLLVGMDSRAGANANIGAGDAEDAGGARSDTVMLVNIPASRERVVAVSFPRDLAITPIQCEAWNPETGKYGPIYDEKTGTMGPRLVYTETKLNSAFSFGGPKCLVKVIQKLSGLSINRFIAIDFVGFARMVEALGGVEVCSTTPLRDYELGTVLEHAGRQVIDGPTALNYVRARQVTTESNGDYGRIKRQQLFLSSLLRSMISTDTLFNLSRLNNVVNMFIGNSYVDNVKTKDLVELGRSLQHMAAGHVTFVTVPTGITDQNGDEPPRTSDMKALFTAIIDDDPLPLENDHNAQRLGNTPSTPPTTTKKAPQAGLTNEIQHQQVTTTSPKEVTVQVSNSTGQAGLATTATDQLKRNGFNVMAPDDYPSSLLATTVFFSPGNEQAAATVAAVFGQSKIERVTGIGQLVQVVLGQDFSAVRAPLPSGSTVSVQISRNSSSPPTKLPEDLTVTNAADTTCE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_5

2854704-2855675

Orphan

Consensus_repeat	Method
NNNCCGCCGGCNCCGCCG	CRT

17 spacers

The CRISPR arrays of NZ_CP022577_5

>merge|NZ_CP022577|5|2854704-2855675|CRT
TTGGCGCCGGTGCCGCCGTTGCCGCCGTTGCCGCCGGTGCCGATCAGCCCGGCGCTGCCGCCGACGCCACCGGCCCCGCCGGTGTCGCCGACGCTTAAGGCTGCGCCGCCTTCGCCGCCGGCGCCGCCGCTACCCCATAACTGACCGCCGGTGCCGCCGTTCCCACCGGCGCCCCCGTTAGCGTTACCGCCGATTCCGCCGATGCCCCCGGCCCCGCCGAAGCCCAGCCAGCCGGCATTGCCGCCGGCCCCACCGACCCCACCGGCGGTGCCGAACCCGCCGAACCCGCCGGCCCCGCCGCTGGACAACAGCAGCCCGGCGTTGCCACCGGCCCCGCCGTCCCCACCGAGGAAACCAAATCCGCCGGCGCCGCCGGCGCCGCCGCTGCCGAACAGCAGCCCTGCGCTACCGCCGGCCCCGCCGTCCCCACCGGTGTCCAGGTTTTCGCCGTCACCGCCGGCTCCGCCGGCGCCGCCCGGCCCGGCGAGCATTCCGGCATTCCCGCCGGCCCCGCCAACCCCGCCGTCGCCATTAGTGCTGAGCCCGCCGGTCCCGCCGTGACCTCCGCCGGCACCGATCAGCCCGGCCAGCAGTCCGCCGGTCCCGCCGGCCCCACCGGCCCCGCCGTCGCCACCAACAAGGCCGGTTCCACCGGCCCCGCCGGCCCCACCGGCGCCCCACAGCCCACCGACCCCGCCTCCCCCGCCGGTGCCGCCGAGTACGGTGCTGGCTCCGCCGATCCCGCCGGCCCCGCCGTCGCCGAGCAGCCAGCCGCCGGCCCCGCCGGCCCCACCGGCCCCGCCGCCACCCGCCGAGCTGCCTCCGGCCCCGCCGGCCCCGCCGGTACCCCACAGCCCGGCAGCCCCGCCCGCCCCGCCGGGCGCGCCCGAGCCCGCCGCGCCGGACCCGCCGGCCCCGCCGTCGCCGAGCAGCCACCCACCGGGGGCCCCGGTGGCCCCGCTGCCGACCGCC

>NZ_CP022577|5|4|2854704-2855675|CRT
TTGGCGCCGGTGCCGCCG	TTGCCGCCGTTGCCGCCGGTGCCGATCAGCCCGGCGCTGCCGCCGACGCCACCGGCCCCGCCGGTGTCGCCGACGCTTAAGGCTGCGCCGCCT
TCGCCGCCGGCGCCGCCG	CTACCCCATAACTGACCGCCGGTGCCGCCGTTCCCACCGGCGCCCCCGTTAGCGTTACCGCCGATTCCGCCG
ATGCCCCCGGCCCCGCCG	AAGCCCAGCCAGCCGGCATTGCCGCCGGCCCCACCGACCCCACCGGCGGTGCCGAACCCGCCG
AACCCGCCGGCCCCGCCG	CTGGACAACAGCAGCCCGGCGTTGCCACCGGCCCCGCCGTCCCCACCGAGGAAACCA
AATCCGCCGGCGCCGCCG	GCGCCGCCGCTGCCGAACAGCAGCCCTGCG
CTACCGCCGGCCCCGCCG	TCCCCACCGGTGTCCAGGTTTTCGCCG
TCACCGCCGGCTCCGCCG	GCGCCGCCCGGCCCGGCGAGCATTCCGGCA
TTCCCGCCGGCCCCGCCA	ACCCCGCCGTCGCCATTAGTGCTG
AGCCCGCCGGTCCCGCCG	TGACCTCCGCCGGCACCGATCAGCCCGGCCAGCAGTCCGCCG
GTCCCGCCGGCCCCACCG	GCCCCGCCGTCGCCACCAACAAGGCCGGTTCCACCG
GCCCCGCCGGCCCCACCG	GCGCCCCACAGCCCACCG
ACCCCGCCTCCCCCGCCG	GTGCCGCCGAGTACGGTGCTGGCTCCGCCG
ATCCCGCCGGCCCCGCCG	TCGCCGAGCAGCCAGCCGCCG
GCCCCGCCGGCCCCACCG	GCCCCGCCGCCACCCGCCGAGCTGCCTCCG
GCCCCGCCGGCCCCGCCG	GTACCCCACAGCCCGGCA
GCCCCGCCCGCCCCGCCG	GGCGCGCCCGAGCCCGCCGCGCCGGACCCGCCG
GCCCCGCCGTCGCCGAGC	AGCCACCCACCGGGGGCCCCGGTG
GCCCCGCTGCCGACCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003901008.1\|2860382_2860910_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003403850.1\|2844901_2846656_-\|phosphoglycerate-mutase-PE_PGRS11	unknown	unknown	gnl\|CDD\|376422
NZ_CP022577.1\|WP_003403837.1\|2851158_2851587_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|350245
NZ_CP022577.1\|WP_003403839.1\|2850940_2851078_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003910986.1\|2857004_2857532_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274800
NZ_CP022577.1\|WP_003403844.1\|2849583_2850468_+\|3-hydroxyisobutyrate-dehydrogenase	unknown	unknown	gnl\|CDD\|130753
NZ_CP022577.1\|WP_003906436.1\|2862774_2862987_-\|PE-domain-containing-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003403847.1\|2846861_2848394_+\|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143404
NZ_CP022577.1\|WP_003403741.1\|2862077_2862626_-\|TIGR03086-family-protein	unknown	unknown	gnl\|CDD\|274424
NZ_CP022577.1\|WP_012054246.1\|2850536_2850782_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003403827.1\|2857739_2858246_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378935
NZ_CP022577.1\|WP_003403834.1\|2851610_2851868_-\|ribbon-helix-helix-protein,-CopG-family	unknown	unknown	gnl\|CDD\|279710
NZ_CP022577.1\|WP_003901009.1\|2859177_2859705_-\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422
NZ_CP022577.1\|WP_003403820.1\|2858242_2858800_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003901007.1\|2861024_2861873_-\|DUF4226-domain-containing-protein	unknown	unknown	gnl\|CDD\|371237
NZ_CP022577.1\|WP_003403828.1\|2857480_2857627_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|130753
NZ_CP022577.1\|WP_003898574.1\|2842774_2844712_+\|PPE-family-protein	unknown	unknown	gnl\|CDD\|366325
NZ_CP022577.1\|WP_003403845.1\|2848400_2849573_+\|acyl-CoA-dehydrogenase-FadE9	unknown	unknown	gnl\|CDD\|173851
NZ_CP022577.1\|WP_003403738.1\|2862983_2863481_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP022577.1\|WP_016330384.1\|2851958_2854232_-\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003403850.1\|2844901_2846656_-\|phosphoglycerate-mutase-PE_PGRS11	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	2.38913e-31
NZ_CP022577.1\|WP_003403837.1\|2851158_2851587_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|350245	cd18678, PIN_MtVapC25_VapC33-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC25, VapC33, and related proteins. This subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC25, VapC29, VapC33, VapC37, and VapC39 toxins. It belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is a PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include FitB toxin of the FitAB TA system, eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	1.48948e-57
NZ_CP022577.1\|WP_003910986.1\|2857004_2857532_-\|hypothetical-protein	gnl\|CDD\|274800	TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase. A conserved gene neighborhood widely spread in the Actinobacteria contains this uncharacterized DEAH-box family helicase encoded convergently towards an operon of genes for protein homologous to type II secretion and pilus formation proteins. The context suggests that this helicase may play a role in conjugal transfer of DNA.	1.73548e-11
NZ_CP022577.1\|WP_003403844.1\|2849583_2850468_+\|3-hydroxyisobutyrate-dehydrogenase	gnl\|CDD\|130753	TIGR01692, 3-hydroxyisobutyrate_dehydrogenase_mitochondrial, 3-hydroxyisobutyrate dehydrogenase. 3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway. In Pseudomonas aeruginosa, 3-hydroxyisobutyrate dehydrogenase (mmsB) is co-induced with methylmalonate-semialdehyde dehydrogenase (mmsA) when grown on medium containing valine as the sole carbon source. The positive transcriptional regulator of this operon (mmsR) is located upstream of these genes and has been identified as a member of the XylS/AraC family of transcriptional regulators. 3-hydroxyisobutyrate dehydrogenase shares high sequence homology to the characterized 3-hydroxyisobutyrate dehydrogenase from rat liver with conservation of proposed NAD+ binding residues at the N-terminus (G-8,10,13,24 and D-31). This enzyme belongs to the 3-hydroxyacid dehydrogenase family, sharing a common evolutionary origin and enzymatic mechanism with 6-phosphogluconate. HIBADH exhibits sequence similarity to the NAD binding domain of 6-phosphogluconate dehydrogenase above trusted (pfam03446). [Energy metabolism, Amino acids and amines].	3.51879e-107
NZ_CP022577.1\|WP_003403847.1\|2846861_2848394_+\|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase	gnl\|CDD\|143404	cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2. Methylmalonate semialdehyde dehydrogenase (MMSDH, EC=1.2.1.27) [acylating] from Bacillus subtilis is involved in valine metabolism and catalyses the NAD+- and CoA-dependent oxidation of methylmalonate semialdehyde into propionyl-CoA. Mitochondrial human MMSDH ALDH6A1 and Arabidopsis MMSDH ALDH6B2 are also present in this CD.	0
NZ_CP022577.1\|WP_003403741.1\|2862077_2862626_-\|TIGR03086-family-protein	gnl\|CDD\|274424	TIGR03086, TIGR03086, TIGR03086 family protein. This family, like pfam07398 and TIGRFAMs family TIGR030834, belongs to the larger set of probable enzymes defined in family TIGR03083. Members are found primarily in the Actinobacteria (Mycobacterium, Streptomyces, etc.). The family is uncharacterized.	3.64194e-51
NZ_CP022577.1\|WP_003403827.1\|2857739_2858246_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	2.38196e-09
NZ_CP022577.1\|WP_003403834.1\|2851610_2851868_-\|ribbon-helix-helix-protein,-CopG-family	gnl\|CDD\|279710	pfam01402, RHH_1, Ribbon-helix-helix protein, copG family. The structure of this protein repressor, which is the shortest reported to date and the first isolated from a plasmid, has a homodimeric ribbon-helix-helix arrangement. The helix-turn-helix-like structure is involved in dimerization and not DNA binding as might have been expected.	0.00885702
NZ_CP022577.1\|WP_003901009.1\|2859177_2859705_-\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.95525e-20
NZ_CP022577.1\|WP_003901007.1\|2861024_2861873_-\|DUF4226-domain-containing-protein	gnl\|CDD\|371237	pfam10774, DUF4226, Domain of unknown function (DUF4226). This family of mycobacterial proteins are uncharacterized.	7.86697e-27
NZ_CP022577.1\|WP_003403828.1\|2857480_2857627_+\|hypothetical-protein	gnl\|CDD\|130753	TIGR01692, 3-hydroxyisobutyrate_dehydrogenase_mitochondrial, 3-hydroxyisobutyrate dehydrogenase. 3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway. In Pseudomonas aeruginosa, 3-hydroxyisobutyrate dehydrogenase (mmsB) is co-induced with methylmalonate-semialdehyde dehydrogenase (mmsA) when grown on medium containing valine as the sole carbon source. The positive transcriptional regulator of this operon (mmsR) is located upstream of these genes and has been identified as a member of the XylS/AraC family of transcriptional regulators. 3-hydroxyisobutyrate dehydrogenase shares high sequence homology to the characterized 3-hydroxyisobutyrate dehydrogenase from rat liver with conservation of proposed NAD+ binding residues at the N-terminus (G-8,10,13,24 and D-31). This enzyme belongs to the 3-hydroxyacid dehydrogenase family, sharing a common evolutionary origin and enzymatic mechanism with 6-phosphogluconate. HIBADH exhibits sequence similarity to the NAD binding domain of 6-phosphogluconate dehydrogenase above trusted (pfam03446). [Energy metabolism, Amino acids and amines].	6.18581e-07
NZ_CP022577.1\|WP_003898574.1\|2842774_2844712_+\|PPE-family-protein	gnl\|CDD\|366325	pfam00823, PPE, PPE family. This family named after a PPE motif near to the amino terminus of the domain. The PPE family of proteins all contain an amino-terminal region of about 180 amino acids. The carboxyl terminus of this family are variable, and on the basis of this region fall into at least three groups. The MPTR subgroup has tandem copies of a motif NXGXGNXG. The second subgroup contains a conserved motif at about position 350. The third group are only related in the amino terminal region. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	2.8545e-82
NZ_CP022577.1\|WP_003403845.1\|2848400_2849573_+\|acyl-CoA-dehydrogenase-FadE9	gnl\|CDD\|173851	cd01162, IBD, Isobutyryl-CoA dehydrogenase. Isobutyryl-CoA dehydrogenase (IBD) catalyzes the alpha, beta- dehydrogenation of short branched chain acyl-CoA intermediates in valine catabolism. It is predicted to be a homotetramer.	0
NZ_CP022577.1\|WP_003403738.1\|2862983_2863481_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	6.59277e-21
NZ_CP022577.1\|WP_016330384.1\|2851958_2854232_-\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.03344e-28

>NZ_CP022577.1|WP_016330384.1|2851958_2854232_-|PE-family-protein
MSWVMVSPELVVAAAADLAGIGSAISSANAAAAVNTTGLLTAGADEVSTAIAALFGAQGQAYQAASAQAAAFYAQFVQALSAGGGAYAAAEAAAVSPLLAPINAQFVAATGRPLIGNGANGAPGTGANGGPGGWLIGNGGAGGSGAPGAGAGGNGGAGGLFGSGGAGGASTDVAGGAGGAGGAGGNAGMLFGAAGVGGVGGFSNGGATGGAGGAGGAGGLFGAGGEGGSGGSGNLTGGAGGAGGNAGTLATGDGGAGGTGGASRSGGFGGAGGAGGDAGMFFGSGGSGGAGGISRSVGDGAAGGAGGAPGLIGNGGNGGNGGASTGGGDGGPGGAGGTGVLIGNGGNGGSGGTGATLGKAGIGGTGGVLLGLDGFTAPASTSPLHTLQQDVINMVNDPFQTLTGRPLIGNGANGTPGTGADGGAGGWLFGNGGNGGQGTIGGVNGGAGGAGGAGGILFGTGGTGGSGGPGATGLGGIGGAGGAALLFGSGGAGGSGGAGAVGGNGGAGGNGGLFANGGAGGPGGFGSPAGAGGIGGAGGNGGLFGAGGAGGNGGLFGAGGTGGAGSHSTAAGVSGGAGGAGGDAGLLSLGASGGAGGSGGSSLTAAGVVGGIGGAGGLLFGSGGAGGSGGFSNSGNGGAGGAGGDAGLLVGSGGAGGAGASATGAATGGDGGAGGKSGAFGLGGDGGAGGATGLSGAFHIGGKGGVGGSAVLIGNGGNGGNGGNSGNAGKSGGAPGPAGAGGAGGLLLGENGLNGLM
>NZ_CP022577.1|WP_003403834.1|2851610_2851868_-|ribbon-helix-helix-protein,-CopG-family
MRTTVSISDEILAAAKRRARERGQSLGAVIEDALRREFAAAHVGGARPTVPVFDGGTGPRRGIDLTSNRALSEVLDEGLELNSRK
>NZ_CP022577.1|WP_003403837.1|2851158_2851587_-|type-II-toxin-antitoxin-system-VapC-family-toxin
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHLPTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
>NZ_CP022577.1|WP_003403839.1|2850940_2851078_+|hypothetical-protein
MVRKHAFHWRYDSTEELELLNQLWQLVSLRLNFFTPTKKALGFRP
>NZ_CP022577.1|WP_012054246.1|2850536_2850782_-|hypothetical-protein
MRAIVGDCVIHIMPMGTGVELSKLADVALDIGRSVGCSAYENDFTLPDIPTQWRNQPLGWYTQGLAPYLPGLSDPKDAAEG
>NZ_CP022577.1|WP_003403844.1|2849583_2850468_+|3-hydroxyisobutyrate-dehydrogenase
MTTIAFLGLGNMGAPMSANLVGAGHVVRGFDPAPTAASGAAAHGVAVFRSAPEAVAEADVVITMLPTGEVVRRCYTDVLAAARPATLFIDSSTISVTDAREVHALAESHGMLQLDAPVSGGVKGAAAATLAFMVGGDESTLRRARPVLEPMAGKIIHCGAAGAGQAAKVCNNMVLAVQQIAIAEAFVLAEKLGLSAQSLFDVITGATGNCWAVHTNCPVPGPVPTSPANNDFKPGFSTALMNKDLGLAMDAVAATGATAPLGSHAADIYAKFAADHADLDFSAVIHTLRARADA
>NZ_CP022577.1|WP_003403845.1|2848400_2849573_+|acyl-CoA-dehydrogenase-FadE9
MFVLNDDERVIVETAAAFAGKRLAPHALEWDAAKHFPVDVLREAAELGMAAIYCRDDVGGSGLRRLDGVRIFEQLAIADPVTAAFLSIHNMCAWMIDSFGTDEQRKDWIPRLATMGVIASYCLTEPGAGSDAGALSTRAVRHGSGKGGDYVLDGVKQFISGAAASDVYVVMARTGAEGPRGVSAFIVEKGTPGLSFGAPEAKMGWHAQPTAQVVLDGVRVPAEAMLGGADGEGAGFGIAMSGLNGGRLNIAACSLGGAQAAFDKAGAYVRDRQAFGGSLLDEPTVRFTLADMATGLQTSRMLLWRAASALDDDDADKVELCAMAKRYVTDTCFEVADQALQLHGGYGYLREYGLEKIVRDLRVHRILEGTNEIMRLVIGRAEAARFRATV
>NZ_CP022577.1|WP_003403847.1|2846861_2848394_+|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase
MTTQISHFIDGQRTAGQSTRSADVFDPNTGQIQAKVPMAGKSDIDAAVASAVEAQKGWAAWNPQRRARVLMRFIELVNDTIDELAELLSREHGKTLADARGDVQRGIEVIEFCLGIPHLLKGEYTEGAGPGIDVYSLRQPLGVVAGITPFNFPAMIPLWKAGPALACGNAFVLKPSERDPSVPVRLAELFIEAGLPAGVFQVVHGDKEAVDAILHHPDIKAVGFVGSSDIAQYIYAGAAATGKRAQCFGGAKNHMIVMPDADLDQAVDALIGAGYGSAGERCMAISVAVPVGDQTAERLRARLIERINNLRVGHSLDPKADYGPLVTGAALARVRDYIGQGVAAGAELVVDGRDRASDDLTFGLPEGDANLEGGFFIGPTLFDHVAAHMSIYTDEIFGPVLCMVRARDYEEALRLPSEHEYGNGVAIFTRDGDAARDFVSRVQVGMVGVNVPIPVPVAYHTFGGWKRSGFGDLNQHGPAAIQFYTKVKTVTSRWPSGIKDGAEFVIPTMS
>NZ_CP022577.1|WP_003403850.1|2844901_2846656_-|phosphoglycerate-mutase-PE_PGRS11
MSFVIVARDALAAAAADLAQIGSAVNAGNLAAANPTTAVAAAAADEVSAALAALFGAHAREYQAAAAQAAAYHEQFVHRLSAAATSYAVTEVTIATSLRGALGSAPASVSDGFQAFVYGPIHATGQQWINSPVGEALAPIVNAPTNVLLGRDLIGNGVTGTAAAPNGGPGGLLFGDGGAGYTGGNGGSAGLIGNGGTGGAGFAGGVGGMGGTGGWLMGNGGMGGAGGVGGNGGAGGQALLFGNGGLGGAGGAGGVDGAIGRGGWFIGTGGMATIGGGGNGQSIVIDFVRHGQTPGNAAMLIDTAVPGPGLTALGQQQAQAIANALAAKGPYAGIFDSQLIRTQQTAAPLANLLGMAPQVLPGLNEIHAGIFEDLPQISPAGLLYLVGPIAWTLGFPIVPMLAPGSTDVNGIVFNRAFTGAVQTIYDASLANPVVAADGNITSVAYSSAFTIGVGTMMNVDNPHPLLLLTHPVPNTGAVVVQGNPEGGWTLVSWDGIPVGPASLPTALFVDVRELITAPQYAAYDIWESLFTGDPAAVINAVRDGADEVGAAVVQFPHAVADDVIDATGHPYLSGLPIGLPSLIP
>NZ_CP022577.1|WP_003898574.1|2842774_2844712_+|PPE-family-protein
MVGFAWLPPETNSLRMYLGAGSRPLLAAAGAWDGLAEELHAAASSFGSVTSELAGGAWQGPASAAMANAAGPYASWLTAAGAQAELAARQARAAAGAFEEALAGVVHPAVVQANRVRTWLLAVSNVFGQNAPAIAAMESTYEQMWAQDVAVMAGYHAASSAAAAQLASWQPALPNINLGVGNIGNLNVGNGNTGDYNLGNGNLGNANFGGGNGSAFHGQISSFNVGSGNIGNFNLGSGNGNVGIGPSSFNVGSGNIGNANVGGGNSGDNNFGFGNFGNANIGIGNAGPNMSSPAVPTPGNGNVGIGNGGNGNFGGGNTGNANIGLGNVGDGNVGFGNSGSYNFGFGNTGNNNIGIGLTGSNQIGFGGLNSGSGNIGFGNSGTGNIGFFNSGSGNFGVGNSGVTNTGVANSGNINTGFGNSGFINTGFGNALSVNTGFGNSGQANTGIGNAGDFNTGNFNGGIINTGSFNSGAFNSGSFNGGDANSGFLNSGLTNTGFANSGNINTGGFNAGNLNTGFGNTTDGLGENSGFGNAGSGNSGFNNSGRGNSGAQNVGNLQISGFANSGQSVTGYNNSVSVTSGFGNKGTGLFSGFMSGFGNTGFLQSGFGNLEANPDNNSATSGFGNSGKQDSGGFNSIDFVSGFFHR
>NZ_CP022577.1|WP_003910986.1|2857004_2857532_-|hypothetical-protein
MGPPHRSRPPLPSPGPTCQVLPTTAVIHTVTAEALGRIGIDAPRIPGSLDVAAHAAIGLLPLVAGCDRRHRRPVRGARAGRAAQVSLCMTAIRVEPVSSNAVCTGPAAQVGDQSRSPQRDYAHQALQPDVPRRRARRHRPRRCSAKTGSSSSMMRCTCHQNQCLWSSGVSWALAR
>NZ_CP022577.1|WP_003403828.1|2857480_2857627_+|hypothetical-protein
MLGLAMEAVASTGAAAPLGSHAAQIYAKFAADHADLDFSAVIETLRGS
>NZ_CP022577.1|WP_003403827.1|2857739_2858246_+|helix-turn-helix-domain-containing-protein
METLLKTSEAAQILGVSRQHVVNMCDRGEMVCVHVGSHRRVPSSEVERVTSRRLTREEERSLWLHRALLSPLLTEPDTVVSAARENLRRWSGMHRRDGMAGWYFTKWQRVLNDGLDAVMHVLTSPSEDAREMRQNSPFAGILPEATRVAVLRSFKDHWDREHERAMTE
>NZ_CP022577.1|WP_003403820.1|2858242_2858800_+|hypothetical-protein
MTRQQLAHLLRRACAVVGDVDVLVLGSQSILGSFDENELPPQATASQEADIAFVNDPARDKADHVDVAIGEMSDFHRSNGVYAEGVHIDTAILPNGWRDRLVSWTVESSRPAKPRFLEPHDLAVAKLAAGREKDKAFVAALIRSGLLDVGVIQARVLLLPEETDPRIGQRIAAWLNYYGAGNHSS
>NZ_CP022577.1|WP_003901009.1|2859177_2859705_-|PE-family-protein
MSFVIAAPEAIAAAATDLASIGSTIGAANAAAAANTTAVLAAGADQVSVAIAAAFGAHGQAYQALSAQAATFHIQFVQALTAGAGSYAAAEAASAASITSPLLDAINAPFLAALGRPLIGNGADGAPGTGAAGGAGGLLFGNGGAGGSGAPGGAGGLLFGNGGAGGPGASGGALG
>NZ_CP022577.1|WP_003901008.1|2860382_2860910_-|hypothetical-protein
MLPKNTRPTSETAEEFWDNSLWCSWGDRETGYTRTVTVSICQVADGEREAEGVRDMMRLECPAGLDLRTPNPEAYEITGQRPGEFVFVLGYLGHVRAIVGNCYIEIMPMGTRVELSKLADVALDIGRSVGCSAYENDFTLPDIPTQWRNQPLGWYTQGLAPYLPGLSDPKDAAEG
>NZ_CP022577.1|WP_003901007.1|2861024_2861873_-|DUF4226-domain-containing-protein
MSDYSLGVPDETGLGADAARAREVALTQHIGVSAETDRAVVPKLRQAYDSLVCGRRRLGAIGAEIENAVAHQRALGLDTPAGARNFSRFLATKAHDITRVLAATAAESQAGAARLRSLASSYQAVGFGPKPQEPPPDPVPFPPYQPKVWAACRARGQDPDKVVRTFHHAPMSARFRSLPAGDSVLYCGNDKYGLLHIQAKHGRQWHDIADARWPSAGNWRYLADYAIGATLAYPERVEYNQDNDTFAVYRRMSLPDGRYVFTTRVIISARDGKIITAFPQTT
>NZ_CP022577.1|WP_003403741.1|2862077_2862626_-|TIGR03086-family-protein
MDPLMAHQRAQDAFAALLANVRADQLGGPTPCSEWTINDLIEHVVGGNEQVGRWAASPIEPPARPDGLVAAHQAAAAVAHEIFAAPGGMSATFKLPLGEVPGQVFIGLRTTDVLTHAWDLAAATGQSTDLDPELAVERLAAARALVGPQFRGPGKPFADEKPCPRERPPADQLAAFLGRTVR
>NZ_CP022577.1|WP_003906436.1|2862774_2862987_-|PE-domain-containing-protein
MRAGRRVSAQCRAEMGAYASARARLGAQPATFHDQFVRALTRARARMRPPRPAGLLLGNGGARRYPAAGS
>NZ_CP022577.1|WP_003403738.1|2862983_2863481_-|MarR-family-transcriptional-regulator
MASDNRDPIAAARANWERSGWGDVSLGMVAVTSVMRAHQILLARVETALRPYDLSFSRFELLRLLAFSRIGALPITKASDRLQVHVTSVTHAIRRLEADGLVRRVPHPTDGRTTLVQITELGRSTVEDATVTLNEQVFANVGMGAEESQALVSAVETLRRNAGDF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_6

3001198-3001274

TypeV-U4

Consensus_repeat	Method
ACCCGCGCTCACGCCGCACCTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022577_6

>merge|NZ_CP022577|6|3001198-3001274|CRISPRCasFinder
ACCCGCGCTCACGCCGCACCTCAGGGTCCAACGGTTCGGCTTGCCGTTCGCGCTACCCGCGCTCACGCCGCACCTCA

>NZ_CP022577|6|3|3001198-3001274|CRISPRCasFinder
ACCCGCGCTCACGCCGCACCTCA	GGGTCCAACGGTTCGGCTTGCCGTTCGCGCT
ACCCGCGCTCACGCCGCACCTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003403052.1\|3014225_3014912_+\|LpqN/LpqT-family-lipoprotein	unknown	unknown	gnl\|CDD\|378485
NZ_CP022577.1\|WP_003403122.1\|2998067_2998460_+\|type-II-toxin-antitoxin-system-toxin-ribonuclease-C4	unknown	unknown	gnl\|CDD\|350335
NZ_CP022577.1\|WP_003403065.1\|3008168_3008891_-\|FadR-family-transcriptional-regulator-Mce2R	unknown	unknown	gnl\|CDD\|225097
NZ_CP022577.1\|WP_003900178.1\|3009028_3011416_+\|flippase-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|377103
NZ_CP022577.1\|WP_003403104.1\|3005265_3006480_-\|MCE-family-protein	unknown	unknown	gnl\|CDD\|378749
NZ_CP022577.1\|WP_003403164.1\|2993131_2993443_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377032
NZ_CP022577.1\|WP_003403047.1\|3014971_3015379_-\|type-II-toxin-antitoxin-system-toxin-ribonuclease-C26	unknown	unknown	gnl\|CDD\|350263
NZ_CP022577.1\|WP_003403139.1\|2995498_2995735_+\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224913
NZ_CP022577.1\|WP_003900973.1\|2994888_2995395_+\|two-component-system-sensor-kinase-HK1	unknown	unknown	gnl\|CDD\|223715
NZ_CP022577.1\|WP_003403128.1\|2996395_2997631_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|224292
NZ_CP022577.1\|WP_003403039.1\|3015375_3015591_-\|type-II-toxin-antitoxin-system-antitoxin-VapB26	unknown	unknown	gnl\|CDD\|279710
NZ_CP022577.1\|WP_003403095.1\|3007374_3008172_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223838
NZ_CP022577.1\|WP_003403144.1\|2994304_2994775_+\|two-component-system-sensor-kinase-HK2	unknown	unknown	gnl\|CDD\|236751
NZ_CP022577.1\|WP_003403055.1\|3011438_3014072_-\|glycoside-hydrolase-family-92-protein	unknown	unknown	gnl\|CDD\|226067
NZ_CP022577.1\|WP_003900181.1\|3002794_3004240_-\|virulence-factor-Mce-family-protein	unknown	unknown	gnl\|CDD\|273384
NZ_CP022577.1\|WP_003905347.1\|3006485_3007373_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223838
NZ_CP022577.1\|WP_003403137.1\|2995731_2996145_+\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|350248
NZ_CP022577.1\|WP_003905349.1\|2998511_3000062_-\|MCE-family-protein	unknown	unknown	gnl\|CDD\|224380
NZ_CP022577.1\|WP_003403125.1\|2997813_2998071_+\|type-II-toxin-antitoxin-system-antitoxin-VapB4	unknown	unknown	gnl\|CDD\|226603
NZ_CP022577.1\|WP_003403148.1\|2993499_2994261_+\|two-component-system-response-regulator-TcrA	unknown	unknown	gnl\|CDD\|223816

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003403052.1\|3014225_3014912_+\|LpqN/LpqT-family-lipoprotein	gnl\|CDD\|378485	pfam10738, Lpp-LpqN, Probable lipoprotein LpqN. This family is conserved in Mycobacteriaceae and is likely to be a lipoprotein.	5.50369e-72
NZ_CP022577.1\|WP_003403122.1\|2998067_2998460_+\|type-II-toxin-antitoxin-system-toxin-ribonuclease-C4	gnl\|CDD\|350335	cd18768, PIN_MtVapC4-C5-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC4, VapC5, and related proteins. This subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC4 and VapC5 toxin of the VapBC toxin/antitoxin (TA) system. This family belongs to the PIN_VapC4-5_FitB-like subfamily of the VapC (virulence-associated protein C)-like family of the PIN domain nuclease superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. M. tuberculosis VapC4 interacts with, and cleaves tRNA44Cys-GCA. M. tuberculosis VapC5 has endonucleolytic activity with RNA, this activity is low with dsRNA, and no activity has been demonstrated on dsDNA. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	5.73431e-57
NZ_CP022577.1\|WP_003403065.1\|3008168_3008891_-\|FadR-family-transcriptional-regulator-Mce2R	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	4.76819e-52
NZ_CP022577.1\|WP_003900178.1\|3009028_3011416_+\|flippase-like-domain-containing-protein	gnl\|CDD\|377103	pfam03706, LPG_synthase_TM, Lysylphosphatidylglycerol synthase TM region. LPG_synthase_TM is the N-terminal region of this family of bacterial phosphatidylglycerol lysyltransferases. The function of the family is to add lysyl groups to membrane lipids, and this region is the transmembrane domain of 7xTMs. In order to counteract attack by membrane-damaging external cationic antimicrobial molecules - from host immune systems, bacteriocins, defencins, etc - bacteria modify their anionic membrane phosphatidylglycerol with positively-charged L-lysine; this results in repulsion of the foreign cationic peptides.	2.17737e-22
NZ_CP022577.1\|WP_003403104.1\|3005265_3006480_-\|MCE-family-protein	gnl\|CDD\|378749	pfam11887, Mce4_CUP1, Cholesterol uptake porter CUP1 of Mce4, putative. Mce4_CUP1 is a family of putative Mce4 transporters of cholesterol. The domain is found associated with pfam02470. The full TCDB classification for this family in conjunction with PF02470 is TC:3.A.1.27.4.	1.49168e-114
NZ_CP022577.1\|WP_003403164.1\|2993131_2993443_-\|hypothetical-protein	gnl\|CDD\|377032	pfam03413, PepSY, Peptidase propeptide and YPEB domain. This region is likely to have an protease inhibitory function (personal obs:C Yeats). This model is likely to miss some members of this family as the separation from signal to noise is not clear. The name is derived from Peptidase & Bacillus subtilis YPEB.	0.00241752
NZ_CP022577.1\|WP_003403047.1\|3014971_3015379_-\|type-II-toxin-antitoxin-system-toxin-ribonuclease-C26	gnl\|CDD\|350263	cd18696, PIN_MtVapC26-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC26 and related proteins. Mycobacterium tuberculosis VapC26 cleaves 23S rRNA in the Sarcin-Ricin Loop, it is inhibited by the cognate VapB26 antitoxin. This subfamily belongs to the VapC (virulence-associated protein C)-like nuclease family of the PIN domain-like superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include FitB toxin of the FitAB TA system, eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The PIN domain belongs to a large nuclease superfamily. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.4948e-60
NZ_CP022577.1\|WP_003403139.1\|2995498_2995735_+\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|224913	COG2002, AbrB, Regulators of stationary/sporulation gene expression [Transcription].	1.50922e-07
NZ_CP022577.1\|WP_003900973.1\|2994888_2995395_+\|two-component-system-sensor-kinase-HK1	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.10494e-27
NZ_CP022577.1\|WP_003403128.1\|2996395_2997631_+\|ATP-binding-protein	gnl\|CDD\|224292	COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only].	1.27416e-77
NZ_CP022577.1\|WP_003403039.1\|3015375_3015591_-\|type-II-toxin-antitoxin-system-antitoxin-VapB26	gnl\|CDD\|279710	pfam01402, RHH_1, Ribbon-helix-helix protein, copG family. The structure of this protein repressor, which is the shortest reported to date and the first isolated from a plasmid, has a homodimeric ribbon-helix-helix arrangement. The helix-turn-helix-like structure is involved in dimerization and not DNA binding as might have been expected.	0.000727733
NZ_CP022577.1\|WP_003403095.1\|3007374_3008172_-\|ABC-transporter-permease	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	9.02403e-82
NZ_CP022577.1\|WP_003403144.1\|2994304_2994775_+\|two-component-system-sensor-kinase-HK2	gnl\|CDD\|236751	PRK10755, PRK10755, two-component system sensor histidine kinase PmrB.	1.39186e-13
NZ_CP022577.1\|WP_003403055.1\|3011438_3014072_-\|glycoside-hydrolase-family-92-protein	gnl\|CDD\|226067	COG3537, COG3537, Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].	0
NZ_CP022577.1\|WP_003900181.1\|3002794_3004240_-\|virulence-factor-Mce-family-protein	gnl\|CDD\|273384	TIGR00996, Mtu_fam_mce, virulence factor Mce family protein. Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. [Cellular processes, Pathogenesis].	1.51384e-92
NZ_CP022577.1\|WP_003905347.1\|3006485_3007373_-\|ABC-transporter-permease	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	2.44952e-83
NZ_CP022577.1\|WP_003403137.1\|2995731_2996145_+\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|350248	cd18681, PIN_MtVapC27-VapC40_like, VapC-like PIN domain of Mycobacterium tuberculosis VapC27, and VapC40, and related proteins. This subfamily includes Mycobacterium tuberculosis VapC27 and VapC40. It belongs to the VapC (virulence-associated protein C)-like family of the PIN domain nuclease superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include FitB toxin of the FitAB TA system, eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	9.76945e-42
NZ_CP022577.1\|WP_003905349.1\|2998511_3000062_-\|MCE-family-protein	gnl\|CDD\|224380	COG1463, Ttg2C, ABC-type transport system involved in resistance to organic solvents, periplasmic component [Secondary metabolites biosynthesis, transport, and catabolism].	2.23163e-80
NZ_CP022577.1\|WP_003403125.1\|2997813_2998071_+\|type-II-toxin-antitoxin-system-antitoxin-VapB4	gnl\|CDD\|226603	COG4118, Phd, Antitoxin of toxin-antitoxin stability system [Cell division and chromosome partitioning].	2.38527e-16
NZ_CP022577.1\|WP_003403148.1\|2993499_2994261_+\|two-component-system-response-regulator-TcrA	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	3.00442e-84

>NZ_CP022577.1|WP_003905349.1|2998511_3000062_-|MCE-family-protein
MLTRAIKTQLVLLTVLAVIAVVVLGWYFLRIPSLVGIGRYTLYAELPRSGGLYRTANVTYRGITIGKVTGVEPTERGARATMSIDNGYQIPTDASANVHSVSAVGEQFVDLVSTRTSGPYLRHGQTITTTTVPSQIGPALDAANRGLAVLPKDRVASVLHEASEAVGGLGSSLNRLIEATQAIAHDVRGSLEDIDDIIERSAPIIDSQVNSGNEIARWAANLNTLAAQTAQTDPAVRSILANAAPTADQVNATFSDVRESLPQTLANLEVVIDMLKRYHNGVEQALVFLPQSGAIAQSVTTEFPGQAGLGVGGLALNQPPPCLTGFLPASEWRSPADTSTAPLPKGTYCRIPMDASNVVRGARNNPCVDVPGKRAATPRECRSNEAYVPGGTNPWYGDPNQMLSCPAPAARCDQPVKPGQVIPAPSVNNGISPLPADQLPGTPPPVNDPLQRPGSGTVQCNGQQPNPCVYTPSTFPTTIYDVQSGKVVAPDGVVYSVEASTHAGADGWKVMLAPTG
>NZ_CP022577.1|WP_003403122.1|2998067_2998460_+|type-II-toxin-antitoxin-system-toxin-ribonuclease-C4
MNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAWALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
>NZ_CP022577.1|WP_003403125.1|2997813_2998071_+|type-II-toxin-antitoxin-system-antitoxin-VapB4
MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTTDDVRW
>NZ_CP022577.1|WP_003403128.1|2996395_2997631_+|ATP-binding-protein
MGVVERAIAPSVLAALADTPVVVVNGARQVGKTTLVARLDYPGSSEVVSLDDVANRDAARDDPRAFVSRPVDTLVIDEAQLEPGLFRAIKAEVDRDRRPGRFLLTGSARLLSAPDMADALVGRVEIIELWPFSQGERAGIADGFVDALFTAPRELIHGSDMRRADLVDRIATGGFPDIVARSPSRRRAWFDNYLTTATQSVIREISPIERLAEMPRVLRLCAARTGAELNVSALANDLSIPARTTAGYLALLEAAFLIHRVPAWSTNLSRKVIRRPKLVVSDSGLACHLLGVTGATLDRPGRPLGPLLETFVANEIRKQLTWSTERPSLWHFRDRGGAEVDLVLEHPDGRVCGIEVKATSTPRAEDLRGLRYLAERLDDRFQFGVLLTAAPEATPFGPTLAALPVSTLWAG
>NZ_CP022577.1|WP_003403137.1|2995731_2996145_+|type-II-toxin-antitoxin-system-VapC-family-toxin
MKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSRTTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
>NZ_CP022577.1|WP_003403139.1|2995498_2995735_+|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK
>NZ_CP022577.1|WP_003900973.1|2994888_2995395_+|two-component-system-sensor-kinase-HK1
MPITPLLHESVARFAATGADITTRAEPDLFVSIDPDHLRRILTAVLDNAITHGDGEIAVTAHARDGAVDIGVRDHGPGFADHFLPVAFDRFTRADTARGGRGSGLGLAIVAALTTTHGGHANATNHPDGGAELRITLPTPRPPFHEELPRITSSDTKDPNREHDTSDQ
>NZ_CP022577.1|WP_003403144.1|2994304_2994775_+|two-component-system-sensor-kinase-HK2
MALVLAAAGAVTVVQFRDAAHEADPDGALRGLTDDITADLVRELVTILPIVLVIAAVAAYLLSRAALRPVDRIRAAAQTLTTTPHPDTDAPLPVPPTDDEIAWLATTLNTMLTRLQRALAHEQQFVADASHELRTPLALLTTELELRCAGPDPPTS
>NZ_CP022577.1|WP_003403148.1|2993499_2994261_+|two-component-system-response-regulator-TcrA
MADETTMRAGRGPGRACGRVSGVRILVVEDEPKMTALLARALTEEGHTVDTVADGRHAVAAVDGGDYDAVVLDVMLPGIDGFEVCARLRRQRVWTPVLMLTARGAVTDRIAGLDGGADDYLTKPFNLDELFARLRALSRRGPIPRPPTLEAGDLRLDPSEHRVWRADTEIRLSHKEFTLLEALIRRPGIVHTRAQLLERCWDAAYEARSNIVDVYIRYLRDKIDRPFGVTSLETIRGAGYRLRKDGGRHALPR
>NZ_CP022577.1|WP_003403164.1|2993131_2993443_-|hypothetical-protein
MNRIVQFGVSAVAAAAIGIGAGSGIAAAFDGEDEVTGPDADRARAAAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGG
>NZ_CP022577.1|WP_003900181.1|3002794_3004240_-|virulence-factor-Mce-family-protein
MRTLTEFNRGRVGMMGAVVTVLVVGVAQSFTSVPMLFATPTYYAQFADTGGINTGDKVEIAGVNVGLVRSLAIRGNRVLIGFSLPGKTIGMQSRAAIRTDTILGRKNLEIEPRGSEPLKPNGFLPLAQTTTPYQIYDAFVDVTKAATGWDIDAVKRSLNVLSETFDQTAPHLSAALEGVKAFSDTVGRRGEQIEQLLANANRIARVLGDRSEQVNGLLVNAKTLLAAFKQRSQALRILLTNVSEASAQVSGLITDNPNLNHVLAQLRTVSEELVKRKNELADVAVLLGRYTAALTEAVGSGPFFKAMVVNLLPYQILQPWVDAAFKKRGIDPENFWRSAGLPEFRWPDPNGTRFPNGAPPAAPPVREGTPKHPGPAVPPGTPCSYTPAAGALPRPDTPLPCAGATVGPFGGPDFPAPLDVQPSPPNPDGPPPTPGILSAGRPGEPAPAVPGIPMPLPPNAPPGARTQPLEPFPDGTGGSNQ
>NZ_CP022577.1|WP_003403104.1|3005265_3006480_-|MCE-family-protein
MPTLVTRKNRRAWLYVEGVVLLLVGALVLVLVYKQFRGEFTPKTELTMVASRAGLVMEAGSKVTYNGVEIGRVGSISEIERDGRPAAKLVLDVNPRYISLIPVNVVADIEAATLFGNKYVALSAPKIPQQQRISSHDVIDVGSVTTEFNTLFETITSIAEKVDPIELNATLSAVAQALDGLGGKFGESIVNGNQILAQLNPRLPQLGYDVRRLADLGEVYVDASPDLWSFLQNALTTARTLTSQQRDLDAALLAATGAGNTGEDVFARGGPYLARAAADLVPTATLLDTYSPELFCMIRNFHDAAPKVADAVGGNGYSLAAAGTILGAPNPYVYPDNLPRVNAHGGPGGRPGCWQTITRELWPAPYLVMDTGASLAPYNHVELGQPMFTEYVWGRQYGENTINP
>NZ_CP022577.1|WP_003905347.1|3006485_3007373_-|ABC-transporter-permease
MVESSTASAAAVLRARYPRTAASLDRYGGGTARRLERTGTFARFTRISVVQIGWALRRYRRETLRLVAEIGMGTGAMAVVGGTVAIIGFVTLSGGSLIAIQGFASLGNIGVETFTGFFAALANTRVAAPIVSGVALAATVGAGATAQLGAMRISEEIDALEVMGIKSISFLVSTRILGGLVVIMPLYALALDMAFTSGQVVTTVFYGQSNGTYEHYFRTFLRPEDVGWSVVEVVIIAVVVMITHCYYGYTASGGPVGVGQAVGRSMRFSLVSVVVVVLLAELALYGVDPNFNLTV
>NZ_CP022577.1|WP_003403095.1|3007374_3008172_-|ABC-transporter-permease
MTTHAVIITYLRDQTQPAVDAIGGFYRTCVLTGKALVRRPFHWREAIEQGWFITSVSLLPTLAVSIPLTVLIIFTLNILLAEFGAADISGAGAALGAVTQLGPLTTVLVIAGAGATAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVVAATIVAALLNGAVITIGLVGGFVFSVFIQHVSAGAYVGTLTLVTGLPEVIISVVKSATFGLIAGLVGCYRGLTTKGGPKGVGTAVNETLVLCVIALFATNVVLTTIGVRFGTGH
>NZ_CP022577.1|WP_003403065.1|3008168_3008891_-|FadR-family-transcriptional-regulator-Mce2R
MALQPVTRRSVPEEVFEQIATDVLTGEMPPGEALPSERRLAELLGVSRPAVREALKRLSAAGLVEVRQGDVTTVRDFRRHAGLDLLPRLLFRNGELDISVVRSILEARLRNFPKVAELAAERNEPELAELLQDSLRALDTEEDPIVWQRHTLDFWDHVVDSAGSIVDRLMYNAFRAAYEPTLAALTTTMTAAAKRPSDYRKLADAICSGDPTGAKKAAQDLLELANTSLMAVLVSQASRQ
>NZ_CP022577.1|WP_003900178.1|3009028_3011416_+|flippase-like-domain-containing-protein
MRVDGRDIGVSGNLLQPLTRRTNDIIRAVLAAIYLVAVITSSLITRPQWVALEKSISEIVGVLSPSQSDLVYLGYGLAILALPFVILIGLIVSRQWKLLGAYAAAGLMAVLPLSISSSRIAAPRWHFDLSDRLATLLAQFLDDPRWIAMLAAVLTVSGPWLPARWRHWWWALLLAFVPIHLVVSAIVPARSLLGLAVGWLVGALVVLVVGTPALEVPLDGAIRALAKRGFAVSGLAVVRPAGPGPLVLSAACEQPNAGACSEALIELYGPHQSGGGALRQLWLKLTLRGTETAPLQASMRRAVEHRALMAIAFGDLGMANTTVIAVSPLDRGWTLYAHRPARGIGISECTKTTPTAHVWEALRTLHDQQISHGDLCSAEITVDNGAVLFGGFGEAEYGATDAQLQSDLAQLLVTTSALYDAEAAVTAAIDTFGKQAILAASRRLTKSAVPKRIRESITDPNAVIASTRAEVMRQTGADQIKAETITRFSRGQLIQLVLIGALVYVAYPFISTVPTFFSQLRTANWWWALLGLAVSALTYVGAAAALWACADGLVGFWKLSIMQVANTFAATTTPAGVGGLALSTRFLQKGGLTAVRATAAVALQQSVQVIVHLVLLILFSALAGTSTDLSHFVPNATVLYLIAGVALGIVGTFLFVPKLRRWLATAVRPKLREVTNDLIALAREPKRLALIVLGCAGTTLGAALALWASIEAFGGGTTFVTVTVVTMVGGTLASAAPTPGGVGAVEAALIGGLAAFGVPAALGVPSVLLYRLLTCWLPVFAGWQVMHWLTRHEMI
>NZ_CP022577.1|WP_003403055.1|3011438_3014072_-|glycoside-hydrolase-family-92-protein
MRARRLRRALAALLAVAGLFVPFIVGVPTAYDGEPVFVAIPVEHVNTLIGTGTGAAIVGEINNFPGASVPFGMVQYSPDTVDNYAGYDYDNPHSTGFSMTHASVGCPAFGDISMLPTTTPLGSQPWSAWEEIAHDDTEVGVPGYYTVRFPGTGVIAELTATTRTGVGRFRYPRNGWPALFHVRSGASLAGNYAATLQIEDNTTITGSATSGGFCGKKNLYTVYFAMKFSQPFSSYGTWDGYAVYPGSHSMNSSYSGGYVGFPAGSVLEVRTALSYVSVDGARANLDAEGGASFDDIRAATSSEWNAALSRIAVAGRGPGDVDTFYTCLYRSLLHPNTFNDVDGRYIGFDGVIHSVASGHTHYANFSDWDTYRSLAPLQGLLFPQRASDMIQSLVTDAEQSGAYPRWALANSATGMMSGDSVVPLIVNLYAFGARDFDLKSALHYMVNAATQGGVGLDGFLERPGIAAYLRLGYGPQTAEFRANGRIAGASVTLEWSVDDFAISRFADSLGDTATAAVFQNRSQYWQNLFNPTTGYISPRSAAGFFPDGPGFVAYPSGFGQDGYDEGNAEQYLWWVPHNVAGLVTALGGRTAVVKRLDRFTKKLNVGPNEPYLWAGNEPGFGVPWLYNYIGQPWKTQRTVDRVRGLFGPTPGGAPGNDDLGALSSWYVWAALGLYPSTPGTTILTVNTPLFDRAVIALPTGKSIQITAPGASGRNRLKYIDGLTIDRQPSNQTFLPESIVRTGGDLTFSLAGTPNKVWGTAASAAPPSFGAGSSAVTVNIARPIIGIVPGATGTVTVDAQRMIDGVDDYTVTPTSYVVGIAAEPLSGQFDDDGAVSASVAITVARSVPSGYYPIYVTTSAGDSARTLIVLVVVAEAVE
>NZ_CP022577.1|WP_003403052.1|3014225_3014912_+|LpqN/LpqT-family-lipoprotein
MKHFTAAVATVALSLALAGCSFNIKTDSAPTTSPTTTSPTTSTTTTSATTSAQAAGPNYTIADYIRDNHIQETPVHHGDPGSPTIDLPVPDDWRLLPESSRAPYGGIVYTQPADPNDPPTIVAILSKLTGDIDPAKVLQFAPGELKNLPGFQGSGDGSAATLGGFSAWQLGGSYSKNGKLRTVAQKTVVIPSQGAVFVLQLNADALDDETMTLMDAANVIDEQTTITP
>NZ_CP022577.1|WP_003403047.1|3014971_3015379_-|type-II-toxin-antitoxin-system-toxin-ribonuclease-C26
MIIDTSALLAYFDAAEPDHAAVSECIDSSADALVVSPYVVAELDYLVATRVGVDAELAVLRELAGGAWELANCGAAEIEQAARIVTKYQDQRIGIADAANVVLADRYRTRTILTLDRRHFSALRPIGGGRFTVIP
>NZ_CP022577.1|WP_003403039.1|3015375_3015591_-|type-II-toxin-antitoxin-system-antitoxin-VapB26
MDKTTVYLPDELKAAVKRAARQRGVSEAQVIRESIRAAVGGAKPPPRGGLYAGSEPIARRVDELLAGFGER

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_7

3330411-3330507

Orphan

Consensus_repeat	Method
CCCGCCGTTGCCACCGTTGCCGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022577_7

>merge|NZ_CP022577|7|3330411-3330507|CRISPRCasFinder
GCCGCCATCGCCGCCGTGGCCGCCGATCGCGCCAGCCGCACCGGCCCCGCCGACACCGCCGACACCGCCCGCACCACCGTCGCCGCCGTTGCCGATC

>NZ_CP022577|7|4|3330411-3330507|CRISPRCasFinder
GCCGCCATCGCCGCCGTGGCCGCC	GATCGCGCCAGCCGCACCGGCCCCGCCGACACCGCCGACACCGCCCGC
ACCACCGTCGCCGCCGTTGCCGATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003401521.1\|3340111_3340999_-\|type-VII-secretion-system-ESX-3-associated-protein-EspG3	unknown	unknown	gnl\|CDD\|379414
NZ_CP022577.1\|WP_003911082.1\|3317452_3326998_+\|PPE-family-protein	unknown	unknown	gnl\|CDD\|366325
NZ_CP022577.1\|WP_003401566.1\|3328678_3329104_-\|PIN-domain-nuclease	unknown	unknown	gnl\|CDD\|350322
NZ_CP022577.1\|WP_003401560.1\|3329369_3329672_-\|toxin-antitoxin-system-toxin	unknown	unknown	unknown
NZ_CP022577.1\|WP_003401503.1\|3341329_3341623_-\|type-VII-secretion-system-protein-EsxG	unknown	unknown	gnl\|CDD\|274862
NZ_CP022577.1\|WP_003898396.1\|3335083_3336286_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|366166
NZ_CP022577.1\|WP_003401538.1\|3334191_3334977_-\|trans-aconitate-2-methyltransferase	unknown	unknown	gnl\|CDD\|184509
NZ_CP022577.1\|WP_003902645.1\|3338646_3340065_-\|type-VII-secretion-system-ESX-3-subunit-EccD3	unknown	unknown	gnl\|CDD\|274855
NZ_CP022577.1\|WP_003401589.1\|3316108_3316591_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003401584.1\|3316578_3317250_-\|5,6-dimethylbenzimidazole-synthase	unknown	unknown	gnl\|CDD\|162875
NZ_CP022577.1\|WP_003905275.1\|3327910_3328543_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP022577.1\|WP_003401540.1\|3333399_3334203_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226848
NZ_CP022577.1\|WP_003401528.1\|3337264_3338650_-\|type-VII-secretion-system-ESX-3-serine-protease-mycosin-MycP3	unknown	unknown	gnl\|CDD\|274856
NZ_CP022577.1\|WP_003401555.1\|3329668_3329896_-\|ribbon-helix-helix-protein,-CopG-family	unknown	unknown	gnl\|CDD\|279710
NZ_CP022577.1\|WP_003401594.1\|3315334_3316051_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP022577.1\|WP_003401563.1\|3329100_3329322_-\|type-II-toxin-antitoxin-system-antitoxin-VapB2	unknown	unknown	gnl\|CDD\|222832
NZ_CP022577.1\|WP_003900117.1\|3327005_3327914_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187670
NZ_CP022577.1\|WP_003401514.1\|3341009_3341300_-\|WXG100-family-type-VII-secretion-target	unknown	unknown	gnl\|CDD\|227179
NZ_CP022577.1\|WP_003401544.1\|3331992_3333390_+\|sulfatase	unknown	unknown	gnl\|CDD\|293751
NZ_CP022577.1\|WP_003401533.1\|3336272_3337268_-\|type-VII-secretion-system-ESX-3-subunit-EccE3	unknown	unknown	gnl\|CDD\|274857

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003911082.1\|3317452_3326998_+\|PPE-family-protein	gnl\|CDD\|366325	pfam00823, PPE, PPE family. This family named after a PPE motif near to the amino terminus of the domain. The PPE family of proteins all contain an amino-terminal region of about 180 amino acids. The carboxyl terminus of this family are variable, and on the basis of this region fall into at least three groups. The MPTR subgroup has tandem copies of a motif NXGXGNXG. The second subgroup contains a conserved motif at about position 350. The third group are only related in the amino terminal region. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.96927e-83
NZ_CP022577.1\|WP_003401594.1\|3315334_3316051_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	2.34145e-31
NZ_CP022577.1\|WP_003401566.1\|3328678_3329104_-\|PIN-domain-nuclease	gnl\|CDD\|350322	cd18755, PIN_MtVapC3_VapC21-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC3, VapC21 and related proteins. This subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC3 and VapC21 toxins. It belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is a PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include FitB toxin of the FitAB TA system, eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.62509e-57
NZ_CP022577.1\|WP_003401503.1\|3341329_3341623_-\|type-VII-secretion-system-protein-EsxG	gnl\|CDD\|274862	TIGR03930, WXG100_ESAT6, WXG100 family type VII secretion target. Members of this protein family include secretion targets for the two main variants of type VII secretion systems (T7SS), one found in the Actinobacteria, one found in the Firmicutes. This model was derived through iteration from pfam06013. The best characterized member of this family is ESAT-6 from Mycobacterium tuberculosis. Members of this family usually are ~100 amino acids in length but occasionally have a long C-terminal extension.	0.00514324
NZ_CP022577.1\|WP_003401538.1\|3334191_3334977_-\|trans-aconitate-2-methyltransferase	gnl\|CDD\|184509	PRK14103, PRK14103, trans-aconitate 2-methyltransferase; Provisional.	8.03642e-167
NZ_CP022577.1\|WP_003902645.1\|3338646_3340065_-\|type-VII-secretion-system-ESX-3-subunit-EccD3	gnl\|CDD\|274855	TIGR03920, T7SS_EccD, type VII secretion integral membrane protein EccD. Members of this family are EccD, a component of actinobacterial type VII secretion systems (T7SS) with ten to eleven predicted transmembrane helix regions. [Protein fate, Protein and peptide secretion and trafficking].	1.59367e-76
NZ_CP022577.1\|WP_003401533.1\|3336272_3337268_-\|type-VII-secretion-system-ESX-3-subunit-EccE3	gnl\|CDD\|274857	TIGR03923, T7SS_EccE, type VII secretion protein EccE. This model represents the transmembrane protein EccB of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccE1, EccE2, etc. This model represents a conserved core region, and many members have 200 or more additional C-terminal residues. [Protein fate, Protein and peptide secretion and trafficking].	1.38183e-59
NZ_CP022577.1\|WP_003401584.1\|3316578_3317250_-\|5,6-dimethylbenzimidazole-synthase	gnl\|CDD\|162875	TIGR02476, BluB, 5,6-dimethylbenzimidazole synthase. A previously published hypothesis that BluB, involved in cobalamin biosynthesis, is EC 1.16.8.1 (cob(II)yrinic acid a,c-diamide reductase) is now contradicted by newer work ascribing a role in 5,6-dimethylbenzimidazole (DMB) biosynthesis. The BluB protein is related to the nitroreductase family (pfam0881). [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin].	6.73571e-73
NZ_CP022577.1\|WP_003905275.1\|3327910_3328543_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.1641e-15
NZ_CP022577.1\|WP_003401540.1\|3333399_3334203_+\|hypothetical-protein	gnl\|CDD\|226848	COG4424, COG4424, Uncharacterized protein conserved in bacteria [Function unknown].	2.12891e-123
NZ_CP022577.1\|WP_003401528.1\|3337264_3338650_-\|type-VII-secretion-system-ESX-3-serine-protease-mycosin-MycP3	gnl\|CDD\|274856	TIGR03921, T7SS_mycosin, type VII secretion-associated serine protease mycosin. Members of this family are subtilisin-related serine proteases, found strictly in the Actinobacteria and associated with type VII secretion operons. The designation mycosin is used for members from Mycobacterium. [Protein fate, Protein and peptide secretion and trafficking, Protein fate, Protein modification and repair].	2.49308e-115
NZ_CP022577.1\|WP_003401555.1\|3329668_3329896_-\|ribbon-helix-helix-protein,-CopG-family	gnl\|CDD\|279710	pfam01402, RHH_1, Ribbon-helix-helix protein, copG family. The structure of this protein repressor, which is the shortest reported to date and the first isolated from a plasmid, has a homodimeric ribbon-helix-helix arrangement. The helix-turn-helix-like structure is involved in dimerization and not DNA binding as might have been expected.	0.000113886
NZ_CP022577.1\|WP_003898396.1\|3335083_3336286_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	1.89486e-06
NZ_CP022577.1\|WP_003401563.1\|3329100_3329322_-\|type-II-toxin-antitoxin-system-antitoxin-VapB2	gnl\|CDD\|222832	PHA01748, PHA01748, hypothetical protein.	0.00852727
NZ_CP022577.1\|WP_003900117.1\|3327005_3327914_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187670	cd09810, LPOR_like_SDR_c_like, light-dependent protochlorophyllide reductase (LPOR)-like, classical (c)-like SDRs. Classical SDR-like subgroup containing LPOR and related proteins. Protochlorophyllide (Pchlide) reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.69352e-146
NZ_CP022577.1\|WP_003401521.1\|3340111_3340999_-\|type-VII-secretion-system-ESX-3-associated-protein-EspG3	gnl\|CDD\|379414	pfam14011, ESX-1_EspG, EspG family. This family of proteins contains the the EspG1, EspG2 and EspG3 proteins from M. tuberculosis. These proteins are involved in the ESAT-6 secretion system 1 (ESX-1) of Mycobacterium tuberculosis which is important for virulence and intercellular spread. Proteins in this family are typically between 254 and 295 amino acids in length.	1.29098e-54
NZ_CP022577.1\|WP_003401514.1\|3341009_3341300_-\|WXG100-family-type-VII-secretion-target	gnl\|CDD\|227179	COG4842, COG4842, Uncharacterized protein conserved in bacteria [Function unknown].	2.85211e-21
NZ_CP022577.1\|WP_003401544.1\|3331992_3333390_+\|sulfatase	gnl\|CDD\|293751	cd16027, SGSH, N-sulfoglucosamine sulfohydrolase (SGSH; sulfamidase). N-sulfoglucosamine sulfohydrolase (SGSH) belongs to the sulfatase family and catalyses the cleavage of N-linked sulfate groups from the GAGs heparin sulfate and heparin. The active site is characterized by the amino-acid sequence motif C(X)PSR that is highly conserved among most sulfatases. The cysteine residue is post-translationally converted to a formylglycine (FGly) residue, which is crucial for the catalytic process. Loss of function of SGSH results a disease called mucopolysaccharidosis type IIIA (Sanfilippo A syndrome), a fatal childhood-onset neurodegenerative disease with mild facial, visceral and skeletal abnormalities.	5.75322e-137

>NZ_CP022577.1|WP_003401555.1|3329668_3329896_-|ribbon-helix-helix-protein,-CopG-family
MTKEKISVTVDAAVLAAIDADARAAGLNRSEMIEQALRNEHLRVALRDYTAKTVPALDIDAYAQRVYQANRAAGS
>NZ_CP022577.1|WP_003401560.1|3329369_3329672_-|toxin-antitoxin-system-toxin
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPLGNAGVAALREAASVVTALLC
>NZ_CP022577.1|WP_003401563.1|3329100_3329322_-|type-II-toxin-antitoxin-system-antitoxin-VapB2
MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVAGLGDPELMRQAWR
>NZ_CP022577.1|WP_003401566.1|3328678_3329104_-|PIN-domain-nuclease
MTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
>NZ_CP022577.1|WP_003905275.1|3327910_3328543_-|TetR/AcrR-family-transcriptional-regulator
MGVPAKKKQQQGERSRESILDATERLMATKGYAATSISDIRDACGLAPSSIYWHFGSKEGVLAAMMERGAQRFFAAIPTWDEADGPVEQRSERQLTELVSLQSQHPDFLRLFYLLSMERSQDPAVAAVVRRVRNTAIARFRDSITHLLPSDIPPGKADLVVAELTAFAVALSDGVYFAGHLEPDTTDVERMYRRLRQALEALIPVLLEET
>NZ_CP022577.1|WP_003900117.1|3327005_3327914_-|SDR-family-NAD(P)-dependent-oxidoreductase
MNTGTAVITGASSGLGLQCARALLRRDASWHVVLAVRDPARGRAAMEELGEPNRCSVLEVDLASVRSVRSFVETVRTTPLPPIRALVCNAGLQVVSGIAFTDDGVEMTFGVNHLGHFALVTGILDWLARPARIVVVSSGTHDPSKHTGMPDPRYTCAADLAHPPTDQNTPAEGRRRYTTSKLCNVLFTYELDRRLDHGEQGVMVNAFDPGLMPGSGLARDYPPILRLAYRLLSPMLRVLPFVHSTRVSGEHLAALAVDPRFAGVTGQYFAGAKAIRSSAESYDRAKALDLWETSERLLAQVT
>NZ_CP022577.1|WP_003911082.1|3317452_3326998_+|PPE-family-protein
MDFVVSAPEVNSLRMYLGAGSGPMLAAAAAWDGLADELAVAASWFGSVTSGLADAAWRGPAAVAMARAVAPYLGWLISATAQAEQAAAQARVAVATFEAARAATVHPAIVAANRAVLVSLVSSNLLGFNAPAIAATEAAYERMWAQDVAAMVGYHAGASAAVSALMPFTQQLKKLAGLSERLTSAAAAAAGPPSAAGFNLGLANVGANNVGNGNVGVFNVGFGNLGSYNLGFANLGSDNLGLANLGGHNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIGFGSFNSGSHNIGLFNSGSGNVGLFNSGTGNFGIGNSGTGNFGLGNTGSTNTGWFNTGDVNTGGFNPGSYNTGNFNTGNYNTGSFNAGNYNTGYFNTGDYNTGVANTGNVNTGAFIAGNYSNGVLWRGDYQGLIGADIALEIPAIPINAQLFSMPIHQVMVMPGSVMTIPGMRLPFTSIVPFVVYYGPVELPQSTLTLPTVTITVGGPTTTIDGNLTGMVGGVSIPLIKIPAAPGFGNSTTSPSSGFFNAGAGTASGFGNFGGGASGFWNLASATSGLSGFGNVGALGSGVANVGNTISGLYNTSTSNLATPAFNSGLLHHSVGTMTLNFGLANVGGNNVGGANAGIFNVGLANLGDYNIGFGNLGGDNLGFAHAGSYNIGFANTGSNNLGFANTGDNNIGFANIGSNNIGIGLTGSGQIGFGSLNSGSHNIGLFNSGDGNIGLFNSGSGNFGIGNAGTGNWGIGNSGAGNFGIGNAGSTNTGLFNSGDLNTGSLNPGSYNTGSVNTGSVNTGGFNAGNYNTGYFNTGDYNTGMANTGNINTGAFISGNHSNGLLWRGDNQGLIDLAIGVDIPEIPIVSVDVNIPIHIPITASFTDIVYSGLDLPPNTAVTVIFFGPVDIDPFTVPVIRITGPTPVVMVGGPTTAINIGATVGVDAINIPIIHIPATPGFGNSTGGLSSGFFNSGAGSASGFGNFGGAASGFMNLVSTTSGMSGFLNVGALGSGVANVGNTISGIYNVGTSDLSTPAVNSGLANIGTNIAGLLRDGAGTAAINLGLANHGNLNVGFASLGGFNFGGATIGHNNVGIGNTGIFDVGLANLGSYNIGFGNLGDDNLGFGNFGSYNIGFGNVGNDNLGFANAGGGNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIGFGSFNSGSGNIGLFNSGSNNIGFFNSGSGNFGIANSGSFNTGIGNTGNTNTGLFNSGDVNTGAFNPGSFNTGSFNTGSFNTGGFNPGNTNTGYLNIGNYNTGIANTGDVDTGAFITGNYSNGLFLSGDYQGLVGLNLVIDMPLPISLGVNIPIDIPITASAGNITLMGVTIPPTGDIVLSSIAGQRAHFGPITIPNITVVGPTTTVAIGGPNTAITITGGGAIRIPLISIPAAPGFGNSTTNPSSGFFNTGAGGASGFGNFGGANSGFWNLASATSGASGLLNVGALGSGLANVGTTVSGFYNTSTSDLATPAFNSGLANISTSIAGLLRDSTGTMVLNLGLANHGTLNVGIANLGDYNIGFANLGSANFGSANIGGNNIGGANTGIFDIGLANLGSYNIGFGNFGDDNLGFGNLGSYNVGFGNLGNDNLGFANTGSNNIGFANTGSNNIGIGLTGDGQIGFGSLNSGSGNIGLFNSGSGNIGFFNSGNGNVGIGNTGTANFGLGNTGSTNTGFFNSGDVNTGIGNTGSFNTGSFNPGDSNTGDFNPGSYNTGLGNTGDVDTGAFISGSYSNGFLWSGNYQGLIGLHAALAIPEIALTFGVDIPIHIPINIDAGVVTLQGFSIVAAENNIDFTPIIIPTINITLPTAAITVGGPTTSIGITASAGIGSITIPIIDIPATSGFGNSTTSPSSGFFNSGAGSASGFLNVVAGASGISGYLNVGALGSGVTNVGHTVSGFYNASALDLVTPAFASGLMRDGMGTMTLNLGLANLGSNNAGFGNTGIFDVGVANLGNYNIGFGNFGDDNLGFANLGSYNIGVANTGSNNIGFANTGSNNIGIGLTGTGQIGIGALNSGSGNIGLFNSGDGNIGFFNSGTGNFGIGNTGTGNFGIGNSGSTSTGLFNSGDGNTGGFNPGNFNTGNFNTGSFNTGGFNAGNTNTGHFNTGNYNTGIANTGDVSTGAFISGNYSNGILWRGDYQGLIGYSYALTIPEIPAHLDVNIPIDIPITGSFTDLVVDNFTIPIIGFESFAFSFHIHTEPDIGPIIVPSFVLSVPTFAIAVGGPTTAINISATAGLGPITIPIIDIPAAPGIGNSTTSPSSGFFNTGAGTASGFGNVGGNTSGLWNLASAASGVSGLLNVGALGSGVANVGNTISGIYNTSPLDLGTPAFGSGLANIAGLLQGGAGTTILDLAGLGNLNVGLANLGGSNFGIGNTGIFNVGFANVGNHNIGLANLGNYSVGFANSGNYHIGIANTGSANIGFANTGSGNIGIGLTGTGQIGFGSFNSGSHNIGLFNSGDGNVGFFNSGTGNVGIGNTGTANFGIANSGSFNTGLGNTGSTNTGLFNPGNVNTGVGNTGSINTGSFNTGSTNTGSFNLGDHNTGSFNSGDYNTGYFNAGDYNTGVANTGNVNTGAFISGNYSNGFFWRGDYQGLIGLSTTITIPEIPYRYDLSVPIDIPITGTVVATTPNSFTIPGFQIRVLLGPAAVLVNEMIGPITIDVNQVIAIDSPIQQTISMVGTGGFGPIPIGISIGGTPGFGNSTTGPSSGFFHTGAGHVSGFGNFGAGNMSGSGNFGAGNSGFFNAGGLGNSGLLNFGALQSGLANLGNTISGVYNTSTLDLATPAFGSGIANIGANLAGLFLDNTGNLTLNFGVANQGGLNAGIGNLGSVNIGFVNTGDSNLGIGNLGDLNFGGVNIGGNNIGIANTGIFDIGLANLGSYNIGLANLGDDNLGFGNAGSYNIGFANFGSDNLGFANTGSYNIGFANTGNNNIGVGLTGNGQIGIGSLNSGSNNIGLFNSGSGNIGFFNSGTGNVGIFNTGTGNFGLANSGGFNTGIGNAGSTNTGVFNPGDLNTGSFNPGSFNTGGFNPGSGNTGYLNTGDYNTGVANTGDVDTGAFITGSYSNGFLVSGDYQGLIGLPLLGIPVTPGYFNLTGGPSSGFFNSGAGSVSGFVNSGAGLSGYLNTGALGSGVANVGNTISGWLNASALDLATPGFLSGIGNFGTNLAGFFRG
>NZ_CP022577.1|WP_003401584.1|3316578_3317250_-|5,6-dimethylbenzimidazole-synthase
MFSAPERRAVYRVIAERRDMRRFVPGGVVSEDVLARLLHAAHAAPSVGLMQPWRFIRITDETLKRRIHALVDDERLLTAEALGAREEEFLALKVEGILDCAELLVVALCDRRGSYIFGRRTLPQMDLASVSCAIQNLWLAARSEGLGMGWVSLFDPQRLAALLAMPADAEPVAILCLGPVPEFPDRPALELDGWAYARPLAEFVSENRWSYPSALATDHHHGE
>NZ_CP022577.1|WP_003401589.1|3316108_3316591_+|hypothetical-protein
MAVIVRKWFGLGRLPADLRCQVEAEGLIYLAEYVAVTRRFTGVIPGLRASHSIASYVGALAFTEQRVLGTLSMVPKLAGRVVDARWDGPQAGAATAEISPTGLQLDLDVADVDPKFSGQLALHFKATIGEDVLSRLPRRSLAFDVPAEYVNLAVGVTYSP
>NZ_CP022577.1|WP_003401594.1|3315334_3316051_-|phosphatase-PAP2-family-protein
MTRPQALLAVSLAFVATAVYAVMWVGHSQDWGWLHSFDWSLLNAAHDIGIKNPAWVRFWDGVSLILGPVVLRPLGLLAAMVALAKRKIRIALLLLACLPLNAIMTIAAKSVAHRPRPATALVSAHSTSFPSGHALEATASVLALLTVLLPMLHSRFTRHIAITVGALCVLTVGVARVALNVHHPTDVVAGWALGYLYFLVCLCVFRPPSIFGAQRASHALSPPVEVSRQPEPEVDTAR
>NZ_CP022577.1|WP_003401544.1|3331992_3333390_+|sulfatase
MTSERATGQRENLLIVHWHDLGRYLGVYHHPDVYSPRLDRLAAEGILFTRAHATAPLCTPSRGSLFTGRYPQSNGLVGLAHHGWEYRTGVQTLPQLLSESGWYSALFGMQHETSYPKRLGFDEFDVSNSYCEYVVAKAQDWLHNRVPALDGQRFLLTAGFFETHRPYPHERYRPADSAAVELPDYLPDTPEVRQDVAEFYGSIATADEAVGRLLDTLADTGLDASTWVVFVTDHGPAFPRAKSTLYDAGTGIALIIRPPTRRAMAPRVYDELFSGVDLVPTLLDLLRLEVPADVEGVSHAPALLAPDTENAAVRDHVYTAKTYHDSFDPIRAIRTKEYSYIENYAPRPLLDLPWDIQESPAGMAVAPLVKAPRPQRELYDLRADPTETNNLLAGDDSTQGVAAIAADLAVRLHDWRQRTADVIPSDFAGSRIAERYTETYLRIHRKTPTGRSAIAADRGIDEHCS
>NZ_CP022577.1|WP_003401540.1|3333399_3334203_+|hypothetical-protein
MSRAVRPYLVLATQRSGSTLLVESLRATGCAGEPQEFFQYLPSTGMAPQPREWFAGVDDDTILQLLDPLDPGTPDTATPVAWREHVRTSGRTPNGVWGGKLMWNQTALLQQRAAQLPDRSGDGLRAAIRDVIGNEPVFVHVHRPDVVSQAVSFWRAVQTQVWRGHPDPKRDSQAVYHAGAIAHIIRNLRDQENGWRAWFAEEGIDPIDIAYPVLWRNLTAIVASVLDAIGQDPKLAPAPMLERQANQRSDEWVDRYRAEAPRLGLPT
>NZ_CP022577.1|WP_003401538.1|3334191_3334977_-|trans-aconitate-2-methyltransferase
MWDPDVYLAFSGHRNRPFYELVSRVGLERARRVVDLGCGPGHLTRYLARRWPGAVIEALDSSPEMVAAAAERGIDATTGDLRDWKPKPDTDVVVSNAALHWVPEHSDLLVRWVDELAPGSWIAVQIPGNFETPSHAAVRALARREPYAKLMRDIPFRVGAVVQSPAYYAELLMDTGCKVDVWETTYLHQLTGEHPVLDWITGSALVPVRERLSDESWQQFRQELIPLLNDAYPPRADGSTIFPFRRLFMVAEVGGARRSGG
>NZ_CP022577.1|WP_003898396.1|3335083_3336286_+|alpha/beta-fold-hydrolase
MSGTFTADAIGPPVPIPDVPGADAGAEGLPSRSVLSARQRILVESSAIADVALRTAVASVLSATVTPAVVANALRHVNEGSERSNLNFYAELAAAHDPAKSFPAPTELPKVTSRPASPLTEWVARGTVDNIAFASGFRAINPTMRQRWSALTANNIVHAQHWRHRDGPRPTLCVIHGFMGSSYLLNGLFFSLPWYYRSGYDVLLYTLPFHGQRAEKFSPFSGFGYFTSGLSGFAEAMAQAVYDFRSIVDYLRHIGVDRIALTGISLGGYTSALLASVESRLEAVIPNCPVVMPAKLFDEWFPANKLVKLGLRLTNISRDELIAGLAYHGPLNYRPLLPKDRRMIITGLGDRMAPPEHAVTLWKQWDRCALHWFPGSHLLHVSQLDYLRRMTVFLQGLMFD
>NZ_CP022577.1|WP_003401533.1|3336272_3337268_-|type-VII-secretion-system-ESX-3-subunit-EccE3
MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVVIGLFGFWRGLYFTTIARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLPLTLIARYLDRYGIRADTIRITSRVTASGDCRTWVGLTVVADDNLAALQARSARIPLQETAQVAARRLADHLREIGWEAGTAAPDEIPALVAADSRETWRGMRHTDSDYVAAYRVSADAELPDTLPAIRSRPAQETWIALEIAYAAGSSTRYTVAAACALRTDWRPGGTAPVAGLLPQHGNHVPALTALDPRSTRRLDGHTDAPADLLTRLHWPTPTAGAHRAPLTNAVSRT
>NZ_CP022577.1|WP_003401528.1|3337264_3338650_-|type-VII-secretion-system-ESX-3-serine-protease-mycosin-MycP3
MIRAAFACLAATVVVAGWWTPPAWAIGPPVVDAAAQPPSGDPGPVAPMEQRGACSVSGVIPGTDPGVPTPSQTMLNLPAAWQFSRGEGQLVAIIDTGVQPGPRLPNVDAGGDFVESTDGLTDCDGHGTLVAGIVAGQPGNDGFSGVAPAARLLSIRAMSTKFSPRTSGGDPQLAQATLDVAVLAGAIVHAADLGAKVINVSTITCLPADRMVDQAALGAAIRYAAVDKDAVIVAAAGNTGASGSVSASCDSNPLTDLSRPDDPRNWAGVTSVSIPSWWQPYVLSVASLTSAGQPSKFSMPGPWVGIAAPGENIASVSNSGDGALANGLPDAHQKLVALSGTSYAAGYVSGVAALVRSRYPGLNATEVVRRLTATAHRGARESSNIVGAGNLDAVAALTWQLPAEPGGGAAPAKPVADPPVPAPKDTTPRNVAFAGAAALSVLVGLTAATVAIARRRREPTE
>NZ_CP022577.1|WP_003902645.1|3338646_3340065_-|type-VII-secretion-system-ESX-3-subunit-EccD3
MSGTVMQIVRVAILADSRLTEMALPAELPLREILPAVQRLVVPSAQNGDGGQADSGAAVQLSLAPVGGQPFSLDANLDTVGVVDGDLLVLQPVPTGPAAPGIVEDIADAAMIFSTSRLKPWGIAHIQRGALAAVIAVALLATGLTVTYRVATGVLAGLLAVAGIAVASALAGLLITIRSPRSGIALSIAALVPIGAALALAVPGKFGPAQVLLGAAGVAAWSLIALMIPSAERERVVAFFTAAAVVGASVALAAGAQLLWQLPLLSIGCGLIVAALLVTIQAAQLSALWARFPLPVIPAPGDPTPSAPPLRLLEDLPRRVRVSDAHQSGFIAAAVLLSVLGSVAIAVRPEALSVVGWYLVAATAAAATLRARVWDSAACKAWLLAQPYLVAGVLLVFYTATGRYVAAFGAVLVLAVLMLAWVVVALNPGIASPESYSLPLRRLLGLVAAGLDVSLIPVMAYLVGLFAWVLNR
>NZ_CP022577.1|WP_003401521.1|3340111_3340999_-|type-VII-secretion-system-ESX-3-associated-protein-EspG3
MDATPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGAFVDRQRDELTRMGLLSPQGVINPAVADWIKVVCFPDRWLDLRYVGPASADGACELLRGIVALRTGTGKTSNKTGNGVVALRNAQLVTFTAMDIDDPRALVPILGVGLAHRPPARFDEFSLPTRVGARADERLRSGVPLGEVVDYLGIPASARPVVESVFSGPRSYVEIVAGCNRDGRHTTTEVGLSIVDTSAGRVLVSPSRAFDGEWVSTFSPGTPFAIAVAIQTLTACLPDGQWFPGQRVSRDFSTQSS
>NZ_CP022577.1|WP_003401514.1|3341009_3341300_-|WXG100-family-type-VII-secretion-target
MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG
>NZ_CP022577.1|WP_003401503.1|3341329_3341623_-|type-VII-secretion-system-protein-EsxG
MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_8

3330588-3330858

Orphan

Consensus_repeat	Method
CCCGCCGTTGCCACCGTTGCCGAA	CRISPRCasFinder

4 spacers

The CRISPR arrays of NZ_CP022577_8

>merge|NZ_CP022577|8|3330588-3330858|CRISPRCasFinder
CCCGCCGGCACCACCGTTGCCACTGTCGCCAACCGGGCCGGATAGAACGCTGCCGCCGTGGCCGCCCGGGCCGCCGGCGCCGCCGGTGCCGCCGTTGCCGCCTTTGCCACCGGCGCCGGCTGTGTTGACCGATCCGCCGCTGACGTGGCCGCCGTTGCCGCCGGCACCGCCGGGCGCACCGACCCCGCCGTTCCCGCCGGTGGCACCATTGCCGCCGCTCGCAGAGGAGCCGGTAGCGCCAGTGTGCTCGACGCTGCCACCATTGCCGCCG

>NZ_CP022577|8|5|3330588-3330858|CRISPRCasFinder
CCCGCCGGCACCACCGTTGCCACT	GTCGCCAACCGGGCCGGATAGAACGCTGCCGCCGTGGCCGCCCGG
GCCGCCGGCGCCGCCGGTGCCGCC	GTTGCCGCCTTTGCCACCGGCGCCGGCTGTGTTGACCGATCCGCC
GCTGACGTGGCCGCCGTTGCCGCC	GGCACCGCCGGGCGCACCGAC
CCCGCCGTTCCCGCCGGTGGCACC	ATTGCCGCCGCTCGCAGAGGAGCCGGTAGCGCCAGTGTG
CTCGACGCTGCCACCATTGCCGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003401521.1\|3340111_3340999_-\|type-VII-secretion-system-ESX-3-associated-protein-EspG3	unknown	unknown	gnl\|CDD\|379414
NZ_CP022577.1\|WP_003911082.1\|3317452_3326998_+\|PPE-family-protein	unknown	unknown	gnl\|CDD\|366325
NZ_CP022577.1\|WP_003401566.1\|3328678_3329104_-\|PIN-domain-nuclease	unknown	unknown	gnl\|CDD\|350322
NZ_CP022577.1\|WP_003401560.1\|3329369_3329672_-\|toxin-antitoxin-system-toxin	unknown	unknown	unknown
NZ_CP022577.1\|WP_003401503.1\|3341329_3341623_-\|type-VII-secretion-system-protein-EsxG	unknown	unknown	gnl\|CDD\|274862
NZ_CP022577.1\|WP_003898396.1\|3335083_3336286_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|366166
NZ_CP022577.1\|WP_003401538.1\|3334191_3334977_-\|trans-aconitate-2-methyltransferase	unknown	unknown	gnl\|CDD\|184509
NZ_CP022577.1\|WP_003902645.1\|3338646_3340065_-\|type-VII-secretion-system-ESX-3-subunit-EccD3	unknown	unknown	gnl\|CDD\|274855
NZ_CP022577.1\|WP_003401589.1\|3316108_3316591_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003401584.1\|3316578_3317250_-\|5,6-dimethylbenzimidazole-synthase	unknown	unknown	gnl\|CDD\|162875
NZ_CP022577.1\|WP_003905275.1\|3327910_3328543_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP022577.1\|WP_003401540.1\|3333399_3334203_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226848
NZ_CP022577.1\|WP_003401528.1\|3337264_3338650_-\|type-VII-secretion-system-ESX-3-serine-protease-mycosin-MycP3	unknown	unknown	gnl\|CDD\|274856
NZ_CP022577.1\|WP_003401555.1\|3329668_3329896_-\|ribbon-helix-helix-protein,-CopG-family	unknown	unknown	gnl\|CDD\|279710
NZ_CP022577.1\|WP_003401594.1\|3315334_3316051_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP022577.1\|WP_003401563.1\|3329100_3329322_-\|type-II-toxin-antitoxin-system-antitoxin-VapB2	unknown	unknown	gnl\|CDD\|222832
NZ_CP022577.1\|WP_003900117.1\|3327005_3327914_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187670
NZ_CP022577.1\|WP_003401514.1\|3341009_3341300_-\|WXG100-family-type-VII-secretion-target	unknown	unknown	gnl\|CDD\|227179
NZ_CP022577.1\|WP_003401544.1\|3331992_3333390_+\|sulfatase	unknown	unknown	gnl\|CDD\|293751
NZ_CP022577.1\|WP_003401533.1\|3336272_3337268_-\|type-VII-secretion-system-ESX-3-subunit-EccE3	unknown	unknown	gnl\|CDD\|274857

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003911082.1\|3317452_3326998_+\|PPE-family-protein	gnl\|CDD\|366325	pfam00823, PPE, PPE family. This family named after a PPE motif near to the amino terminus of the domain. The PPE family of proteins all contain an amino-terminal region of about 180 amino acids. The carboxyl terminus of this family are variable, and on the basis of this region fall into at least three groups. The MPTR subgroup has tandem copies of a motif NXGXGNXG. The second subgroup contains a conserved motif at about position 350. The third group are only related in the amino terminal region. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.96927e-83
NZ_CP022577.1\|WP_003401594.1\|3315334_3316051_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	2.34145e-31
NZ_CP022577.1\|WP_003401566.1\|3328678_3329104_-\|PIN-domain-nuclease	gnl\|CDD\|350322	cd18755, PIN_MtVapC3_VapC21-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC3, VapC21 and related proteins. This subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC3 and VapC21 toxins. It belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is a PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include FitB toxin of the FitAB TA system, eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.62509e-57
NZ_CP022577.1\|WP_003401503.1\|3341329_3341623_-\|type-VII-secretion-system-protein-EsxG	gnl\|CDD\|274862	TIGR03930, WXG100_ESAT6, WXG100 family type VII secretion target. Members of this protein family include secretion targets for the two main variants of type VII secretion systems (T7SS), one found in the Actinobacteria, one found in the Firmicutes. This model was derived through iteration from pfam06013. The best characterized member of this family is ESAT-6 from Mycobacterium tuberculosis. Members of this family usually are ~100 amino acids in length but occasionally have a long C-terminal extension.	0.00514324
NZ_CP022577.1\|WP_003401538.1\|3334191_3334977_-\|trans-aconitate-2-methyltransferase	gnl\|CDD\|184509	PRK14103, PRK14103, trans-aconitate 2-methyltransferase; Provisional.	8.03642e-167
NZ_CP022577.1\|WP_003902645.1\|3338646_3340065_-\|type-VII-secretion-system-ESX-3-subunit-EccD3	gnl\|CDD\|274855	TIGR03920, T7SS_EccD, type VII secretion integral membrane protein EccD. Members of this family are EccD, a component of actinobacterial type VII secretion systems (T7SS) with ten to eleven predicted transmembrane helix regions. [Protein fate, Protein and peptide secretion and trafficking].	1.59367e-76
NZ_CP022577.1\|WP_003401533.1\|3336272_3337268_-\|type-VII-secretion-system-ESX-3-subunit-EccE3	gnl\|CDD\|274857	TIGR03923, T7SS_EccE, type VII secretion protein EccE. This model represents the transmembrane protein EccB of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccE1, EccE2, etc. This model represents a conserved core region, and many members have 200 or more additional C-terminal residues. [Protein fate, Protein and peptide secretion and trafficking].	1.38183e-59
NZ_CP022577.1\|WP_003401584.1\|3316578_3317250_-\|5,6-dimethylbenzimidazole-synthase	gnl\|CDD\|162875	TIGR02476, BluB, 5,6-dimethylbenzimidazole synthase. A previously published hypothesis that BluB, involved in cobalamin biosynthesis, is EC 1.16.8.1 (cob(II)yrinic acid a,c-diamide reductase) is now contradicted by newer work ascribing a role in 5,6-dimethylbenzimidazole (DMB) biosynthesis. The BluB protein is related to the nitroreductase family (pfam0881). [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin].	6.73571e-73
NZ_CP022577.1\|WP_003905275.1\|3327910_3328543_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.1641e-15
NZ_CP022577.1\|WP_003401540.1\|3333399_3334203_+\|hypothetical-protein	gnl\|CDD\|226848	COG4424, COG4424, Uncharacterized protein conserved in bacteria [Function unknown].	2.12891e-123
NZ_CP022577.1\|WP_003401528.1\|3337264_3338650_-\|type-VII-secretion-system-ESX-3-serine-protease-mycosin-MycP3	gnl\|CDD\|274856	TIGR03921, T7SS_mycosin, type VII secretion-associated serine protease mycosin. Members of this family are subtilisin-related serine proteases, found strictly in the Actinobacteria and associated with type VII secretion operons. The designation mycosin is used for members from Mycobacterium. [Protein fate, Protein and peptide secretion and trafficking, Protein fate, Protein modification and repair].	2.49308e-115
NZ_CP022577.1\|WP_003401555.1\|3329668_3329896_-\|ribbon-helix-helix-protein,-CopG-family	gnl\|CDD\|279710	pfam01402, RHH_1, Ribbon-helix-helix protein, copG family. The structure of this protein repressor, which is the shortest reported to date and the first isolated from a plasmid, has a homodimeric ribbon-helix-helix arrangement. The helix-turn-helix-like structure is involved in dimerization and not DNA binding as might have been expected.	0.000113886
NZ_CP022577.1\|WP_003898396.1\|3335083_3336286_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	1.89486e-06
NZ_CP022577.1\|WP_003401563.1\|3329100_3329322_-\|type-II-toxin-antitoxin-system-antitoxin-VapB2	gnl\|CDD\|222832	PHA01748, PHA01748, hypothetical protein.	0.00852727
NZ_CP022577.1\|WP_003900117.1\|3327005_3327914_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187670	cd09810, LPOR_like_SDR_c_like, light-dependent protochlorophyllide reductase (LPOR)-like, classical (c)-like SDRs. Classical SDR-like subgroup containing LPOR and related proteins. Protochlorophyllide (Pchlide) reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.69352e-146
NZ_CP022577.1\|WP_003401521.1\|3340111_3340999_-\|type-VII-secretion-system-ESX-3-associated-protein-EspG3	gnl\|CDD\|379414	pfam14011, ESX-1_EspG, EspG family. This family of proteins contains the the EspG1, EspG2 and EspG3 proteins from M. tuberculosis. These proteins are involved in the ESAT-6 secretion system 1 (ESX-1) of Mycobacterium tuberculosis which is important for virulence and intercellular spread. Proteins in this family are typically between 254 and 295 amino acids in length.	1.29098e-54
NZ_CP022577.1\|WP_003401514.1\|3341009_3341300_-\|WXG100-family-type-VII-secretion-target	gnl\|CDD\|227179	COG4842, COG4842, Uncharacterized protein conserved in bacteria [Function unknown].	2.85211e-21
NZ_CP022577.1\|WP_003401544.1\|3331992_3333390_+\|sulfatase	gnl\|CDD\|293751	cd16027, SGSH, N-sulfoglucosamine sulfohydrolase (SGSH; sulfamidase). N-sulfoglucosamine sulfohydrolase (SGSH) belongs to the sulfatase family and catalyses the cleavage of N-linked sulfate groups from the GAGs heparin sulfate and heparin. The active site is characterized by the amino-acid sequence motif C(X)PSR that is highly conserved among most sulfatases. The cysteine residue is post-translationally converted to a formylglycine (FGly) residue, which is crucial for the catalytic process. Loss of function of SGSH results a disease called mucopolysaccharidosis type IIIA (Sanfilippo A syndrome), a fatal childhood-onset neurodegenerative disease with mild facial, visceral and skeletal abnormalities.	5.75322e-137

>NZ_CP022577.1|WP_003401555.1|3329668_3329896_-|ribbon-helix-helix-protein,-CopG-family
MTKEKISVTVDAAVLAAIDADARAAGLNRSEMIEQALRNEHLRVALRDYTAKTVPALDIDAYAQRVYQANRAAGS
>NZ_CP022577.1|WP_003401560.1|3329369_3329672_-|toxin-antitoxin-system-toxin
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPLGNAGVAALREAASVVTALLC
>NZ_CP022577.1|WP_003401563.1|3329100_3329322_-|type-II-toxin-antitoxin-system-antitoxin-VapB2
MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVAGLGDPELMRQAWR
>NZ_CP022577.1|WP_003401566.1|3328678_3329104_-|PIN-domain-nuclease
MTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
>NZ_CP022577.1|WP_003905275.1|3327910_3328543_-|TetR/AcrR-family-transcriptional-regulator
MGVPAKKKQQQGERSRESILDATERLMATKGYAATSISDIRDACGLAPSSIYWHFGSKEGVLAAMMERGAQRFFAAIPTWDEADGPVEQRSERQLTELVSLQSQHPDFLRLFYLLSMERSQDPAVAAVVRRVRNTAIARFRDSITHLLPSDIPPGKADLVVAELTAFAVALSDGVYFAGHLEPDTTDVERMYRRLRQALEALIPVLLEET
>NZ_CP022577.1|WP_003900117.1|3327005_3327914_-|SDR-family-NAD(P)-dependent-oxidoreductase
MNTGTAVITGASSGLGLQCARALLRRDASWHVVLAVRDPARGRAAMEELGEPNRCSVLEVDLASVRSVRSFVETVRTTPLPPIRALVCNAGLQVVSGIAFTDDGVEMTFGVNHLGHFALVTGILDWLARPARIVVVSSGTHDPSKHTGMPDPRYTCAADLAHPPTDQNTPAEGRRRYTTSKLCNVLFTYELDRRLDHGEQGVMVNAFDPGLMPGSGLARDYPPILRLAYRLLSPMLRVLPFVHSTRVSGEHLAALAVDPRFAGVTGQYFAGAKAIRSSAESYDRAKALDLWETSERLLAQVT
>NZ_CP022577.1|WP_003911082.1|3317452_3326998_+|PPE-family-protein
MDFVVSAPEVNSLRMYLGAGSGPMLAAAAAWDGLADELAVAASWFGSVTSGLADAAWRGPAAVAMARAVAPYLGWLISATAQAEQAAAQARVAVATFEAARAATVHPAIVAANRAVLVSLVSSNLLGFNAPAIAATEAAYERMWAQDVAAMVGYHAGASAAVSALMPFTQQLKKLAGLSERLTSAAAAAAGPPSAAGFNLGLANVGANNVGNGNVGVFNVGFGNLGSYNLGFANLGSDNLGLANLGGHNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIGFGSFNSGSHNIGLFNSGSGNVGLFNSGTGNFGIGNSGTGNFGLGNTGSTNTGWFNTGDVNTGGFNPGSYNTGNFNTGNYNTGSFNAGNYNTGYFNTGDYNTGVANTGNVNTGAFIAGNYSNGVLWRGDYQGLIGADIALEIPAIPINAQLFSMPIHQVMVMPGSVMTIPGMRLPFTSIVPFVVYYGPVELPQSTLTLPTVTITVGGPTTTIDGNLTGMVGGVSIPLIKIPAAPGFGNSTTSPSSGFFNAGAGTASGFGNFGGGASGFWNLASATSGLSGFGNVGALGSGVANVGNTISGLYNTSTSNLATPAFNSGLLHHSVGTMTLNFGLANVGGNNVGGANAGIFNVGLANLGDYNIGFGNLGGDNLGFAHAGSYNIGFANTGSNNLGFANTGDNNIGFANIGSNNIGIGLTGSGQIGFGSLNSGSHNIGLFNSGDGNIGLFNSGSGNFGIGNAGTGNWGIGNSGAGNFGIGNAGSTNTGLFNSGDLNTGSLNPGSYNTGSVNTGSVNTGGFNAGNYNTGYFNTGDYNTGMANTGNINTGAFISGNHSNGLLWRGDNQGLIDLAIGVDIPEIPIVSVDVNIPIHIPITASFTDIVYSGLDLPPNTAVTVIFFGPVDIDPFTVPVIRITGPTPVVMVGGPTTAINIGATVGVDAINIPIIHIPATPGFGNSTGGLSSGFFNSGAGSASGFGNFGGAASGFMNLVSTTSGMSGFLNVGALGSGVANVGNTISGIYNVGTSDLSTPAVNSGLANIGTNIAGLLRDGAGTAAINLGLANHGNLNVGFASLGGFNFGGATIGHNNVGIGNTGIFDVGLANLGSYNIGFGNLGDDNLGFGNFGSYNIGFGNVGNDNLGFANAGGGNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIGFGSFNSGSGNIGLFNSGSNNIGFFNSGSGNFGIANSGSFNTGIGNTGNTNTGLFNSGDVNTGAFNPGSFNTGSFNTGSFNTGGFNPGNTNTGYLNIGNYNTGIANTGDVDTGAFITGNYSNGLFLSGDYQGLVGLNLVIDMPLPISLGVNIPIDIPITASAGNITLMGVTIPPTGDIVLSSIAGQRAHFGPITIPNITVVGPTTTVAIGGPNTAITITGGGAIRIPLISIPAAPGFGNSTTNPSSGFFNTGAGGASGFGNFGGANSGFWNLASATSGASGLLNVGALGSGLANVGTTVSGFYNTSTSDLATPAFNSGLANISTSIAGLLRDSTGTMVLNLGLANHGTLNVGIANLGDYNIGFANLGSANFGSANIGGNNIGGANTGIFDIGLANLGSYNIGFGNFGDDNLGFGNLGSYNVGFGNLGNDNLGFANTGSNNIGFANTGSNNIGIGLTGDGQIGFGSLNSGSGNIGLFNSGSGNIGFFNSGNGNVGIGNTGTANFGLGNTGSTNTGFFNSGDVNTGIGNTGSFNTGSFNPGDSNTGDFNPGSYNTGLGNTGDVDTGAFISGSYSNGFLWSGNYQGLIGLHAALAIPEIALTFGVDIPIHIPINIDAGVVTLQGFSIVAAENNIDFTPIIIPTINITLPTAAITVGGPTTSIGITASAGIGSITIPIIDIPATSGFGNSTTSPSSGFFNSGAGSASGFLNVVAGASGISGYLNVGALGSGVTNVGHTVSGFYNASALDLVTPAFASGLMRDGMGTMTLNLGLANLGSNNAGFGNTGIFDVGVANLGNYNIGFGNFGDDNLGFANLGSYNIGVANTGSNNIGFANTGSNNIGIGLTGTGQIGIGALNSGSGNIGLFNSGDGNIGFFNSGTGNFGIGNTGTGNFGIGNSGSTSTGLFNSGDGNTGGFNPGNFNTGNFNTGSFNTGGFNAGNTNTGHFNTGNYNTGIANTGDVSTGAFISGNYSNGILWRGDYQGLIGYSYALTIPEIPAHLDVNIPIDIPITGSFTDLVVDNFTIPIIGFESFAFSFHIHTEPDIGPIIVPSFVLSVPTFAIAVGGPTTAINISATAGLGPITIPIIDIPAAPGIGNSTTSPSSGFFNTGAGTASGFGNVGGNTSGLWNLASAASGVSGLLNVGALGSGVANVGNTISGIYNTSPLDLGTPAFGSGLANIAGLLQGGAGTTILDLAGLGNLNVGLANLGGSNFGIGNTGIFNVGFANVGNHNIGLANLGNYSVGFANSGNYHIGIANTGSANIGFANTGSGNIGIGLTGTGQIGFGSFNSGSHNIGLFNSGDGNVGFFNSGTGNVGIGNTGTANFGIANSGSFNTGLGNTGSTNTGLFNPGNVNTGVGNTGSINTGSFNTGSTNTGSFNLGDHNTGSFNSGDYNTGYFNAGDYNTGVANTGNVNTGAFISGNYSNGFFWRGDYQGLIGLSTTITIPEIPYRYDLSVPIDIPITGTVVATTPNSFTIPGFQIRVLLGPAAVLVNEMIGPITIDVNQVIAIDSPIQQTISMVGTGGFGPIPIGISIGGTPGFGNSTTGPSSGFFHTGAGHVSGFGNFGAGNMSGSGNFGAGNSGFFNAGGLGNSGLLNFGALQSGLANLGNTISGVYNTSTLDLATPAFGSGIANIGANLAGLFLDNTGNLTLNFGVANQGGLNAGIGNLGSVNIGFVNTGDSNLGIGNLGDLNFGGVNIGGNNIGIANTGIFDIGLANLGSYNIGLANLGDDNLGFGNAGSYNIGFANFGSDNLGFANTGSYNIGFANTGNNNIGVGLTGNGQIGIGSLNSGSNNIGLFNSGSGNIGFFNSGTGNVGIFNTGTGNFGLANSGGFNTGIGNAGSTNTGVFNPGDLNTGSFNPGSFNTGGFNPGSGNTGYLNTGDYNTGVANTGDVDTGAFITGSYSNGFLVSGDYQGLIGLPLLGIPVTPGYFNLTGGPSSGFFNSGAGSVSGFVNSGAGLSGYLNTGALGSGVANVGNTISGWLNASALDLATPGFLSGIGNFGTNLAGFFRG
>NZ_CP022577.1|WP_003401584.1|3316578_3317250_-|5,6-dimethylbenzimidazole-synthase
MFSAPERRAVYRVIAERRDMRRFVPGGVVSEDVLARLLHAAHAAPSVGLMQPWRFIRITDETLKRRIHALVDDERLLTAEALGAREEEFLALKVEGILDCAELLVVALCDRRGSYIFGRRTLPQMDLASVSCAIQNLWLAARSEGLGMGWVSLFDPQRLAALLAMPADAEPVAILCLGPVPEFPDRPALELDGWAYARPLAEFVSENRWSYPSALATDHHHGE
>NZ_CP022577.1|WP_003401589.1|3316108_3316591_+|hypothetical-protein
MAVIVRKWFGLGRLPADLRCQVEAEGLIYLAEYVAVTRRFTGVIPGLRASHSIASYVGALAFTEQRVLGTLSMVPKLAGRVVDARWDGPQAGAATAEISPTGLQLDLDVADVDPKFSGQLALHFKATIGEDVLSRLPRRSLAFDVPAEYVNLAVGVTYSP
>NZ_CP022577.1|WP_003401594.1|3315334_3316051_-|phosphatase-PAP2-family-protein
MTRPQALLAVSLAFVATAVYAVMWVGHSQDWGWLHSFDWSLLNAAHDIGIKNPAWVRFWDGVSLILGPVVLRPLGLLAAMVALAKRKIRIALLLLACLPLNAIMTIAAKSVAHRPRPATALVSAHSTSFPSGHALEATASVLALLTVLLPMLHSRFTRHIAITVGALCVLTVGVARVALNVHHPTDVVAGWALGYLYFLVCLCVFRPPSIFGAQRASHALSPPVEVSRQPEPEVDTAR
>NZ_CP022577.1|WP_003401544.1|3331992_3333390_+|sulfatase
MTSERATGQRENLLIVHWHDLGRYLGVYHHPDVYSPRLDRLAAEGILFTRAHATAPLCTPSRGSLFTGRYPQSNGLVGLAHHGWEYRTGVQTLPQLLSESGWYSALFGMQHETSYPKRLGFDEFDVSNSYCEYVVAKAQDWLHNRVPALDGQRFLLTAGFFETHRPYPHERYRPADSAAVELPDYLPDTPEVRQDVAEFYGSIATADEAVGRLLDTLADTGLDASTWVVFVTDHGPAFPRAKSTLYDAGTGIALIIRPPTRRAMAPRVYDELFSGVDLVPTLLDLLRLEVPADVEGVSHAPALLAPDTENAAVRDHVYTAKTYHDSFDPIRAIRTKEYSYIENYAPRPLLDLPWDIQESPAGMAVAPLVKAPRPQRELYDLRADPTETNNLLAGDDSTQGVAAIAADLAVRLHDWRQRTADVIPSDFAGSRIAERYTETYLRIHRKTPTGRSAIAADRGIDEHCS
>NZ_CP022577.1|WP_003401540.1|3333399_3334203_+|hypothetical-protein
MSRAVRPYLVLATQRSGSTLLVESLRATGCAGEPQEFFQYLPSTGMAPQPREWFAGVDDDTILQLLDPLDPGTPDTATPVAWREHVRTSGRTPNGVWGGKLMWNQTALLQQRAAQLPDRSGDGLRAAIRDVIGNEPVFVHVHRPDVVSQAVSFWRAVQTQVWRGHPDPKRDSQAVYHAGAIAHIIRNLRDQENGWRAWFAEEGIDPIDIAYPVLWRNLTAIVASVLDAIGQDPKLAPAPMLERQANQRSDEWVDRYRAEAPRLGLPT
>NZ_CP022577.1|WP_003401538.1|3334191_3334977_-|trans-aconitate-2-methyltransferase
MWDPDVYLAFSGHRNRPFYELVSRVGLERARRVVDLGCGPGHLTRYLARRWPGAVIEALDSSPEMVAAAAERGIDATTGDLRDWKPKPDTDVVVSNAALHWVPEHSDLLVRWVDELAPGSWIAVQIPGNFETPSHAAVRALARREPYAKLMRDIPFRVGAVVQSPAYYAELLMDTGCKVDVWETTYLHQLTGEHPVLDWITGSALVPVRERLSDESWQQFRQELIPLLNDAYPPRADGSTIFPFRRLFMVAEVGGARRSGG
>NZ_CP022577.1|WP_003898396.1|3335083_3336286_+|alpha/beta-fold-hydrolase
MSGTFTADAIGPPVPIPDVPGADAGAEGLPSRSVLSARQRILVESSAIADVALRTAVASVLSATVTPAVVANALRHVNEGSERSNLNFYAELAAAHDPAKSFPAPTELPKVTSRPASPLTEWVARGTVDNIAFASGFRAINPTMRQRWSALTANNIVHAQHWRHRDGPRPTLCVIHGFMGSSYLLNGLFFSLPWYYRSGYDVLLYTLPFHGQRAEKFSPFSGFGYFTSGLSGFAEAMAQAVYDFRSIVDYLRHIGVDRIALTGISLGGYTSALLASVESRLEAVIPNCPVVMPAKLFDEWFPANKLVKLGLRLTNISRDELIAGLAYHGPLNYRPLLPKDRRMIITGLGDRMAPPEHAVTLWKQWDRCALHWFPGSHLLHVSQLDYLRRMTVFLQGLMFD
>NZ_CP022577.1|WP_003401533.1|3336272_3337268_-|type-VII-secretion-system-ESX-3-subunit-EccE3
MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVVIGLFGFWRGLYFTTIARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLPLTLIARYLDRYGIRADTIRITSRVTASGDCRTWVGLTVVADDNLAALQARSARIPLQETAQVAARRLADHLREIGWEAGTAAPDEIPALVAADSRETWRGMRHTDSDYVAAYRVSADAELPDTLPAIRSRPAQETWIALEIAYAAGSSTRYTVAAACALRTDWRPGGTAPVAGLLPQHGNHVPALTALDPRSTRRLDGHTDAPADLLTRLHWPTPTAGAHRAPLTNAVSRT
>NZ_CP022577.1|WP_003401528.1|3337264_3338650_-|type-VII-secretion-system-ESX-3-serine-protease-mycosin-MycP3
MIRAAFACLAATVVVAGWWTPPAWAIGPPVVDAAAQPPSGDPGPVAPMEQRGACSVSGVIPGTDPGVPTPSQTMLNLPAAWQFSRGEGQLVAIIDTGVQPGPRLPNVDAGGDFVESTDGLTDCDGHGTLVAGIVAGQPGNDGFSGVAPAARLLSIRAMSTKFSPRTSGGDPQLAQATLDVAVLAGAIVHAADLGAKVINVSTITCLPADRMVDQAALGAAIRYAAVDKDAVIVAAAGNTGASGSVSASCDSNPLTDLSRPDDPRNWAGVTSVSIPSWWQPYVLSVASLTSAGQPSKFSMPGPWVGIAAPGENIASVSNSGDGALANGLPDAHQKLVALSGTSYAAGYVSGVAALVRSRYPGLNATEVVRRLTATAHRGARESSNIVGAGNLDAVAALTWQLPAEPGGGAAPAKPVADPPVPAPKDTTPRNVAFAGAAALSVLVGLTAATVAIARRRREPTE
>NZ_CP022577.1|WP_003902645.1|3338646_3340065_-|type-VII-secretion-system-ESX-3-subunit-EccD3
MSGTVMQIVRVAILADSRLTEMALPAELPLREILPAVQRLVVPSAQNGDGGQADSGAAVQLSLAPVGGQPFSLDANLDTVGVVDGDLLVLQPVPTGPAAPGIVEDIADAAMIFSTSRLKPWGIAHIQRGALAAVIAVALLATGLTVTYRVATGVLAGLLAVAGIAVASALAGLLITIRSPRSGIALSIAALVPIGAALALAVPGKFGPAQVLLGAAGVAAWSLIALMIPSAERERVVAFFTAAAVVGASVALAAGAQLLWQLPLLSIGCGLIVAALLVTIQAAQLSALWARFPLPVIPAPGDPTPSAPPLRLLEDLPRRVRVSDAHQSGFIAAAVLLSVLGSVAIAVRPEALSVVGWYLVAATAAAATLRARVWDSAACKAWLLAQPYLVAGVLLVFYTATGRYVAAFGAVLVLAVLMLAWVVVALNPGIASPESYSLPLRRLLGLVAAGLDVSLIPVMAYLVGLFAWVLNR
>NZ_CP022577.1|WP_003401521.1|3340111_3340999_-|type-VII-secretion-system-ESX-3-associated-protein-EspG3
MDATPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGAFVDRQRDELTRMGLLSPQGVINPAVADWIKVVCFPDRWLDLRYVGPASADGACELLRGIVALRTGTGKTSNKTGNGVVALRNAQLVTFTAMDIDDPRALVPILGVGLAHRPPARFDEFSLPTRVGARADERLRSGVPLGEVVDYLGIPASARPVVESVFSGPRSYVEIVAGCNRDGRHTTTEVGLSIVDTSAGRVLVSPSRAFDGEWVSTFSPGTPFAIAVAIQTLTACLPDGQWFPGQRVSRDFSTQSS
>NZ_CP022577.1|WP_003401514.1|3341009_3341300_-|WXG100-family-type-VII-secretion-target
MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG
>NZ_CP022577.1|WP_003401503.1|3341329_3341623_-|type-VII-secretion-system-protein-EsxG
MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_9

3331128-3331469

Orphan

Consensus_repeat	Method
CCCGCCGTTGCCACCGTTGCCGAA	CRISPRCasFinder

5 spacers

The CRISPR arrays of NZ_CP022577_9

>merge|NZ_CP022577|9|3331128-3331469|CRISPRCasFinder
CCCGCCCATGCCGCCGTTGCCGCCGTTGCCGAAGAACCCGGCGTTGCCGCCGTCGCCGCCGGCGCCGCCGAGACCGCCGTTGATGCCGGCAACACCGATCCCGCCGGCCCCGCCGTTGCCGCCGAAGCCGAAGAACCAGCCGGCGGTGCCGCCGGCGCCGCCGTTCGCTCCGGCCCCGCCGTCCCCGCCGTTGCCACCGTTGCCGAAGAACCCGGCCGCCCCGCCGGCCCCGCCGGCCTGTCCGGGTGCGCCGGACCCGCCGTTGCCGCCGTTGCCGAACAACAGCCCACCGTCGCCGCCGGCCTGCCCGGTGCCCGGCGCCCCGTTGGCACCGTTGCCGAT

>NZ_CP022577|9|6|3331128-3331469|CRISPRCasFinder
CCCGCCCATGCCGCCGTTGCCGCC	GTTGCCGAAGAACCCGGCGTT
GCCGCCGTCGCCGCCGGCGCCGCC	GAGACCGCCGTTGATGCCGGCAACACCGAT
CCCGCCGGCCCCGCCGTTGCCGCC	GAAGCCGAAGAACCAGCCGGCGGTGCCGCCGGCGCCGCCGTTCGCTCCGGC
CCCGCCGTCCCCGCCGTTGCCACC	GTTGCCGAAGAACCCGGCCGCCCCGCCGGCCCCGCCGGCCTGTCCGGGTGCGCCGGA
CCCGCCGTTGCCGCCGTTGCCGAA	CAACAGCCCACCGTCGCCGCCGGCCTGCCCGGTGCCCGG
CGCCCCGTTGGCACCGTTGCCGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003401521.1\|3340111_3340999_-\|type-VII-secretion-system-ESX-3-associated-protein-EspG3	unknown	unknown	gnl\|CDD\|379414
NZ_CP022577.1\|WP_003911082.1\|3317452_3326998_+\|PPE-family-protein	unknown	unknown	gnl\|CDD\|366325
NZ_CP022577.1\|WP_003401566.1\|3328678_3329104_-\|PIN-domain-nuclease	unknown	unknown	gnl\|CDD\|350322
NZ_CP022577.1\|WP_003401560.1\|3329369_3329672_-\|toxin-antitoxin-system-toxin	unknown	unknown	unknown
NZ_CP022577.1\|WP_003401503.1\|3341329_3341623_-\|type-VII-secretion-system-protein-EsxG	unknown	unknown	gnl\|CDD\|274862
NZ_CP022577.1\|WP_003898396.1\|3335083_3336286_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|366166
NZ_CP022577.1\|WP_003401538.1\|3334191_3334977_-\|trans-aconitate-2-methyltransferase	unknown	unknown	gnl\|CDD\|184509
NZ_CP022577.1\|WP_003902645.1\|3338646_3340065_-\|type-VII-secretion-system-ESX-3-subunit-EccD3	unknown	unknown	gnl\|CDD\|274855
NZ_CP022577.1\|WP_003401589.1\|3316108_3316591_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003401584.1\|3316578_3317250_-\|5,6-dimethylbenzimidazole-synthase	unknown	unknown	gnl\|CDD\|162875
NZ_CP022577.1\|WP_003905275.1\|3327910_3328543_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP022577.1\|WP_003401540.1\|3333399_3334203_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226848
NZ_CP022577.1\|WP_003401528.1\|3337264_3338650_-\|type-VII-secretion-system-ESX-3-serine-protease-mycosin-MycP3	unknown	unknown	gnl\|CDD\|274856
NZ_CP022577.1\|WP_003401555.1\|3329668_3329896_-\|ribbon-helix-helix-protein,-CopG-family	unknown	unknown	gnl\|CDD\|279710
NZ_CP022577.1\|WP_003401594.1\|3315334_3316051_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP022577.1\|WP_003401563.1\|3329100_3329322_-\|type-II-toxin-antitoxin-system-antitoxin-VapB2	unknown	unknown	gnl\|CDD\|222832
NZ_CP022577.1\|WP_003900117.1\|3327005_3327914_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187670
NZ_CP022577.1\|WP_003401514.1\|3341009_3341300_-\|WXG100-family-type-VII-secretion-target	unknown	unknown	gnl\|CDD\|227179
NZ_CP022577.1\|WP_003401544.1\|3331992_3333390_+\|sulfatase	unknown	unknown	gnl\|CDD\|293751
NZ_CP022577.1\|WP_003401533.1\|3336272_3337268_-\|type-VII-secretion-system-ESX-3-subunit-EccE3	unknown	unknown	gnl\|CDD\|274857

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003911082.1\|3317452_3326998_+\|PPE-family-protein	gnl\|CDD\|366325	pfam00823, PPE, PPE family. This family named after a PPE motif near to the amino terminus of the domain. The PPE family of proteins all contain an amino-terminal region of about 180 amino acids. The carboxyl terminus of this family are variable, and on the basis of this region fall into at least three groups. The MPTR subgroup has tandem copies of a motif NXGXGNXG. The second subgroup contains a conserved motif at about position 350. The third group are only related in the amino terminal region. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.96927e-83
NZ_CP022577.1\|WP_003401594.1\|3315334_3316051_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	2.34145e-31
NZ_CP022577.1\|WP_003401566.1\|3328678_3329104_-\|PIN-domain-nuclease	gnl\|CDD\|350322	cd18755, PIN_MtVapC3_VapC21-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC3, VapC21 and related proteins. This subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC3 and VapC21 toxins. It belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is a PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include FitB toxin of the FitAB TA system, eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.62509e-57
NZ_CP022577.1\|WP_003401503.1\|3341329_3341623_-\|type-VII-secretion-system-protein-EsxG	gnl\|CDD\|274862	TIGR03930, WXG100_ESAT6, WXG100 family type VII secretion target. Members of this protein family include secretion targets for the two main variants of type VII secretion systems (T7SS), one found in the Actinobacteria, one found in the Firmicutes. This model was derived through iteration from pfam06013. The best characterized member of this family is ESAT-6 from Mycobacterium tuberculosis. Members of this family usually are ~100 amino acids in length but occasionally have a long C-terminal extension.	0.00514324
NZ_CP022577.1\|WP_003401538.1\|3334191_3334977_-\|trans-aconitate-2-methyltransferase	gnl\|CDD\|184509	PRK14103, PRK14103, trans-aconitate 2-methyltransferase; Provisional.	8.03642e-167
NZ_CP022577.1\|WP_003902645.1\|3338646_3340065_-\|type-VII-secretion-system-ESX-3-subunit-EccD3	gnl\|CDD\|274855	TIGR03920, T7SS_EccD, type VII secretion integral membrane protein EccD. Members of this family are EccD, a component of actinobacterial type VII secretion systems (T7SS) with ten to eleven predicted transmembrane helix regions. [Protein fate, Protein and peptide secretion and trafficking].	1.59367e-76
NZ_CP022577.1\|WP_003401533.1\|3336272_3337268_-\|type-VII-secretion-system-ESX-3-subunit-EccE3	gnl\|CDD\|274857	TIGR03923, T7SS_EccE, type VII secretion protein EccE. This model represents the transmembrane protein EccB of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccE1, EccE2, etc. This model represents a conserved core region, and many members have 200 or more additional C-terminal residues. [Protein fate, Protein and peptide secretion and trafficking].	1.38183e-59
NZ_CP022577.1\|WP_003401584.1\|3316578_3317250_-\|5,6-dimethylbenzimidazole-synthase	gnl\|CDD\|162875	TIGR02476, BluB, 5,6-dimethylbenzimidazole synthase. A previously published hypothesis that BluB, involved in cobalamin biosynthesis, is EC 1.16.8.1 (cob(II)yrinic acid a,c-diamide reductase) is now contradicted by newer work ascribing a role in 5,6-dimethylbenzimidazole (DMB) biosynthesis. The BluB protein is related to the nitroreductase family (pfam0881). [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin].	6.73571e-73
NZ_CP022577.1\|WP_003905275.1\|3327910_3328543_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.1641e-15
NZ_CP022577.1\|WP_003401540.1\|3333399_3334203_+\|hypothetical-protein	gnl\|CDD\|226848	COG4424, COG4424, Uncharacterized protein conserved in bacteria [Function unknown].	2.12891e-123
NZ_CP022577.1\|WP_003401528.1\|3337264_3338650_-\|type-VII-secretion-system-ESX-3-serine-protease-mycosin-MycP3	gnl\|CDD\|274856	TIGR03921, T7SS_mycosin, type VII secretion-associated serine protease mycosin. Members of this family are subtilisin-related serine proteases, found strictly in the Actinobacteria and associated with type VII secretion operons. The designation mycosin is used for members from Mycobacterium. [Protein fate, Protein and peptide secretion and trafficking, Protein fate, Protein modification and repair].	2.49308e-115
NZ_CP022577.1\|WP_003401555.1\|3329668_3329896_-\|ribbon-helix-helix-protein,-CopG-family	gnl\|CDD\|279710	pfam01402, RHH_1, Ribbon-helix-helix protein, copG family. The structure of this protein repressor, which is the shortest reported to date and the first isolated from a plasmid, has a homodimeric ribbon-helix-helix arrangement. The helix-turn-helix-like structure is involved in dimerization and not DNA binding as might have been expected.	0.000113886
NZ_CP022577.1\|WP_003898396.1\|3335083_3336286_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	1.89486e-06
NZ_CP022577.1\|WP_003401563.1\|3329100_3329322_-\|type-II-toxin-antitoxin-system-antitoxin-VapB2	gnl\|CDD\|222832	PHA01748, PHA01748, hypothetical protein.	0.00852727
NZ_CP022577.1\|WP_003900117.1\|3327005_3327914_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187670	cd09810, LPOR_like_SDR_c_like, light-dependent protochlorophyllide reductase (LPOR)-like, classical (c)-like SDRs. Classical SDR-like subgroup containing LPOR and related proteins. Protochlorophyllide (Pchlide) reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.69352e-146
NZ_CP022577.1\|WP_003401521.1\|3340111_3340999_-\|type-VII-secretion-system-ESX-3-associated-protein-EspG3	gnl\|CDD\|379414	pfam14011, ESX-1_EspG, EspG family. This family of proteins contains the the EspG1, EspG2 and EspG3 proteins from M. tuberculosis. These proteins are involved in the ESAT-6 secretion system 1 (ESX-1) of Mycobacterium tuberculosis which is important for virulence and intercellular spread. Proteins in this family are typically between 254 and 295 amino acids in length.	1.29098e-54
NZ_CP022577.1\|WP_003401514.1\|3341009_3341300_-\|WXG100-family-type-VII-secretion-target	gnl\|CDD\|227179	COG4842, COG4842, Uncharacterized protein conserved in bacteria [Function unknown].	2.85211e-21
NZ_CP022577.1\|WP_003401544.1\|3331992_3333390_+\|sulfatase	gnl\|CDD\|293751	cd16027, SGSH, N-sulfoglucosamine sulfohydrolase (SGSH; sulfamidase). N-sulfoglucosamine sulfohydrolase (SGSH) belongs to the sulfatase family and catalyses the cleavage of N-linked sulfate groups from the GAGs heparin sulfate and heparin. The active site is characterized by the amino-acid sequence motif C(X)PSR that is highly conserved among most sulfatases. The cysteine residue is post-translationally converted to a formylglycine (FGly) residue, which is crucial for the catalytic process. Loss of function of SGSH results a disease called mucopolysaccharidosis type IIIA (Sanfilippo A syndrome), a fatal childhood-onset neurodegenerative disease with mild facial, visceral and skeletal abnormalities.	5.75322e-137

>NZ_CP022577.1|WP_003401555.1|3329668_3329896_-|ribbon-helix-helix-protein,-CopG-family
MTKEKISVTVDAAVLAAIDADARAAGLNRSEMIEQALRNEHLRVALRDYTAKTVPALDIDAYAQRVYQANRAAGS
>NZ_CP022577.1|WP_003401560.1|3329369_3329672_-|toxin-antitoxin-system-toxin
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPLGNAGVAALREAASVVTALLC
>NZ_CP022577.1|WP_003401563.1|3329100_3329322_-|type-II-toxin-antitoxin-system-antitoxin-VapB2
MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVAGLGDPELMRQAWR
>NZ_CP022577.1|WP_003401566.1|3328678_3329104_-|PIN-domain-nuclease
MTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
>NZ_CP022577.1|WP_003905275.1|3327910_3328543_-|TetR/AcrR-family-transcriptional-regulator
MGVPAKKKQQQGERSRESILDATERLMATKGYAATSISDIRDACGLAPSSIYWHFGSKEGVLAAMMERGAQRFFAAIPTWDEADGPVEQRSERQLTELVSLQSQHPDFLRLFYLLSMERSQDPAVAAVVRRVRNTAIARFRDSITHLLPSDIPPGKADLVVAELTAFAVALSDGVYFAGHLEPDTTDVERMYRRLRQALEALIPVLLEET
>NZ_CP022577.1|WP_003900117.1|3327005_3327914_-|SDR-family-NAD(P)-dependent-oxidoreductase
MNTGTAVITGASSGLGLQCARALLRRDASWHVVLAVRDPARGRAAMEELGEPNRCSVLEVDLASVRSVRSFVETVRTTPLPPIRALVCNAGLQVVSGIAFTDDGVEMTFGVNHLGHFALVTGILDWLARPARIVVVSSGTHDPSKHTGMPDPRYTCAADLAHPPTDQNTPAEGRRRYTTSKLCNVLFTYELDRRLDHGEQGVMVNAFDPGLMPGSGLARDYPPILRLAYRLLSPMLRVLPFVHSTRVSGEHLAALAVDPRFAGVTGQYFAGAKAIRSSAESYDRAKALDLWETSERLLAQVT
>NZ_CP022577.1|WP_003911082.1|3317452_3326998_+|PPE-family-protein
MDFVVSAPEVNSLRMYLGAGSGPMLAAAAAWDGLADELAVAASWFGSVTSGLADAAWRGPAAVAMARAVAPYLGWLISATAQAEQAAAQARVAVATFEAARAATVHPAIVAANRAVLVSLVSSNLLGFNAPAIAATEAAYERMWAQDVAAMVGYHAGASAAVSALMPFTQQLKKLAGLSERLTSAAAAAAGPPSAAGFNLGLANVGANNVGNGNVGVFNVGFGNLGSYNLGFANLGSDNLGLANLGGHNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIGFGSFNSGSHNIGLFNSGSGNVGLFNSGTGNFGIGNSGTGNFGLGNTGSTNTGWFNTGDVNTGGFNPGSYNTGNFNTGNYNTGSFNAGNYNTGYFNTGDYNTGVANTGNVNTGAFIAGNYSNGVLWRGDYQGLIGADIALEIPAIPINAQLFSMPIHQVMVMPGSVMTIPGMRLPFTSIVPFVVYYGPVELPQSTLTLPTVTITVGGPTTTIDGNLTGMVGGVSIPLIKIPAAPGFGNSTTSPSSGFFNAGAGTASGFGNFGGGASGFWNLASATSGLSGFGNVGALGSGVANVGNTISGLYNTSTSNLATPAFNSGLLHHSVGTMTLNFGLANVGGNNVGGANAGIFNVGLANLGDYNIGFGNLGGDNLGFAHAGSYNIGFANTGSNNLGFANTGDNNIGFANIGSNNIGIGLTGSGQIGFGSLNSGSHNIGLFNSGDGNIGLFNSGSGNFGIGNAGTGNWGIGNSGAGNFGIGNAGSTNTGLFNSGDLNTGSLNPGSYNTGSVNTGSVNTGGFNAGNYNTGYFNTGDYNTGMANTGNINTGAFISGNHSNGLLWRGDNQGLIDLAIGVDIPEIPIVSVDVNIPIHIPITASFTDIVYSGLDLPPNTAVTVIFFGPVDIDPFTVPVIRITGPTPVVMVGGPTTAINIGATVGVDAINIPIIHIPATPGFGNSTGGLSSGFFNSGAGSASGFGNFGGAASGFMNLVSTTSGMSGFLNVGALGSGVANVGNTISGIYNVGTSDLSTPAVNSGLANIGTNIAGLLRDGAGTAAINLGLANHGNLNVGFASLGGFNFGGATIGHNNVGIGNTGIFDVGLANLGSYNIGFGNLGDDNLGFGNFGSYNIGFGNVGNDNLGFANAGGGNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIGFGSFNSGSGNIGLFNSGSNNIGFFNSGSGNFGIANSGSFNTGIGNTGNTNTGLFNSGDVNTGAFNPGSFNTGSFNTGSFNTGGFNPGNTNTGYLNIGNYNTGIANTGDVDTGAFITGNYSNGLFLSGDYQGLVGLNLVIDMPLPISLGVNIPIDIPITASAGNITLMGVTIPPTGDIVLSSIAGQRAHFGPITIPNITVVGPTTTVAIGGPNTAITITGGGAIRIPLISIPAAPGFGNSTTNPSSGFFNTGAGGASGFGNFGGANSGFWNLASATSGASGLLNVGALGSGLANVGTTVSGFYNTSTSDLATPAFNSGLANISTSIAGLLRDSTGTMVLNLGLANHGTLNVGIANLGDYNIGFANLGSANFGSANIGGNNIGGANTGIFDIGLANLGSYNIGFGNFGDDNLGFGNLGSYNVGFGNLGNDNLGFANTGSNNIGFANTGSNNIGIGLTGDGQIGFGSLNSGSGNIGLFNSGSGNIGFFNSGNGNVGIGNTGTANFGLGNTGSTNTGFFNSGDVNTGIGNTGSFNTGSFNPGDSNTGDFNPGSYNTGLGNTGDVDTGAFISGSYSNGFLWSGNYQGLIGLHAALAIPEIALTFGVDIPIHIPINIDAGVVTLQGFSIVAAENNIDFTPIIIPTINITLPTAAITVGGPTTSIGITASAGIGSITIPIIDIPATSGFGNSTTSPSSGFFNSGAGSASGFLNVVAGASGISGYLNVGALGSGVTNVGHTVSGFYNASALDLVTPAFASGLMRDGMGTMTLNLGLANLGSNNAGFGNTGIFDVGVANLGNYNIGFGNFGDDNLGFANLGSYNIGVANTGSNNIGFANTGSNNIGIGLTGTGQIGIGALNSGSGNIGLFNSGDGNIGFFNSGTGNFGIGNTGTGNFGIGNSGSTSTGLFNSGDGNTGGFNPGNFNTGNFNTGSFNTGGFNAGNTNTGHFNTGNYNTGIANTGDVSTGAFISGNYSNGILWRGDYQGLIGYSYALTIPEIPAHLDVNIPIDIPITGSFTDLVVDNFTIPIIGFESFAFSFHIHTEPDIGPIIVPSFVLSVPTFAIAVGGPTTAINISATAGLGPITIPIIDIPAAPGIGNSTTSPSSGFFNTGAGTASGFGNVGGNTSGLWNLASAASGVSGLLNVGALGSGVANVGNTISGIYNTSPLDLGTPAFGSGLANIAGLLQGGAGTTILDLAGLGNLNVGLANLGGSNFGIGNTGIFNVGFANVGNHNIGLANLGNYSVGFANSGNYHIGIANTGSANIGFANTGSGNIGIGLTGTGQIGFGSFNSGSHNIGLFNSGDGNVGFFNSGTGNVGIGNTGTANFGIANSGSFNTGLGNTGSTNTGLFNPGNVNTGVGNTGSINTGSFNTGSTNTGSFNLGDHNTGSFNSGDYNTGYFNAGDYNTGVANTGNVNTGAFISGNYSNGFFWRGDYQGLIGLSTTITIPEIPYRYDLSVPIDIPITGTVVATTPNSFTIPGFQIRVLLGPAAVLVNEMIGPITIDVNQVIAIDSPIQQTISMVGTGGFGPIPIGISIGGTPGFGNSTTGPSSGFFHTGAGHVSGFGNFGAGNMSGSGNFGAGNSGFFNAGGLGNSGLLNFGALQSGLANLGNTISGVYNTSTLDLATPAFGSGIANIGANLAGLFLDNTGNLTLNFGVANQGGLNAGIGNLGSVNIGFVNTGDSNLGIGNLGDLNFGGVNIGGNNIGIANTGIFDIGLANLGSYNIGLANLGDDNLGFGNAGSYNIGFANFGSDNLGFANTGSYNIGFANTGNNNIGVGLTGNGQIGIGSLNSGSNNIGLFNSGSGNIGFFNSGTGNVGIFNTGTGNFGLANSGGFNTGIGNAGSTNTGVFNPGDLNTGSFNPGSFNTGGFNPGSGNTGYLNTGDYNTGVANTGDVDTGAFITGSYSNGFLVSGDYQGLIGLPLLGIPVTPGYFNLTGGPSSGFFNSGAGSVSGFVNSGAGLSGYLNTGALGSGVANVGNTISGWLNASALDLATPGFLSGIGNFGTNLAGFFRG
>NZ_CP022577.1|WP_003401584.1|3316578_3317250_-|5,6-dimethylbenzimidazole-synthase
MFSAPERRAVYRVIAERRDMRRFVPGGVVSEDVLARLLHAAHAAPSVGLMQPWRFIRITDETLKRRIHALVDDERLLTAEALGAREEEFLALKVEGILDCAELLVVALCDRRGSYIFGRRTLPQMDLASVSCAIQNLWLAARSEGLGMGWVSLFDPQRLAALLAMPADAEPVAILCLGPVPEFPDRPALELDGWAYARPLAEFVSENRWSYPSALATDHHHGE
>NZ_CP022577.1|WP_003401589.1|3316108_3316591_+|hypothetical-protein
MAVIVRKWFGLGRLPADLRCQVEAEGLIYLAEYVAVTRRFTGVIPGLRASHSIASYVGALAFTEQRVLGTLSMVPKLAGRVVDARWDGPQAGAATAEISPTGLQLDLDVADVDPKFSGQLALHFKATIGEDVLSRLPRRSLAFDVPAEYVNLAVGVTYSP
>NZ_CP022577.1|WP_003401594.1|3315334_3316051_-|phosphatase-PAP2-family-protein
MTRPQALLAVSLAFVATAVYAVMWVGHSQDWGWLHSFDWSLLNAAHDIGIKNPAWVRFWDGVSLILGPVVLRPLGLLAAMVALAKRKIRIALLLLACLPLNAIMTIAAKSVAHRPRPATALVSAHSTSFPSGHALEATASVLALLTVLLPMLHSRFTRHIAITVGALCVLTVGVARVALNVHHPTDVVAGWALGYLYFLVCLCVFRPPSIFGAQRASHALSPPVEVSRQPEPEVDTAR
>NZ_CP022577.1|WP_003401544.1|3331992_3333390_+|sulfatase
MTSERATGQRENLLIVHWHDLGRYLGVYHHPDVYSPRLDRLAAEGILFTRAHATAPLCTPSRGSLFTGRYPQSNGLVGLAHHGWEYRTGVQTLPQLLSESGWYSALFGMQHETSYPKRLGFDEFDVSNSYCEYVVAKAQDWLHNRVPALDGQRFLLTAGFFETHRPYPHERYRPADSAAVELPDYLPDTPEVRQDVAEFYGSIATADEAVGRLLDTLADTGLDASTWVVFVTDHGPAFPRAKSTLYDAGTGIALIIRPPTRRAMAPRVYDELFSGVDLVPTLLDLLRLEVPADVEGVSHAPALLAPDTENAAVRDHVYTAKTYHDSFDPIRAIRTKEYSYIENYAPRPLLDLPWDIQESPAGMAVAPLVKAPRPQRELYDLRADPTETNNLLAGDDSTQGVAAIAADLAVRLHDWRQRTADVIPSDFAGSRIAERYTETYLRIHRKTPTGRSAIAADRGIDEHCS
>NZ_CP022577.1|WP_003401540.1|3333399_3334203_+|hypothetical-protein
MSRAVRPYLVLATQRSGSTLLVESLRATGCAGEPQEFFQYLPSTGMAPQPREWFAGVDDDTILQLLDPLDPGTPDTATPVAWREHVRTSGRTPNGVWGGKLMWNQTALLQQRAAQLPDRSGDGLRAAIRDVIGNEPVFVHVHRPDVVSQAVSFWRAVQTQVWRGHPDPKRDSQAVYHAGAIAHIIRNLRDQENGWRAWFAEEGIDPIDIAYPVLWRNLTAIVASVLDAIGQDPKLAPAPMLERQANQRSDEWVDRYRAEAPRLGLPT
>NZ_CP022577.1|WP_003401538.1|3334191_3334977_-|trans-aconitate-2-methyltransferase
MWDPDVYLAFSGHRNRPFYELVSRVGLERARRVVDLGCGPGHLTRYLARRWPGAVIEALDSSPEMVAAAAERGIDATTGDLRDWKPKPDTDVVVSNAALHWVPEHSDLLVRWVDELAPGSWIAVQIPGNFETPSHAAVRALARREPYAKLMRDIPFRVGAVVQSPAYYAELLMDTGCKVDVWETTYLHQLTGEHPVLDWITGSALVPVRERLSDESWQQFRQELIPLLNDAYPPRADGSTIFPFRRLFMVAEVGGARRSGG
>NZ_CP022577.1|WP_003898396.1|3335083_3336286_+|alpha/beta-fold-hydrolase
MSGTFTADAIGPPVPIPDVPGADAGAEGLPSRSVLSARQRILVESSAIADVALRTAVASVLSATVTPAVVANALRHVNEGSERSNLNFYAELAAAHDPAKSFPAPTELPKVTSRPASPLTEWVARGTVDNIAFASGFRAINPTMRQRWSALTANNIVHAQHWRHRDGPRPTLCVIHGFMGSSYLLNGLFFSLPWYYRSGYDVLLYTLPFHGQRAEKFSPFSGFGYFTSGLSGFAEAMAQAVYDFRSIVDYLRHIGVDRIALTGISLGGYTSALLASVESRLEAVIPNCPVVMPAKLFDEWFPANKLVKLGLRLTNISRDELIAGLAYHGPLNYRPLLPKDRRMIITGLGDRMAPPEHAVTLWKQWDRCALHWFPGSHLLHVSQLDYLRRMTVFLQGLMFD
>NZ_CP022577.1|WP_003401533.1|3336272_3337268_-|type-VII-secretion-system-ESX-3-subunit-EccE3
MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVVIGLFGFWRGLYFTTIARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLPLTLIARYLDRYGIRADTIRITSRVTASGDCRTWVGLTVVADDNLAALQARSARIPLQETAQVAARRLADHLREIGWEAGTAAPDEIPALVAADSRETWRGMRHTDSDYVAAYRVSADAELPDTLPAIRSRPAQETWIALEIAYAAGSSTRYTVAAACALRTDWRPGGTAPVAGLLPQHGNHVPALTALDPRSTRRLDGHTDAPADLLTRLHWPTPTAGAHRAPLTNAVSRT
>NZ_CP022577.1|WP_003401528.1|3337264_3338650_-|type-VII-secretion-system-ESX-3-serine-protease-mycosin-MycP3
MIRAAFACLAATVVVAGWWTPPAWAIGPPVVDAAAQPPSGDPGPVAPMEQRGACSVSGVIPGTDPGVPTPSQTMLNLPAAWQFSRGEGQLVAIIDTGVQPGPRLPNVDAGGDFVESTDGLTDCDGHGTLVAGIVAGQPGNDGFSGVAPAARLLSIRAMSTKFSPRTSGGDPQLAQATLDVAVLAGAIVHAADLGAKVINVSTITCLPADRMVDQAALGAAIRYAAVDKDAVIVAAAGNTGASGSVSASCDSNPLTDLSRPDDPRNWAGVTSVSIPSWWQPYVLSVASLTSAGQPSKFSMPGPWVGIAAPGENIASVSNSGDGALANGLPDAHQKLVALSGTSYAAGYVSGVAALVRSRYPGLNATEVVRRLTATAHRGARESSNIVGAGNLDAVAALTWQLPAEPGGGAAPAKPVADPPVPAPKDTTPRNVAFAGAAALSVLVGLTAATVAIARRRREPTE
>NZ_CP022577.1|WP_003902645.1|3338646_3340065_-|type-VII-secretion-system-ESX-3-subunit-EccD3
MSGTVMQIVRVAILADSRLTEMALPAELPLREILPAVQRLVVPSAQNGDGGQADSGAAVQLSLAPVGGQPFSLDANLDTVGVVDGDLLVLQPVPTGPAAPGIVEDIADAAMIFSTSRLKPWGIAHIQRGALAAVIAVALLATGLTVTYRVATGVLAGLLAVAGIAVASALAGLLITIRSPRSGIALSIAALVPIGAALALAVPGKFGPAQVLLGAAGVAAWSLIALMIPSAERERVVAFFTAAAVVGASVALAAGAQLLWQLPLLSIGCGLIVAALLVTIQAAQLSALWARFPLPVIPAPGDPTPSAPPLRLLEDLPRRVRVSDAHQSGFIAAAVLLSVLGSVAIAVRPEALSVVGWYLVAATAAAATLRARVWDSAACKAWLLAQPYLVAGVLLVFYTATGRYVAAFGAVLVLAVLMLAWVVVALNPGIASPESYSLPLRRLLGLVAAGLDVSLIPVMAYLVGLFAWVLNR
>NZ_CP022577.1|WP_003401521.1|3340111_3340999_-|type-VII-secretion-system-ESX-3-associated-protein-EspG3
MDATPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGAFVDRQRDELTRMGLLSPQGVINPAVADWIKVVCFPDRWLDLRYVGPASADGACELLRGIVALRTGTGKTSNKTGNGVVALRNAQLVTFTAMDIDDPRALVPILGVGLAHRPPARFDEFSLPTRVGARADERLRSGVPLGEVVDYLGIPASARPVVESVFSGPRSYVEIVAGCNRDGRHTTTEVGLSIVDTSAGRVLVSPSRAFDGEWVSTFSPGTPFAIAVAIQTLTACLPDGQWFPGQRVSRDFSTQSS
>NZ_CP022577.1|WP_003401514.1|3341009_3341300_-|WXG100-family-type-VII-secretion-target
MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG
>NZ_CP022577.1|WP_003401503.1|3341329_3341623_-|type-VII-secretion-system-protein-EsxG
MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_10

3358672-3359749

Orphan

Consensus_repeat	Method
CGGNGCCGGCGGNNNCGGCGG	CRT

20 spacers

The CRISPR arrays of NZ_CP022577_10

>merge|NZ_CP022577|10|3358672-3359749|CRT
GGCTGCCGGCGGGGCCGGCGGGTGGTTGTTCGGCAACGGCGGTAACGGCGGGCACGGTGCGACCAACACCGCCGCCACGGCTACGGGCGGGGCCGGCGGGGCCGGCGGGATCTTGTTCGGTACCGGTGGCAATGGCGGGACCGGCGGGATAGCCACCGGTGCTGGAGGGATCGGCGGGGCCGGCGGCGCCGGTGGGGTCTCCTTGCTGATCGGCTCCGGCGGCACCGGCGGCAACGGTGGGAACTCCATAGGCGTCGCTGGCATCGGCGGGGCCGGCGGGCGCGGCGGCGACGCCGGTTTGCTCTTCGGCGCGGCCGGCACCGGCGGCCACGGCGCCGCTGGCGGTGTCCCGGCCGGCGTCGGCGGCGCCGGCGGCAACGGCGGACTGTTCGCCAACGGCGGAGCCGGAGGGGCCGGCGGGTTCAACGCAGCCGGCGGGAACGGCGGGAACGGCGGACTGTTCGGAACTGGCGGCACCGGCGGGGCCGGCACGAACTTCGGGGCCGGTGGGAACGGCGGGAACGGCGGACTGTTCGGAGCCGGCGGCACCGGCGGCGCCGCCGGCTCGGGAGGGTCCGGGATCACCACCGGCGGCGGCGGGCACGGCGGCAACGCCGGCCTACTCTCCCTCGGCGCCTCCGGTGGCGCCGGCGGCAGCGGTGGCGCCAGCTCCCTTGCCGGCGGGGCCGGCGGAACCGGCGGGAACGGCGCCTTACTCTTCGGCTTCGGCGGCGCCGGCGGCGCCGGCGGGCACGGCGGGGCAGCACTTACCAGCATCCAGCAAGGCGGCGCCGGCGGCGCCGGCGGGAACGGCGGCTTGCTCTTCGGCTCCGCCGGCGCCGGCGGCGCCGGCGGCAGCGGTGCCAACGCTCTAGGCGCCGGTACCGGCGGCACCGGCGGTGACGGTGGCCACGCCGGGGTGTTCGGCAACGGCGGTGACGGGGGTTGCCGGCGGGTTTGGCGCCGGTACCGGCGGCAGCGGTGGTGTCGGCGGCAACGCCGTGCTGATCGGCAACGGCGGCAACGGCGGCAACGCCGGCAAAGCCGGGGCCACGCCCGGTGCCGGCGGCACCGGCGG

>NZ_CP022577|10|5|3358672-3359749|CRT
GGCTGCCGGCGGGGCCGGCGG	GTGGTTGTTCGGCAACGGCGGTAACGGCGGGCACGGTGCGACCAACACCGCCGCCACGGCTACGGG
CGGGGCCGGCGGGGCCGGCGG	GATCTTGTTCGGTACCGGTGGCAATGGCGGGACCGGCGGGATAGCCAC
CGGTGCTGGAGGGATCGGCGG	GGCCGGCGGCGCCGGTGGGGTCTCCTTGCTGAT
CGGCTCCGGCGGCACCGGCGG	CAACGGTGGGAACTCCAT
AGGCGTCGCTGGCATCGGCGG	GGCCGGCGGGCGCGGCGGCGACGCCGGTTTGCTCTT
CGGCGCGGCCGGCACCGGCGG	CCACGGCGCCGCTGGCGGTGTCCCGGC
CGGCGTCGGCGGCGCCGGCGG	CAACGGCGGACTGTTCGCCAACGG
CGGAGCCGGAGGGGCCGGCGG	GTTCAACGCAGCCGGCGGGAACGGCGGGAACGGCGGACTGTT
CGGAACTGGCGGCACCGGCGG	GGCCGGCACGAACTTCGGGGCCGGTGGGAACGGCGGGAACGGCGGACTGTT
CGGAGCCGGCGGCACCGGCGG	CGCCGCCGGCTCGGGAGGGTCCGGGATCACCAC
CGGCGGCGGCGGGCACGGCGG	CAACGCCGGCCTACTCTCCCTCGGCGCCTCCGG
TGGCGCCGGCGGCAGCGGTGG	CGCCAGCTCCCTTGCCGG
CGGGGCCGGCGGAACCGGCGG	GAACGGCGCCTTACTCTTCGGCTTCGG
CGGCGCCGGCGGCGCCGGCGG	GCACGGCGGGGCAGCACTTACCAGCATCCAGCAAGG
CGGCGCCGGCGGCGCCGGCGG	GAACGGCGGCTTGCTCTTCGGCTCCGC
CGGCGCCGGCGGCGCCGGCGG	CAGCGGTGCCAACGCTCTAGGCGC
CGGTACCGGCGGCACCGGCGG	TGACGGTGGCCACGCCGGGGTGTT
CGGCAACGGCGGTGACGGGGG	TTGCCGGCGGGTTTGGCGCCGGTACCGG
CGGCAGCGGTGGTGTCGGCGG	CAACGCCGTGCTGATCGGCAACGG
CGGCAACGGCGGCAACGCCGG	CAAAGCCGGGGCCACGCC
CGGTGCCGGCGGCACCGGCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003899886.1\|3361632_3362358_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP022577.1\|WP_003401394.1\|3363582_3364716_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378820
NZ_CP022577.1\|WP_003401392.1\|3364829_3367025_+\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173841
NZ_CP022577.1\|WP_011961607.1\|3359948_3360131_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003401485.1\|3343215_3343524_-\|type-VII-secretion-system-ESX-3-target-PE5	unknown	unknown	gnl\|CDD\|376422
NZ_CP022577.1\|WP_016330379.1\|3354074_3356783_+\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422
NZ_CP022577.1\|WP_003401386.1\|3368759_3369953_+\|DNA-polymerase-domain-containing-protein	unknown	unknown	gnl\|CDD\|225823
NZ_CP022577.1\|WP_003401488.1\|3341671_3343213_-\|type-VII-secretion-system-ESX-3-target-PPE4	unknown	unknown	gnl\|CDD\|227938
NZ_CP022577.1\|WP_003401478.1\|3343520_3347513_-\|type-VII-secretion-system-ESX-3-FtsK/SpoIIIE-family-ATPase-EccC3	unknown	unknown	gnl\|CDD\|274858
NZ_CP022577.1\|WP_003401448.1\|3351241_3352150_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|225852
NZ_CP022577.1\|WP_003401397.1\|3362965_3363586_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP022577.1\|WP_003401472.1\|3347509_3349126_-\|type-VII-secretion-system-ESX-3-subunit-EccB3	unknown	unknown	gnl\|CDD\|368288
NZ_CP022577.1\|WP_003401406.1\|3360154_3360583_+\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|350245
NZ_CP022577.1\|WP_003899884.1\|3367041_3368724_-\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|236097
NZ_CP022577.1\|WP_003401399.1\|3362287_3362869_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|366361
NZ_CP022577.1\|WP_003401503.1\|3341329_3341623_-\|type-VII-secretion-system-protein-EsxG	unknown	unknown	gnl\|CDD\|274862
NZ_CP022577.1\|WP_003401404.1\|3360622_3361543_-\|DUF2236-domain-containing-protein	unknown	unknown	gnl\|CDD\|226188
NZ_CP022577.1\|WP_003401514.1\|3341009_3341300_-\|WXG100-family-type-VII-secretion-target	unknown	unknown	gnl\|CDD\|227179
NZ_CP022577.1\|WP_003401463.1\|3349122_3351018_-\|type-VII-secretion-system-ESX-3-AAA-family-ATPase-EccA3	unknown	unknown	gnl\|CDD\|188437
NZ_CP022577.1\|WP_003902643.1\|3352173_3353784_-\|PPE-family-protein	unknown	unknown	gnl\|CDD\|227938

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003899886.1\|3361632_3362358_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.66172e-07
NZ_CP022577.1\|WP_003401394.1\|3363582_3364716_+\|hypothetical-protein	gnl\|CDD\|378820	pfam12146, Hydrolase_4, Serine aminopeptidase, S33. This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. It is found in association with pfam00561. The majority of the members in this family carry the exopeptidase active-site residues of Ser-122, Asp-239 and His-269 as in UniProtKB:Q7ZWC2.	0.00172554
NZ_CP022577.1\|WP_003401392.1\|3364829_3367025_+\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	1.76306e-158
NZ_CP022577.1\|WP_003401485.1\|3343215_3343524_-\|type-VII-secretion-system-ESX-3-target-PE5	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	7.41358e-11
NZ_CP022577.1\|WP_016330379.1\|3354074_3356783_+\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	3.29853e-32
NZ_CP022577.1\|WP_003401386.1\|3368759_3369953_+\|DNA-polymerase-domain-containing-protein	gnl\|CDD\|225823	COG3285, COG3285, Predicted eukaryotic-type DNA primase [DNA replication, recombination, and repair].	2.78761e-127
NZ_CP022577.1\|WP_003401488.1\|3341671_3343213_-\|type-VII-secretion-system-ESX-3-target-PPE4	gnl\|CDD\|227938	COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion].	1.09345e-59
NZ_CP022577.1\|WP_003401478.1\|3343520_3347513_-\|type-VII-secretion-system-ESX-3-FtsK/SpoIIIE-family-ATPase-EccC3	gnl\|CDD\|274858	TIGR03924, T7SS_EccC_a, type VII secretion protein EccCa. This model represents the N-terminal domain or EccCa subunit of the type VII secretion protein EccC as found in the Actinobacteria. Type VII secretion is defined more broadly as including secretion systems for ESAT-6-like proteins in the Firmicutes as well as in the Actinobacteria, but this family does not show close homologs in the Firmicutes. [Protein fate, Protein and peptide secretion and trafficking].	0
NZ_CP022577.1\|WP_003401448.1\|3351241_3352150_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|225852	COG3315, COG3315, O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism].	1.10201e-94
NZ_CP022577.1\|WP_003401397.1\|3362965_3363586_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.87158e-12
NZ_CP022577.1\|WP_003401472.1\|3347509_3349126_-\|type-VII-secretion-system-ESX-3-subunit-EccB3	gnl\|CDD\|368288	pfam05108, T7SS_ESX1_EccB, Type VII secretion system ESX-1, transport TM domain B. EccB is a family of largely Gram-positive bacterial transmembrane componenets of the type VII secretion system characterized in Mycobacterium tuberculosis, systems ESX1-5. Translocation of virulent peptides through the membranes is thought to be mediated via a complex that includes EccB, EccC, EccD, EccE, and MycP. EccB, EccC, EccD, and EccE form a stable complex in the mycobacterial cell envelope.	0
NZ_CP022577.1\|WP_003401406.1\|3360154_3360583_+\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|350245	cd18678, PIN_MtVapC25_VapC33-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC25, VapC33, and related proteins. This subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC25, VapC29, VapC33, VapC37, and VapC39 toxins. It belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is a PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include FitB toxin of the FitAB TA system, eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.23805e-60
NZ_CP022577.1\|WP_003899884.1\|3367041_3368724_-\|acyl-CoA-synthetase	gnl\|CDD\|236097	PRK07788, PRK07788, acyl-CoA synthetase; Validated.	0
NZ_CP022577.1\|WP_003401399.1\|3362287_3362869_-\|VOC-family-protein	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	5.1808e-20
NZ_CP022577.1\|WP_003401503.1\|3341329_3341623_-\|type-VII-secretion-system-protein-EsxG	gnl\|CDD\|274862	TIGR03930, WXG100_ESAT6, WXG100 family type VII secretion target. Members of this protein family include secretion targets for the two main variants of type VII secretion systems (T7SS), one found in the Actinobacteria, one found in the Firmicutes. This model was derived through iteration from pfam06013. The best characterized member of this family is ESAT-6 from Mycobacterium tuberculosis. Members of this family usually are ~100 amino acids in length but occasionally have a long C-terminal extension.	0.00514324
NZ_CP022577.1\|WP_003401404.1\|3360622_3361543_-\|DUF2236-domain-containing-protein	gnl\|CDD\|226188	COG3662, COG3662, Uncharacterized protein conserved in bacteria [Function unknown].	2.89836e-118
NZ_CP022577.1\|WP_003401514.1\|3341009_3341300_-\|WXG100-family-type-VII-secretion-target	gnl\|CDD\|227179	COG4842, COG4842, Uncharacterized protein conserved in bacteria [Function unknown].	2.85211e-21
NZ_CP022577.1\|WP_003401463.1\|3349122_3351018_-\|type-VII-secretion-system-ESX-3-AAA-family-ATPase-EccA3	gnl\|CDD\|188437	TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA. This model represents the AAA family ATPase, EccA, of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccA1, EccA2, etc. [Protein fate, Protein and peptide secretion and trafficking].	0
NZ_CP022577.1\|WP_003902643.1\|3352173_3353784_-\|PPE-family-protein	gnl\|CDD\|227938	COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion].	1.75244e-73

>NZ_CP022577.1|WP_016330379.1|3354074_3356783_+|PE-family-protein
MSFVIAAPEVIAAAATDLASLESSIAAANAAAAANTTALLAAGADEVSTAVAALFGAHGQAYQALSAQAQAFHAQFTQALTSGGGAYAAAEAAATSPLLAPINEFFLANTGRPLIGNGTNGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGNGGAGGLIGNGGAGGAGGVASSGIGGSGGAGGNAMLFGAGGAGGAGGAGGGVVALTGGAGGAGGAGGNAGLLFGAAGVGGAGGFTNGSALGGAGGAGGAGGLFATGGVGGSGGAGSSGGAGGAGGAGGLFGAGGTGGHGGFADSSFGGVGGAGGAGGLFGAGGEGGSGGHSLVAGGDGGAGGNAGMLALGAAGGAGGIGGDGGTLTAGGIGGAGGAGGNAGLLFGSGGSGGAGGFGFADGGQGGPGGNAGTVFGSGGAGGNGGVGQGFAGGIGGAGGTPGLIGNGGNGGNGGASAVTGGNGGIGGTGVLIGNGGNGGSGGIGAGKAGVGGVSGLLLGLDGFNAPASTSPLHTLQQNVLNVVNEPFQTLTGRPLIGNGANGTPGTGADGGAGGWLFGNGGNGGSGATGTNGGDGGDGGAGGIFFGTGGTGGAGGVGTTGTGGDGGAGGAAFLMGSGGNGGSGGAGLTAGGDGGDGGNAGSFFGAAGTGGAGASTKAGGTGGTGGNGGLFANGGAGGSGGLGGDAGTGGAGGNGGLFGAGGTGGAGGSLGPGAGGAGGNGGLFGAGGTGGSGGHGTPAAVPGGAGGAGGNAGLFSLGASGGAGGSGGSSLTDGGGIGGVGGAGGLLFGYGGAGGAGGYSNIGAGGAGGAGGNAGMLSGSGGSGGTGGASGAAKGGVGGNGGTAGVFGNGGDGGAGGFGAGTGGNGGVGGNAVLIGNGGNGGNGGKAGGTPGAGGTSGLLIGENGLNGLP
>NZ_CP022577.1|WP_003902643.1|3352173_3353784_-|PPE-family-protein
MTLWMASPPEVHSALLSSGPGPGSVLSAAGVWSSLSAEYAAVADELIGLLGAVQTGAWQGPSAAAYVAAHAPYLAWLMRASETSAEAAARHETVAAAYTTAVAAMPTLVELAANHTLHGVLVATNFFGINTIPIALNEADYARMWTQAASTMATYQAVAEAAVASAPQTTPAPPILAAEAADDDHDHDHDHGGEPTPLDYLVAEILRIISGGRLIWDPAEGTMNGIPFEDYTDAAQPIWWVVRAIEFSKDFETFVQKLFVNPVEAFQFYFELLLFDYPTHIVQIVEALSQSPQLLAVALGSVISNLGAVTGFAGLSGLAGMQPAAIPALAPVAAAPPTLPAVAMAPTMAAPGAAVASAAAPASAPAASTVASATPAPPPAPGAAGFGYPYAIAPPGIGFGSGMSASASAQRKAPQPDSAAAAAAAAAVRDQARARRRRRVTRRGYGDEFMDMNIDVDPDWGPPPGEDPVTSTVASDRGAGHLGFAGTARREAVADAAGMTTLAGDDFGDGPTTPMVPGSWDPDRDAPGSAEPGDRG
>NZ_CP022577.1|WP_003401448.1|3351241_3352150_-|class-I-SAM-dependent-methyltransferase
MRTEGDSWDITTSVGSTALFVATARALEAQKSDPLVVDPYAEAFCRAVGGSWADVLDGKLPDHKLKSTDFGEHFVNFQGARTKYFDEYFRRAAAAGARQVVILAAGLDSRAYRLPWPDGTTVFELDRPQVLDFKREVLASHGAQPRALRREIAVDLRDDWPQALRDSGFDAAAPSAWIAEGLLIYLPATAQERLFTGIDALAGRRSHVAVEDGAPMGPDEYAAKVEEERAAIAEGAEEHPFFQLVYNERCAPAAEWFGERGWTAVATLLNDYLEAVGRPVPGPESEAGPMFARNTLVSAARV
>NZ_CP022577.1|WP_003401463.1|3349122_3351018_-|type-VII-secretion-system-ESX-3-AAA-family-ATPase-EccA3
MAGVGAGDSGGVERDDIGMVAASPVASRVNGKVDADVVGRFATCCRALGIAVYQRKRPPDLAAARSGFAALTRVAHDQCDAWTGLAAAGDQSIGVLEAASRTATTAGVLQRQVELADNALGFLYDTGLYLRFRATGPDDFHLAYAAALASTGGPEEFAKANHVVSGITERRAGWRAARWLAVVINYRAERWSDVVKLLTPMVNDPDLDEAFSHAAKITLGTALARLGMFAPALSYLEEPDGPVAVAAVDGALAKALVLRAHVDEESASEVLQDLYAAHPENEQVEQALSDTSFGIVTTTAGRIEARTDPWDPATEPGAEDFVDPAAHERKAALLHEAELQLAEFIGLDEVKRQVSRLKSSVAMELVRKQRGLTVAQRTHHLVFAGPPGTGKTTIARVVAKIYCGLGLLKRENIREVHRADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADLDKFLDTNEGLRSRFTRNIDFPSYTSHELVEIAHKMAEQRDSVFEQSALHDLEALFAKLAAESTPDTNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDHSEHAGSGEFSDEELMTITADDVGRSVEPLLRGLGLSVRA
>NZ_CP022577.1|WP_003401472.1|3347509_3349126_-|type-VII-secretion-system-ESX-3-subunit-EccB3
MTNQQHDHDFDHDRRSFASRTPVNNNPDKVVYRRGFVTRHQVTGWRFVMRRIAAGIALHDTRMLVDPLRTQSRAVLMGVLIVITGLIGSFVFSLIRPNGQAGSNAVLADRSTAALYVRVGEQLHPVLNLTSARLIVGRPVSPTTVKSTELDQFPRGNLIGIPGAPERMVQNTSTDANWTVCDGLNAPSRGGADGVGVTVIAGPLEDTGARAAALGPGQAVLVDSGAGTWLLWDGKRSPIDLADHAVTSGLGLGADVPAPRIIASGLFNAIPEAPPLTAPIIPDAGNPASFGVPAPIGAVVSSYALKDSGKTISDTVQYYAVLPDGLQQISPVLAAILRNNNSYGLQQPPRLGADEVAKLPVSRVLDTRRYPSEPVSLVDVTRDPVTCAYWSKPVGAATSSLTLLAGSALPVPDAVHTVELVGAGNGGVATRVALAAGTGYFTQTVGGGPDAPGAGSLFWVSDTGVRYGIDNEPQGVAGGGKAVEALGLNPPPVPIPWSVLSLFVPGPTLSRADALLAHDTLVPDSRPARPVSAEGGYR
>NZ_CP022577.1|WP_003401478.1|3343520_3347513_-|type-VII-secretion-system-ESX-3-FtsK/SpoIIIE-family-ATPase-EccC3
MSRLIFEARRRLAPPSSHQGTIIIEAPPELPRVIPPSLLRRALPYLIGILIVGMIVALVATGMRVISPQTLFFPFVLLLAATALYRGNDKKMRTEEVDAERADYLRYLSVVRDNIRAQAAEQRASALWSHPDPTALASVPGSRRQWERDPHDPDFLVLRAGRHTVPLATTLRVNDTADEIDLEPVSHSALRSLLDTQRSIGDVPTGIDLTKVSRITVLGERAQVRAVLRAWIAQAVTWHDPTVLGVALAARDLEGRDWNWLKWLPHVDIPGRLDALGPARNLSTDPDELIALLGPVLADRPAFTGQPTDALRHLLIVVDDPDYDLGASPLAVGRAGVTVVHCSASAPHREQYSDPEKPILRVAHGAIERWQTGGWQPYIDAADQFSADEAAHLARRLSRWDSNPTHAGLRSAATRGASFTTLLGIEDASRLDVPALWAPRRRDEELRVPIGVTGTGEPLMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHSAERLIVIYADFKGEAGADSFRDFPQVVAVISNMAEKKSLADRFADTLRGEVARREMLLREAGRKVQGSAFNSVLEYENAIAAGHSLPPIPTLFVVADEFTLMLADHPEYAELFDYVARKGRSFRIHILFASQTLDVGKIKDIDKNTAYRIGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGATPIRFRSTYVDGIYEPPQTAKAVVVQSVPEPKLFTAAAVEPDPGTVIADTDEQEPADPPRKLIATIGEQLARYGPRAPQLWLPPLDETIPLSAALARAGVGPRQWRWPLGEIDRPFEMRRDPLVFDARSSAGNMVIHGGPKSGKSTALQTFILSAASLHSPHEVSFYCLDYGGGQLRALQDLAHVGSVASALEPERIRRTFGELEQLLLSRQQREVFRDRGANGSTPDDGFGEVFLVIDNLYGFGRDNTDQFNTRNPLLARVTELVNVGLAYGIHVIITTPSWLEVPLAMRDGLGLRLELRLHDARDSNVRVVGALRRPADAVPHDQPGRGLTMAAEHFLFAAPELDAQTNPVAAINARYPGMAAPPVRLLPTNLAPHAVGELYRGPDQLVIGQREEDLAPVILDLAANPLLMVFGDARSGKTTLLRHIIRTVREHSTADRVAFTVLDRRLHLVDEPLFPDNEYTANIDRIIPAMLGLANLIEARRPPAGMSAAELSRWTFAGHTHYLIIDDVDQVPDSPAMTGPYIGQRPWTPLIGLLAQAGDLGLRVIVTGRATGSAHLLMTSPLLRRFNDLQATTLMLAGNPADSGKIRGERFARLPAGRAILLTDSDSPTYVQLINPLVDAAAVSGETQQKGSQS
>NZ_CP022577.1|WP_003401485.1|3343215_3343524_-|type-VII-secretion-system-ESX-3-target-PE5
MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG
>NZ_CP022577.1|WP_003401488.1|3341671_3343213_-|type-VII-secretion-system-ESX-3-target-PPE4
MAAPIWMASPPEVHSALLSNGPGPGSLVAAATAWSQLSAEYASTAAELSGLLGAVPGWAWQGPSAEWYVAAHLPYVAWLTQASADAAGAAAQHEAAAAAYTTALAAMPTLAELAANHVIHTVLVATNFFGINTIPITLNEADYVRMWLQAAAVMGLYQAASGAALASAPRTVPAPTVMNPGGGAASTVGAVNPWQWLLALLQQLWNAYTGFYGWMLQLIWQFLQDPIGNSIKIIIAFLTNPIQALITYGPLLFALGYQIFFNLVGWPTWGMILSSPFLLPAGLGLGLAAIAFLPIVLAPAVIPPASTPLAAAAVAAGSVWPAVSMAVTGAGTAGAATPAAGAAPSAGAAPAPAAPATASFAYAVGGSGDWGPSLGPTVGGRGGIKAPAATVPAAAAAAATRGQSRARRRRRSELRDYGDEFLDMDSDSGFGPSTGDHGAQASERGAGTLGFAGTATKERRVRAVGLTALAGDEFGNGPRMPMVPGTWEQGSNEPEAPDGSGRGGGDGLPHDSK
>NZ_CP022577.1|WP_003401503.1|3341329_3341623_-|type-VII-secretion-system-protein-EsxG
MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF
>NZ_CP022577.1|WP_003401514.1|3341009_3341300_-|WXG100-family-type-VII-secretion-target
MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG
>NZ_CP022577.1|WP_011961607.1|3359948_3360131_+|hypothetical-protein
MGAVIEDALRRELAAARTGGARPTVPVFDAGTGPRPGIDLTSNTVLSEVLDEGLELNSRK
>NZ_CP022577.1|WP_003401406.1|3360154_3360583_+|type-II-toxin-antitoxin-system-VapC-family-toxin
MFLIDVNVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLTTNRRIFEIPSPRADAFAFVEAVNAQPHHLPTSPGPRHLVLLRKLCDEADASGDLIPDAVLGAIAVEHHCAVVSLDRDFARFASVRHIRPPI
>NZ_CP022577.1|WP_003401404.1|3360622_3361543_-|DUF2236-domain-containing-protein
MAISLVAHQPIPHVERPMADPPRLQLARRRRSAAGPGGNEDSLMGVALLAGPANVIMELAMPGVGYGVLESRVESGRLDRHPIKRARTTFTYVAVAVAGSDDQKAAFRRAVNKVHAQVYSTPESPVSYHAFDPELQLWVAACLYKGGVDVYRTFVGEMDDEEADHHYRAGMAMGTTLQVPPQMWPPDRAAFDRYWRQSLDRVHIDDVVRDYLYPIVALRIRGIALPGPLRRLSEGIALLITTGFLPQRFRDEMRLPWDATKQRRFDALMAVLRTVNRLMPRFVREFPFNLMLWDLDRRMRRGRPLV
>NZ_CP022577.1|WP_003899886.1|3361632_3362358_+|TetR/AcrR-family-transcriptional-regulator
MTRSDRPYRGVEAAERLATRRRQSLSAGLDLLGSDQHDIAELTIRTICRRAGLSVRYFYESFTDKDEFVGRVFDWVVAELVATTQAAVTAVPAREQTRAGMANIVRTITADARVGRLLFSTQLANAVITRKRAESSALFAMLSGQHAVDTLHAPANDHVKAVAHFAVGGVGQTISAWLAGDVRLDPDQLVDQLAALLDELTDPNLSRPRVAATAAKSGANDPQPPEVAGQPPSSARPARRS
>NZ_CP022577.1|WP_003401399.1|3362287_3362869_-|VOC-family-protein
MIKPHNTNTEFELGGINHVALVCSDMARTVDFYSNILGMPLIKALDLPGGQGQHFFFDAGNGDCVAFFWFADAPDRVPGLSSPVAIPGIGDITSAVSTMNHLAFHVPAERFDAYRQRLKDKGVRVGPVLNHDDSETQVSAVVHPGVYVRSFYFQDPDGITLEFACWTKEFTTSDAQAVPKTAADRRPPVAADR
>NZ_CP022577.1|WP_003401397.1|3362965_3363586_+|TetR/AcrR-family-transcriptional-regulator
MPDFPTQRGRRTQAAIDAAARTVVVRNGILATTVADITAEAGRSAASFYNYYDSKEAMVRQWALRFRDDANQRALSVIRHGLSDRERAYEAAAAHWYTYRNRLAEAISVSQLAMVSDDFAQYWSEICQIPISFITETVKRAQAHGYCVGDDPQLMAEAIVAMFNQFCYLQLSGKRSRRGQPDDQACIQTLANIYYRAIYSKEDSSN
>NZ_CP022577.1|WP_003401394.1|3363582_3364716_+|hypothetical-protein
MTGRAATPGVIREFVGLPSRTAGRAAAGGHPCQGLYHHSVGRKPKVALIAAHYQIDFSEHYLAEYMAIRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVRWLREVQGVETVVLLGNSGGGSLMAAYQSQAVDPNVTPLDGMRPAAGVTELPAADAYVAAAAHPGRPDVLTAWMDAAVIDENDPVATDPELDLFDERNGPPYSPEFISRYRSAQVKRNHTITDWAESELKRVRAAGFSDRPFSVMRTWADPRMVDPSIEPTKRRPNQCYAGTPVKANRSAHGIAAACTLRGWLGMWSLRVAQTRAAPHLARITCPALVLNAEADTGIFPSDAQQIYDGLASSDKTQVSIDTDHYFTTPGARSEQADTIAKWIAKRWR
>NZ_CP022577.1|WP_003401392.1|3364829_3367025_+|acyl-CoA-dehydrogenase-family-protein
MSIAITPEHYELADSVRSLVARVAPSEVLHAALESPVENPPPYWQAAAEQGLQGVHLAESVGGQGFGILELAVVLAEFGYGAVPGPFVPSAIASALIAAHDPQAKVLAELATGAAIAAYALDSGLTATRHGDVLVIRGEVRAVPAAAQASVLVLPVAIESRDEWVVLRNDQLEIEAVKSLDPLRPIAHVRANAVDVSDDALLSNLTMTTAHALMSTLLSAEAVGVARWATDTASAYAKIREQFGRPIGQFQAIKHKCAEMIADTERATAAVWDAARALDDAGESSSDVEFAAAVAATLAPATAQRCTQDCIQVHGGIGFTWEHDTNVYYRRALMLAACFGRGSEYPQRVVDTATTAGMRPVDIDLDPSTEKLRAQIRAEVAALKAMPREPRTVAIAEGGWVLPYLPKPWGRAASPVEQIIIAQEFTAGRVKRPQIAIATWIVPSIVAFGTDNQKQRLLPPTFRGDIFWCQLFSEPGAGSDLASLATKATRVDGGWRITGQKIWTTGAQYSQWGALLARTDPSAPKHNGITYFLLDMKSEGVQVKPLRELTGKEFFNTVYLDDVFVPDELVLGEVNRGWEVSRNTLTAERVSIGGSDSTFLPTLGEFVDFVRDYRFEGQFDQVARHRAGQLIAEGHATKLLNLRSTLLTLAGGDPMAPAAISKLLSMRTGQGYAEFAVSSFGTDAVIGDTERLPGKWGEYLLASRATTIYGGTSEVQLNIIAERLLGLPRDP
>NZ_CP022577.1|WP_003899884.1|3367041_3368724_-|acyl-CoA-synthetase
MPNLTDLPGQAVSKLQKSIGQYVARGTAELHYLRKIIESGAIGLEPPLNYAALAADIRKWGEVGMLPSHNARRAPNRAAVIDEEGTLTFSELDEAAHAVANGLLAKGVRAGDGVAILARNHRWFVIANYGAARVGARIILLNSEFSGPQIKEVSDREGAKVIIYDDEYTKAVSLAQPPLGKLRALGVNPDDDKPSGSSDETLAELIAHSSTAPAPKASRRASIIILTSGTTGTPKGANRNTPPTLAPIGGILSHVPFKAGEVTLLPSPMFHALGYMHAALAMFLGSTLVLRRRFKPALVLEDIEKHKATSMVVVPVMLSRILDQLEKTEPKPDLSSLKIVFVSGSQLGAELATRALGDLGPVIYNMYGSTEVAFATIAGPKDLQFNPSTVGPVVKGVTVKILDENGNEVPQGAVGRIFVGNAFPFEGYTGGGGKQIIDGLLSSGDVGYFDERGLLYVSGRDDEMIVSGGENVFPAEVEDLISGHPDVVEAAAIGVDDKEFGARLRAFVVKKPGADLDEDTIKQYVRDHLARYKVPREVIFLDELPRNPTGKVLKRELRKL
>NZ_CP022577.1|WP_003401386.1|3368759_3369953_+|DNA-polymerase-domain-containing-protein
MSRMAAPVSLDVHGRQVIVTHPGRVVFPAHNDRKGYTKFDLVRYYLAVAEGAMRGVAGRPMILKRFVKGISAEAVFQKRAPANRPDWVDVAELHYASGRSAAEAVIHDAAGLAWVINLGCVDLNPHPVLAGDLDHPDELRVDLDPMPGVAWQRVVEVALVVREVLEDYGLTAWPKTSGSRGFHVYARIAPCWSFPQVRLAAQTVAREVERRLPDAATSRWWKEEREGVFVDFNQNAKDRTVASAYSVRATPDARVSTPLHWEEVPGCDPAVFTMATVPSRLADIGDPWAGMDDAVGRLDRLLMLAEELGPPQKAQSAKPLIEIARAKTRAEAMAALDIWRDRYPGAAALLRPADVLVDGMRGPSSIWYRIRINLQHVPADQRPPQEELIADYSPWPR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_11

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_11

3992607-3992695

Orphan

Consensus_repeat	Method
GGCCGTCATCCGGCCCGCATCGTCGCCGAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022577_11

>merge|NZ_CP022577|11|3992607-3992695|CRISPRCasFinder
GGCCGTCATCCGGCCCGCATCGTCGCCGAGCTCGGTTCGATTGCTCGGCTCCTCCTCGGGCCGTCATCCGGCCCGCATCGTCGCCGAGC

>NZ_CP022577|11|7|3992607-3992695|CRISPRCasFinder
GGCCGTCATCCGGCCCGCATCGTCGCCGAGC	TCGGTTCGATTGCTCGGCTCCTCCTCG
GGCCGTCATCCGGCCCGCATCGTCGCCGAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003419689.1\|4002862_4003726_-\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|273654
NZ_CP022577.1\|WP_003900733.1\|3999694_4001341_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
NZ_CP022577.1\|WP_003901692.1\|3996288_3997914_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173853
NZ_CP022577.1\|WP_003419712.1\|3991043_3992027_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP022577.1\|WP_003419708.1\|3992891_3993590_+\|protease	unknown	unknown	unknown
NZ_CP022577.1\|WP_003419710.1\|3992027_3992546_-\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|377816
NZ_CP022577.1\|WP_003899635.1\|3986993_3987371_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_106420803.1\|3989030_3989852_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
NZ_CP022577.1\|WP_003419701.1\|3997915_3998842_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP022577.1\|WP_003900732.1\|4004224_4005277_+\|septum-site-determining-protein-Ssd	unknown	unknown	gnl\|CDD\|274798
NZ_CP022577.1\|WP_003899624.1\|4005273_4006437_+\|TadA-family-conjugal-transfer-associated-ATPase	unknown	unknown	gnl\|CDD\|200328
NZ_CP022577.1\|WP_003899626.1\|4001337_4002108_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003906177.1\|3986220_3986895_-\|cAMP-activated-global-transcriptional-regulator-CRP	unknown	unknown	gnl\|CDD\|223736
NZ_CP022577.1\|WP_003419733.1\|3984858_3985314_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100006
NZ_CP022577.1\|WP_003419714.1\|3989857_3991051_+\|acid-resistance-serine-protease-MarP	unknown	unknown	gnl\|CDD\|379142
NZ_CP022577.1\|WP_003419731.1\|3985320_3986115_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293836
NZ_CP022577.1\|WP_003902541.1\|3987478_3988216_+\|endonuclease-III	unknown	unknown	gnl\|CDD\|223255
NZ_CP022577.1\|WP_003419721.1\|3988215_3988899_+\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
NZ_CP022577.1\|WP_003899631.1\|3993625_3995581_-\|acetate--CoA-ligase	unknown	unknown	gnl\|CDD\|234677
NZ_CP022577.1\|WP_003899628.1\|3998834_3999698_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003419689.1\|4002862_4003726_-\|HAD-IB-family-hydrolase	gnl\|CDD\|273654	TIGR01490, Uncharacterized_protein_Rv3661/MT3761, HAD-superfamily subfamily IB hydrolase, TIGR01490. This hypothetical equivalog is a member of the IB subfamily (TIGR01488) of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. The sequences modelled here are all bacterial. The IB subfamily includes the enzyme phosphoserine phosphatase (TIGR00338). Due to this relationship, several of these sequences have been annotated as "phosphoserine phosphatase related proteins," or "Phosphoserine phosphatase-family enzymes." There is presently no evidence that any of the enzymes in this model possess PSPase activity. OMNI\|NTL01ML1250 is annotated as a "possible transferase," however this is due to the C-terminal domain found on this sequence which is homologous to a group of glycerol-phosphate acyltransferases (between trusted and noise to TIGR00530). A subset of these sequences including OMNI\|CC1962, the Caulobacter crescentus CicA protein cluster together and may represent a separate equivalog. [Unknown function, Enzymes of unknown specificity].	5.37865e-86
NZ_CP022577.1\|WP_003900733.1\|3999694_4001341_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	0
NZ_CP022577.1\|WP_003901692.1\|3996288_3997914_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173853	cd00995, PBP2_NikA_DppA_OppA_like, The substrate-binding domain of an ABC-type nickel/oligopeptide-like import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain of nickel/dipeptide/oligopeptide transport systems, which function in the import of nickel and peptides, and other closely related proteins. The oligopeptide-binding protein OppA is a periplasmic component of an ATP-binding cassette (ABC) transport system OppABCDEF consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Similar to the ABC-type dipeptide and oligopeptide import systems, nickel transporter is comprised of five subunits NikABCDE: the two pore-forming integral inner membrane proteins NikB and NikC; the two inner membrane-associated proteins with ATPase activity NikD and NikE; and the periplasmic nickel binding NikA, which is the initial nickel receptor that controls the chemotactic response away from nickel. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand binding domains of ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	4.27273e-122
NZ_CP022577.1\|WP_003419712.1\|3991043_3992027_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.34553e-25
NZ_CP022577.1\|WP_003419710.1\|3992027_3992546_-\|phage-holin-family-protein	gnl\|CDD\|377816	pfam07332, Phage_holin_3_6, Putative Actinobacterial Holin-X, holin superfamily III. Phage_holin_3_6 is a family of small hydrophobic proteins with two or three transmembrane domains of the Hol-X family. Holin proteins are produced by double-stranded DNA bacteriophages that use an endolysin-holin strategy to achieve lysis of their hosts. The endolysins are peptidoglycan-degrading enzymes that are usually accumulated in the cytosol until access to the cell wall substrate is provided by the holin membrane lesion.	8.41555e-32
NZ_CP022577.1\|WP_106420803.1\|3989030_3989852_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	1.0647e-47
NZ_CP022577.1\|WP_003419701.1\|3997915_3998842_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	7.57934e-99
NZ_CP022577.1\|WP_003900732.1\|4004224_4005277_+\|septum-site-determining-protein-Ssd	gnl\|CDD\|274798	TIGR03815, CpaE_hom_Actino, helicase/secretion neighborhood CpaE-like protein. Members of this protein family belong to the MinD/ParA family of P-loop NTPases, and in particular show homology to the CpaE family of pilus assembly proteins (see ). Nearly all members are found, not only in a gene context consistent with pilus biogenesis or a pilus-like secretion apparatus, but also near a DEAD/DEAH-box helicase, suggesting an involvement in DNA transfer activity. The model describes a clade restricted to the Actinobacteria.	4.37512e-92
NZ_CP022577.1\|WP_003899624.1\|4005273_4006437_+\|TadA-family-conjugal-transfer-associated-ATPase	gnl\|CDD\|200328	TIGR03819, heli_sec_ATPase, helicase/secretion neighborhood ATPase. Members of this protein family comprise a distinct clade of putative ATPase associated with an integral membrane complex likely to act in pilus formation, secretion, or conjugal transfer. The association of most members with a nearby gene for a DEAH-box helicase suggests a role in conjugal transfer.	1.05849e-164
NZ_CP022577.1\|WP_003906177.1\|3986220_3986895_-\|cAMP-activated-global-transcriptional-regulator-CRP	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	3.59113e-55
NZ_CP022577.1\|WP_003419733.1\|3984858_3985314_+\|RidA-family-protein	gnl\|CDD\|100006	cd02199, YjgF_YER057c_UK114_like_1, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	7.62827e-68
NZ_CP022577.1\|WP_003419714.1\|3989857_3991051_+\|acid-resistance-serine-protease-MarP	gnl\|CDD\|379142	pfam13365, Trypsin_2, Trypsin-like peptidase domain. This family includes trypsin-like peptidase domains.	2.19977e-19
NZ_CP022577.1\|WP_003419731.1\|3985320_3986115_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293836	cd16278, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	3.29322e-75
NZ_CP022577.1\|WP_003902541.1\|3987478_3988216_+\|endonuclease-III	gnl\|CDD\|223255	COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair].	3.2984e-106
NZ_CP022577.1\|WP_003419721.1\|3988215_3988899_+\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.72736e-22
NZ_CP022577.1\|WP_003899631.1\|3993625_3995581_-\|acetate--CoA-ligase	gnl\|CDD\|234677	PRK00174, PRK00174, acetyl-CoA synthetase; Provisional.	0
NZ_CP022577.1\|WP_003899628.1\|3998834_3999698_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	2.77559e-81

>NZ_CP022577.1|WP_003419710.1|3992027_3992546_-|phage-holin-family-protein
MSKIDRKNGVPSTLTTIPLADPHAGPAEPSIGDLIKDATTQMSTLVRAEVELARAEITRDVKKGLTGSVFFISSLVVGFYSTFFFFFFVAELLDTWIWRWVAFLLVFAIMVVVTAVLALLGFLKVRRIRGPRQTIASVKETRTALTPGHDKTPVTPKPVTSDRATPVDPSGW
>NZ_CP022577.1|WP_003419712.1|3991043_3992027_-|alpha/beta-hydrolase
MAAPDPSMTRIAGPWRHLDVHANGIRFHVVEAVPSGQPEGPDAATPPMQPALARPLVILLHGFGSFWWSWRHQLCGLTGARVVAVDLRGYGGSDKPPRGYDGWTLAGDTAGLIRALGHPSATLVGHADGGLACWTTALLHSRLVRAIALISSPHPAALRRSTLTRRDQRHALLPTLLRYQLPIWPERLLTRNNAAEIERLVRARGCAKWLASEDFSQAIDHLRQAIQIPAAAHCALEYQRWAVRSQLRSEGRRFIRAMTQQLGMPLLHLRGDADPYVLADPVERTQRYAPHGRYISIAGAGHFSHEEAPEEVNRHLMRFLEQVHQLS
>NZ_CP022577.1|WP_003419714.1|3989857_3991051_+|acid-resistance-serine-protease-MarP
MTPSQWLDIAVLAVAFIAAISGWRAGALGSMLSFGGVLLGATAGVLLAPHIVSQISAPRAKLFAALFLILALVVVGEVAGVVLGRAVRGAIRNRPIRLIDSVIGVGVQLVVVLTAAWLLAMPLTQSKEQPELAAAVKGSRVLARVNEAAPTWLKTVPKRLSALLNTSGLPAVLEPFSRTPVIPVASPDPALVNNPVVAATEPSVVKIRSLAPRCQKVLEGTGFVISPDRVMTNAHVVAGSNNVTVYAGDKPFEATVVSYDPSVDVAILAVPHLPPPPLVFAAEPAKTGADVVVLGYPGGGNFTATPARIREAIRLSGPDIYGDPEPVTRDVYTIRADVEQGDSGGPLIDLNGQVLGVVFGAAVDDAETGFVLTAGEVAGQLAKIGATQPVGTGACVS
>NZ_CP022577.1|WP_106420803.1|3989030_3989852_+|CoA-pyrophosphatase
MSAGGTPLQAGATPTGSRGTVALRPDAGPSWLRPLVDNVGQIPDAYRRRLPADVLAMVTAAGAVSAMTSSRRDHREAAVLVLFSGPEAGPGDGGVPDDADLLLTVRASTLRHHAGQAAFPGGVVDPADDGPVATALREANEETGIDPSRLHPLATMERTFIAPSRFHVVPVLAYSPDPGPVAVVNEAETAIVARVPVRAFINPANRLMVYRRPHTRRWAGPAFLLNQMLVWGFTGQVISAVLDVAGWAQPWDSGDIRELDAAMVLIDDESDPR
>NZ_CP022577.1|WP_003419721.1|3988215_3988899_+|TlpA-family-protein-disulfide-reductase
MPSLPTTPAETAMTTLTGKTRWTIAILAVVAALMAALVAQLHDYSASSTISQRPAPREHRDGDTPEALAWSRQRANLPPCPAAGNGPGAAALRGVVVVCAGDGSAVDVARALAGRRVVINLWAHWCAPCMTELPVMAEYQRRVGPAVLVVTVHQGQNEAAALSRLADLGVRLPTLQDDRRRVAAALRVANVMPATVVLRPDGSVAQTLPRAFGSADEIVAAVGNDAG
>NZ_CP022577.1|WP_003902541.1|3987478_3988216_+|endonuclease-III
MRGRWSAETRLALVRRARRMNRALAQAFPHVYCELDFTTPLELAVATILSAQSTDKRVNLTTPALFARYRTARDYAQADRTELESLIRPTGFYRNKAASLIGLGQALVERFGGEVPATMDKLVTLPGVGRKTANVILGNAFGIPGITVDTHFGRLVRRWRWTTAEDPVKVEQAVGELIERKEWTLLSHRVIFHGRRVCHARRPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPETDHLLALAGL
>NZ_CP022577.1|WP_003899635.1|3986993_3987371_-|hypothetical-protein
MFTLLVSWLLVACVPGLLMLATLGLGRLERFLARDTVTATDVAEFLEQAEAVDVHTLARNGMPEALDYLHRRQARRITDSPPLGSGAGPRYAGPLFVTDLDSPVEPPRHGQPNPQFRTARHANHV
>NZ_CP022577.1|WP_003906177.1|3986220_3986895_-|cAMP-activated-global-transcriptional-regulator-CRP
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGNRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
>NZ_CP022577.1|WP_003419731.1|3985320_3986115_+|MBL-fold-metallo-hydrolase
MSKTAESLTHPAYGQLRAVTDTASVLLADNPGLLTLDGTNTWVLRGPLSDELVVVDPGPDDDEHLARVAALGRIALVLISHRHGDHTSGIDKLVALTGAPVRAADPQFLRRDGETLTDGEVIDVAGLTITVLATPGHTADSLSFVLDDAVLTADTVLGCGTTVIDKEDGSLADYLESLHRLRGLGRRTVLPGHGPDLLDLEAIASGYLLHRHERLEQIRAALRDLGDDATVREVVEHVYLDVDEKLWNAAEWSVQAQLDYLRTR
>NZ_CP022577.1|WP_003419733.1|3984858_3985314_+|RidA-family-protein
MSAKARLGQLGVTLPQVAAPLAAYVPAVRTGNLVYTAGQLPLEAGKLVRTGKLGADVNPEEGKTLARICALNALAAVDSLVDLDAVTRVVKVVGFVASAPGFHGQPSVINGASDLLAEVFGDSGAHARSAVGVSELPLDAPVEVELIVEVG
>NZ_CP022577.1|WP_003419708.1|3992891_3993590_+|protease
MQTAHRRFAAAFAAVLLAVVCLPANTAAADDKLPLGGGAGIVVNGDTMCTLTTIGHDKNGDLIGFTSAHCGGPGAQIAAEGAENAGPVGIMVAGNDGLDYAVIKFDPAKVTPVAVFNGFAINGIGPDPSFGQIACKQGRTTGNSCGVTWGPGESPGTLVMQVCGGPGDSGAPVTVDNLLVGMIHGAFSDNLPSCITKYIPLHTPAVVMSINADLADINAKNRPGAGFVPVPA
>NZ_CP022577.1|WP_003899631.1|3993625_3995581_-|acetate--CoA-ligase
MSESTPEVSSSYPPPAHFAEHANARAELYREAEEDRLAFWAKQANRLSWTTPFTEVLDWSGAPFAKWFVGGELNVAYNCVDRHVEAGHGDRVAIHWEGEPVGDRRTLTYSDLLAEVSKAANALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAKLLITADGQFRRGKPSPLKAAADEALAAIPDCSVEHVLVVRRTGIEMAWSEGRDLWWHHVVGSASPAHTPEPFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTIFDVKPDSDVFWCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTPDTPDRHRHFQIIEKYGVTIYYTAPTLIRMFMKWGREIPDSHDLSSLRLLGSVGEPINPEAWRWYRDVIGGGRTPLVDTWWQTETGSAMISPLPGIAAAKPGSAMTPLPGISAKIVDDHGDPLPPHTEGAQHVTGYLVLDQPWPSMLRGIWGDPARYWHSYWSKFSDKGYYFAGDGARIDPDGAIWVLGRIDDVMNVSGHRISTAEVESALVAHSGVAEAAVVGVTDETTTQAICAFVVLRANYAPHDRTAEELRTEVARVISPIARPRDVHVVPELPKTRSGKIMRRLLRDVAENRELGDTSTLLDPTVFDAIRAAK
>NZ_CP022577.1|WP_003901692.1|3996288_3997914_+|ABC-transporter-substrate-binding-protein
MVRRMRAALAALATGLLVLAPVAGCGGGVLSPDVVLVNGGEPPNPLIPTGTNDSNGGRIIDRLFAGLMSYDAVGKPSLEVAQSIESADNVNYRITVKPGWKFTDGSPVTAHSFVDAWNYGALSTNAQLQQHFFSPIEGFDDVAGAPGDKSRTTMSGLRVVNDLEFTVRLKAPTIDFTLRLGHSSFYPLPDSAFRDMAAFGRNPIGNGPYKLADGPAGPAWEHNVRIDLVPNPDYHGNRKPRNKGLRFEFYANLDTAYADLLSGNLDVLDTIPPSALTVYQRDLGDHATSGPAAINQTLDTPLRLPHFGGEEGRLRRLALSAAINRPQICQQIFAGTRSPARDFTARSLPGFDPNLPGNEVLDYDPQRARRLWAQADAISPWSGRYAIAYNADAGHRDWVDAVANSIKNVLGIDAVAAPQPTFAGFRTQITNRAIDSAFRAGWRGDYPSMIEFLAPLFTAGAGSNDVGYINPEFDAALAAAEAAPTLTESHELVNDAQRILFHDMPVVPLWDYISVVGWSSQVSNVTVTWNGLPDYENIVKA
>NZ_CP022577.1|WP_003419701.1|3997915_3998842_+|ABC-transporter-permease
MGWYVARRVAVMVPVFLGATLLIYGMVFLLPGDPVAALAGDRPLTPAVAAQLRSHYHLDDPFLVQYLRYLGGILHGDLGRAYSGLPVSAVLAHAFPVTIRLALIALAVEAVLGIGFGVIAGLRQGGIFDSAVLVTGLVIIAIPIFVLGFLAQFLFGVQLEIAPVTVGERASVGRLLLPGIVLGAMSFAYVVRLTRSAVAANAHADYVRTATAKGLSRPRVVTVHILRNSLIPVVTFLGADLGALMGGAIVTEGIFNIHGVGGVLYQAVTRQETPTVVSIVTVLVLIYLITNLLVDLLYAALDPRIRYG
>NZ_CP022577.1|WP_003899628.1|3998834_3999698_+|ABC-transporter-permease
MAEHTGFWLDAWRGLRRRPKFVIAAALILLILVVAAFPSLFTAADPTYADPSQSMLAPSAAHWFGTDLQGHDIYSRTVYGARASVTVGLGATLAVFVVGGALGALAGFYGSWIDAVVSRVTDVFLGLPLLLAAIVLMQVMHHRTVWTVIAILALFGWPQVARIARGAVLEVRASDYVLAAKALGLNRFQILLRHALPNAVGPVIAVATVALGIFIVTEATLSYLGVGLPTSVVSWGGDINVAQTRLRSGSPILFYPAGALAITVLAFMMMGDALRDALDPASRAWRA
>NZ_CP022577.1|WP_003900733.1|3999694_4001341_+|ABC-transporter-ATP-binding-protein
MSVPAAPLLSVEGLEVTFGTDAPAVCGVDLAVRSGQTVAVVGESGSGKSTTAAAILGLLPAGGRITAGRVVFDGRDITGADAKRLRSIRGREIGYVPQDPMTNLNPVWKVGFQVTEALRANTDGRAARRRAVELLAEAGLPDPAKQAGRYPHQLSGGMCQRALIAIGLAGRPRLLIADEPTSALDVTVQRQVLDHLQGLTDELGTALLLITHDLALAAQRAEAVVVVRRGVVVESGAAQSILQSPQHEYTRRLVAAAPSLTARSRRPPESRSRATTQAGDILVVSELTKIYRESRGAPWRRVESRAVDGVSFRLPRASTLAIVGESGSGKSTLARMVLGLLQPTSGTVVFDGTYDVGALARDQVLAFRRRVQPVFQNPYSSLDPMYSVFRAIEEPLRVHHVGDRRQRQRAVRELVDQVALPSSILGRRPRELSGGQRQRVAIARALALRPEVLVCDEAVSALDVLVQAQILDLLADLQADLGLTYLFISHDLAVIRQIADDVLVMRAGRVVEHASTEEVFSRPRHEYTRQLLQAIPGAPSAPRKVGNL
>NZ_CP022577.1|WP_003899626.1|4001337_4002108_+|hypothetical-protein
MTVDPLAPLMELPGVAAASDRVRDALSRVHRHRANLRGWPVAAAEASLRAARASSVLDGGPARLHDAGAPTSGKPALSDPVFAGALRVGQALEGGAGPVVGVWRRAPLQALARLHMLAAADQVDDDRLGRPRSDADVGPRLELLADVVTHPTLASAPVVAAVAHGELLTLRPFGCADGVVARAVSRLVTIATGLDPHGLGVPEVIWMRQPAEYHDAARRFAGGTPDGVAGWLLLCCGAMLDGAREALSIAESLSPG
>NZ_CP022577.1|WP_003419689.1|4002862_4003726_-|HAD-IB-family-hydrolase
MTVSDSPAQRQTPPQTPGGTAPRARTAAFFDLDKTIIAKSSTLAFSKPFFAQGLLNRRAVLKSSYAQFIFLLSGADHDQMDRMRTHLTNMCAGWDVAQVRSIVNETLHDIVTPLVFAEAADLIAAHKLCGRDVVVVSASGEEIVGPIARALGATHAMATRMIVEDGKYTGEVAFYCYGEGKAQAIRELAASEGYPLEHCYAYSDSITDLPMLEAVGHASVVNPDRGLRKEASVRGWPVLSFSRPVSLRDRIPAPSAAAIATTAAVGISALAAGAVTYALLRRFAFQP
>NZ_CP022577.1|WP_003900732.1|4004224_4005277_+|septum-site-determining-protein-Ssd
MLTDPGLRDELDRVAAAVGVRVVHLGGRHPVSRKTWSAAAAVVLDHAAADRCGRLALPRRTHVSVLTGTEAATATWAAAITVGAQHVLRMPEQEGELVRELAEAAESARDDGICGAVVAVIGGRGGAGASLFAVALAQAAADALLVDLDPWAGGIDLLVGGETAPGLRWPDLALQGGRLNWSAVRAALPRPRGISVLSGTRRGYELDAGPVDAVIDAGRRGGVTVVCDLPRRLTDATQAALDAADLVVLVSPCDVRACAAAATMAPVLTAINPNLGLVVRGPSPGGLRAAEVADVAGVPLLASMRAQPRLAEQLEHGGLRLRRRSVLASAARRVLGVLPRAGSGRHGRAA
>NZ_CP022577.1|WP_003899624.1|4005273_4006437_+|TadA-family-conjugal-transfer-associated-ATPase
MTGSLIERVRERLASESGPLRPSVVAAAIRAESGGMLGDTEVLANLRVLQTELTGAGILEPLLSADGTTDVLVTAPDSVWVDDGNGLRRSQIRFADESAVRRLAQRLALAAGRRLDDAQPWVDGQLTGIGVGGFAVRLHAVLPPVATQGTCLSLRVLRPATQDLAALAAAGAIDPAAAALVADIVTARLAFLVCGGTGAGKTTLLAAMLGAVSPDERIVCVEDAAELAPRHPHLVKLVARRANVEGIGEVTVRQLVRQALRMRPDRIVVGEVRGAEVVDLLAALNTGHEGGAGTVHANNPGEVPARMEALGALGGLDRAALHSQLAAAVQVLLHVARDRAGRRRLAEIAVLRQAEGRVQAVTVWHADRGMSDDAAALHDLLRSRASA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_12

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_12

4153588-4154752

Orphan

Consensus_repeat	Method
GCCGCCGNNNCCGCCGGNGCCGCCNNNGCCGCCGGNNCCGCCG	CRT

14 spacers

The CRISPR arrays of NZ_CP022577_12

>merge|NZ_CP022577|12|4153588-4154752|CRT
GCCGCCGTTACCACCGTTACCACCGTCGCCGCCGTCGCCGACGCCGGTGGCTGCCCCTCCGTCGGCGCCATCGCCGCCGTCACCGCCGGCGCCGCCTTTGCCGCCGGTGCCGCTGCCGGTGGGCGCGCCGCCGCTGCCGCCGGGCCCGCCTGTGCCGCCGGTCCCGCCGCTGCCGCCGTTGCCGTTGGTGCCGCCTTTTCCTCCGACCCCGGCGTTGCCGCCGTCACCGCCGGGCCCGCCGTCGCCAGCGATGCCGCCCATGCCGCCTTTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCGTTGAAGTTGGCCCCGCCGCTACCGCCGGCCCCGCCGCTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCTTTGCCGGGGTCGCCGGCGCCGGTGCCTGCGTTGCCGCCGTCGCCCCCGGTGCCGCCCACGCCCCCGGTGCCGCCGGTGCCGCCGTTGCTGCCGTTGCTGAAGCTGATGCCAGCACCCCCGGCGCCGCCTTGTCCGCCGGCCCCGCCGGCGCCGGAGCCGTTGGTGCCGCCGGTGCCGGCGTTGCCGCCGGCCCCGCCTTTGCCGCCGGCCCCGCCGGCAAAGCCGGGCTGGCCGCCCAATCCGGAACCGCTGTCTCCTTGGCCGCCGTTACCGCCTTGGCCGCCGTCACCGCCGATGCCCGCGTTGCCTGCGGTGCCGCCGGTGTTGGCTAGGCCGCCGGCGCCGGCGTTGCCGCCGGCCCCGCCTGTGCCGCCGGTCCCGCCGGCGGAGTCGTCGCCGGCCCCGCCGGTGCCGCCTTTGCCGCCAGTGCCGCCGGTGCCGCCGGTGCCGCTGGTGGCGCTGCTGAGTCCGTCGGTGTTTAGGCCGCCGTTGCCGCCGTTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCGTTGAAGTTGGCCCCGCCGCTACCGCCGGCCCCGCCGCTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCTTTGCCGGGGTCGCCGGCGCCGGTGCCTGCGTTGCCGCCGTCGCCCCCGGTGCCGCCCACGCCCCCGGTGCCGCCGGTGCCGCCGTTGCTGCCGTTGCTGAAGCTGATGCCAGCACCCCCGGCGCCGCCTTGTCCGCCGGCCCCGCCGGCGCCGCCGGAGCCGTTGGTGCCGCCG

>NZ_CP022577|12|6|4153588-4154752|CRT
GCCGCCGTTACCACCGTTACCACCGTCGCCGCCGTCGCCGACG	CCGGTGGCTGCCCCTCCGTCGGCGCCATC
GCCGCCGTCACCGCCGGCGCCGCCTTTGCCGCCGGTGCCGCTG	CCGGTGGGCGCGCCGCCGCTGCCGCCGGGCCCGCCTGTGCCGCCGGTCCCGCCGCT
GCCGCCGTTGCCGTTGGTGCCGCCTTTTCCTCCGACCCCGGCG	TTGCCGCCGTCACCGCCGGGCCCGCCGTCGCCAGCGATGCCGCCCATGCCGCCTTT
GCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCG	TTGAAGTTGGCCCCGCCGCT
ACCGCCGGCCCCGCCGCTGCCGCCGGTGCCGCCGGTGCCGCCG	GTGCCGCCTTTGCCGGGGTCGCCGGCGCCGGTGCCTGCGTT
GCCGCCGTCGCCCCCGGTGCCGCCCACGCCCCCGGTGCCGCCG	GTGCCGCCGTTGCTGCCGTTGCTGAAGCT
GATGCCAGCACCCCCGGCGCCGCCTTGTCCGCCGGCCCCGCCG	GCGCCGGAGCCGTTGGTGCCGCCGGT
GCCGGCGTTGCCGCCGGCCCCGCCTTTGCCGCCGGCCCCGCCG	GCAAAGCCGGGCTGGCCGCCCAATCCGGAACCGCT
GTCTCCTTGGCCGCCGTTACCGCCTTGGCCGCCGTCACCGCCG	ATGCCCGCGTTGCCTGCGGTGCCGCCGGTGTTGGCTAGGCCGCCGGC
GCCGGCGTTGCCGCCGGCCCCGCCTGTGCCGCCGGTCCCGCCG	GCGGAGTCGTCGCCGGCCCCGCCGGT
GCCGCCTTTGCCGCCAGTGCCGCCGGTGCCGCCGGTGCCGCTG	GTGGCGCTGCTGAGTCCGTCGGTGTTTAGGCCGCCGTT
GCCGCCGTTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCG	TTGAAGTTGGCCCCGCCGCTACCGCCGGC
CCCGCCGCTGCCGCCGGTGCCGCCGGTGCCGCCGGTGCCGCCT	TTGCCGGGGTCGCCGGCGCCGGTGCCTGCGTT
GCCGCCGTCGCCCCCGGTGCCGCCCACGCCCCCGGTGCCGCCG	GTGCCGCCGTTGCTGCCGTTGCTGAAGCTGATGCCAGCACCCCCGGCGCCGCCTTG
TCCGCCGGCCCCGCCGGCGCCGCCGGAGCCGTTGGTGCCGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003911024.1\|4151251_4152898_+\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|236100
NZ_CP022577.1\|WP_003421145.1\|4165737_4166574_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|225070
NZ_CP022577.1\|WP_003419207.1\|4141935_4142967_-\|membrane-protein	unknown	unknown	gnl\|CDD\|271322
NZ_CP022577.1\|WP_003902513.1\|4158170_4158827_+\|fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|236100
NZ_CP022577.1\|WP_003900872.1\|4166570_4168118_+\|acetolactate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|236063
NZ_CP022577.1\|WP_003418997.1\|4180484_4181687_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173841
NZ_CP022577.1\|WP_016330448.1\|4168284_4173147_-\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422
NZ_CP022577.1\|WP_003418993.1\|4181901_4182093_+\|ferredoxin	unknown	unknown	gnl\|CDD\|224064
NZ_CP022577.1\|WP_003901661.1\|4145289_4146201_-\|OB-fold-nucleic-acid-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224462
NZ_CP022577.1\|WP_003418990.1\|4182117_4183071_+\|3-oxoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|181120
NZ_CP022577.1\|WP_003419000.1\|4179338_4180460_-\|acyl-CoA/acyl-ACP-dehydrogenase	unknown	unknown	gnl\|CDD\|224871
NZ_CP022577.1\|WP_003906140.1\|4143008_4144193_-\|thiolase-domain-containing-protein	unknown	unknown	gnl\|CDD\|181378
NZ_CP022577.1\|WP_003419184.1\|4149451_4150291_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003900082.1\|4148200_4149397_+\|steroid-C26-monooxygenase-Cyp142	unknown	unknown	gnl\|CDD\|225035
NZ_CP022577.1\|WP_031650494.1\|4147461_4148172_-\|acetoacetate-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|377649
NZ_CP022577.1\|WP_003900084.1\|4146353_4147397_+\|LLM-class-F420-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274647
NZ_CP022577.1\|WP_003901655.1\|4177759_4179268_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236120
NZ_CP022577.1\|WP_003419199.1\|4144209_4145274_-\|thiolase-domain-containing-protein	unknown	unknown	gnl\|CDD\|181173
NZ_CP022577.1\|WP_003419179.1\|4150386_4151178_-\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|181122
NZ_CP022577.1\|WP_106420806.1\|4173437_4177589_-\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003911024.1\|4151251_4152898_+\|acyl-CoA-synthetase	gnl\|CDD\|236100	PRK07798, PRK07798, acyl-CoA synthetase; Validated.	0
NZ_CP022577.1\|WP_003421145.1\|4165737_4166574_+\|amidohydrolase	gnl\|CDD\|225070	COG2159, COG2159, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	2.24025e-81
NZ_CP022577.1\|WP_003419207.1\|4141935_4142967_-\|membrane-protein	gnl\|CDD\|271322	cd14952, NHL_PKND_like, NHL repeat domain of the protein kinase PknD. PknD is a mycobacterial transmembrane protein with a cytosolic kinase domain and an extracellular sensor domain that contains NHL repeats. It plays a key role in the development of central nervous system tuberculosis, by mediating the invasion of host brain endothelia. The NHL (NCL-1, HT2A and LIN-41) repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures.	3.56986e-118
NZ_CP022577.1\|WP_003902513.1\|4158170_4158827_+\|fatty-acid--CoA-ligase	gnl\|CDD\|236100	PRK07798, PRK07798, acyl-CoA synthetase; Validated.	8.05622e-104
NZ_CP022577.1\|WP_003900872.1\|4166570_4168118_+\|acetolactate-synthase-large-subunit	gnl\|CDD\|236063	PRK07586, PRK07586, acetolactate synthase large subunit.	0
NZ_CP022577.1\|WP_003418997.1\|4180484_4181687_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.72908e-173
NZ_CP022577.1\|WP_016330448.1\|4168284_4173147_-\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.63447e-28
NZ_CP022577.1\|WP_003418993.1\|4181901_4182093_+\|ferredoxin	gnl\|CDD\|224064	COG1141, Fer, Ferredoxin [Energy production and conversion].	6.5974e-14
NZ_CP022577.1\|WP_003901661.1\|4145289_4146201_-\|OB-fold-nucleic-acid-binding-domain-containing-protein	gnl\|CDD\|224462	COG1545, COG1545, Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only].	9.89177e-41
NZ_CP022577.1\|WP_003418990.1\|4182117_4183071_+\|3-oxoacyl-ACP-reductase	gnl\|CDD\|181120	PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	2.1253e-180
NZ_CP022577.1\|WP_003419000.1\|4179338_4180460_-\|acyl-CoA/acyl-ACP-dehydrogenase	gnl\|CDD\|224871	COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism].	2.51968e-48
NZ_CP022577.1\|WP_003906140.1\|4143008_4144193_-\|thiolase-domain-containing-protein	gnl\|CDD\|181378	PRK08313, PRK08313, thiolase domain-containing protein.	0
NZ_CP022577.1\|WP_003900082.1\|4148200_4149397_+\|steroid-C26-monooxygenase-Cyp142	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	1.72638e-107
NZ_CP022577.1\|WP_031650494.1\|4147461_4148172_-\|acetoacetate-decarboxylase-family-protein	gnl\|CDD\|377649	pfam06314, ADC, Acetoacetate decarboxylase (ADC). This family consists of several acetoacetate decarboxylase (ADC) proteins (EC:4.1.1.4).	9.37323e-27
NZ_CP022577.1\|WP_003900084.1\|4146353_4147397_+\|LLM-class-F420-dependent-oxidoreductase	gnl\|CDD\|274647	TIGR03559, F420_Rv3520c, probable F420-dependent oxidoreductase, Rv3520c family. Members of this protein family are predicted to be oxidoreductases dependent on coenzyme F420. The family includes a single member in Mycobacterium tuberculosis (Rv3520c/MT3621) but four in Mycobacterium smegmatis. Prediction that this family is F420-dependent is based primarily on Partial Phylogenetic Profiling vs. F420 biosynthesis. [Unknown function, Enzymes of unknown specificity].	0
NZ_CP022577.1\|WP_003901655.1\|4177759_4179268_-\|AMP-binding-protein	gnl\|CDD\|236120	PRK07867, PRK07867, acyl-CoA synthetase; Validated.	0
NZ_CP022577.1\|WP_003419199.1\|4144209_4145274_-\|thiolase-domain-containing-protein	gnl\|CDD\|181173	PRK07937, PRK07937, lipid-transfer protein; Provisional.	0
NZ_CP022577.1\|WP_003419179.1\|4150386_4151178_-\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|181122	PRK07799, PRK07799, crotonase/enoyl-CoA hydratase family protein.	0
NZ_CP022577.1\|WP_106420806.1\|4173437_4177589_-\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.56038e-30

>NZ_CP022577.1|WP_003911024.1|4151251_4152898_+|acyl-CoA-synthetase
MAVALNIADLAEHAIDAVPDRVAVICGDEQLTYAQLEDKANRLAHHLIDQGVQKYDKVGLYCRNRIEIVIAMLGIVKAGAILVNVNFRYVEGELRYLFDNSDMVALVHERRYADRVANVLPDTPHVRTILVVEDGSDQDYRRYGGVEFYSAIAAGSPERDFGERSADAIYLLYTGGTTGFPKGVMWRHEDIYRVLFGGTDFATGEFVKDEYDLAKAAAANPPMIRYPIPPMIHGATQSATWMALFSGQTTVLAPEFNADEVWRTIHKHKVNLLFFTGDAMARPLVDALVKGNDYDLSSLFLLASTAALFSPSIKEKLLELLPNRVITDSIGSSETGFGGTSVVAAGQAHGGGPRVRIDHRTVVLDDDGNEVKPGSGMRGVIAKKGNIPVGYYKDEKKTAETFRTINGVRYAIPGDYAQVEEDGTVTMLGRGSVSINSGGEKVYPEEVEAALKGHPDVFDALVVGVPDPRYGQQVAAVVQARPGCRPSLAELDSFVRSEIAGYKVPRSLWFVDEVKRSPAGKPDYRWAKEQTEARPADDVHAGHVTSGG
>NZ_CP022577.1|WP_003419179.1|4150386_4151178_-|crotonase/enoyl-CoA-hydratase-family-protein
MESGPDALVERRGHTLIVTMNRPAARNALSTEMMRIMVQAWDRVDNDPDIRCCILTGAGGYFCAGMDLKAATQKPPGDSFKDGSYDPSRIDALLKGRRLTKPLIAAVEGPAIAGGTEILQGTDIRVAGESAKFGISEAKWSLYPMGGSAVRLVRQIPYTLACDLLLTGRHITAAEAKEMGLIGHVVPDGQALTKALELADAISANGPLAVQAILRSIRETECMPENEAFKIDTQIGIKVFLSDDAKEGPRAFAEKRAPNFQNR
>NZ_CP022577.1|WP_003419184.1|4149451_4150291_-|hypothetical-protein
MIEPFLGSEAIASGALTRHRLRSAYATIHPDVYVSPGADLTAWSRAQAAWLWSRRRGVIAGQSAAAMHGAKWVDARQAAELLYDHRRPPAGIHTWSDRVADDEIQPISGMNTTTPARTALDLARRYPVGKAVAAIDALARATDLKLADVEMLAERYRGSRGIRNARIALDLVDPGAESPRETWLRLLLIRAGFPRPQTQIPVYDEYGQLVAVIDMGWAGIKVGVDYEGDHHRTDRRTFNKDIKRAEALTELGWTDVRVTVEDTEGGIIWRVSAAWQRRT
>NZ_CP022577.1|WP_003900082.1|4148200_4149397_+|steroid-C26-monooxygenase-Cyp142
MTEAPDVDLADGNFYASREARAAYRWMRANQPVFRDRNGLAAASTYQAVIDAERQPELFSNAGGIRPDQPALPMMIDMDDPAHLLRRKLVNAGFTRKRVKDKEASIAALCDTLIDAVCERGECDFVRDLAAPLPMAVIGDMLGVRPEQRDMFLRWSDDLVTFLSSHVSQEDFQITMDAFAAYNDFTRATIAARRADPTDDLVSVLVSSEVDGERLSDDELVMETLLILIGGDETTRHTLSGGTEQLLRNRDQWDLLQRDPSLLPGAIEEMLRWTAPVKNMCRVLTADTEFHGTALCAGEKMMLLFESANFDEAVFCEPEKFDVQRNPNSHLAFGFGTHFCLGNQLARLELSLMTERVLRRLPDLRLVADDSVLPLRPANFVSGLESMPVVFTPSPPLG
>NZ_CP022577.1|WP_031650494.1|4147461_4148172_-|acetoacetate-decarboxylase-family-protein
MPVSQHTIAGTVLTMPVRIRTGNLHSAMFSVPADPAQRLIDYSGLRVCEYLPGKAIVMQMLVRYVDGDLGRYHEYGTAIMVNPPGTQRRGPRALTRAAAFIHHLPVDQVFTLEAGRTIWGFPKIMADFNVTDGRRFGFDVSADGRLIAGIEFSTGLPVPTLGWQMLKTYSHHDGVTREIPWEMKVSGLRARLGGARLRLGDHPYAKELASLGLPKRALLSQSAANVEMTFGDGHPI
>NZ_CP022577.1|WP_003900084.1|4146353_4147397_+|LLM-class-F420-dependent-oxidoreductase
MEAGMKLGLQLGYWGAQPPQNHAELVAAAEDAGFDTVFTAEAWGSDAYTPLAWWGSSTQRVRLGTSVIQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQVVEGWYGQRFPKPLARTREYIDIVRQVWARESPVTSAGPHYRLPLTGEGTTGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIFYSPRMAGMYNEWLDEGFARPGARRSREDFEICATAQVVITDDRAAAFAGIKPFLALYMGGMGAEETNFHADVYRRMGYTQVVDEVTKLFRSGRKDEAAEIIPDELVDDAVIVGDIDHVRKQMAVWEAAGVTMMVVTAGSAEQVRDLAALV
>NZ_CP022577.1|WP_003901661.1|4145289_4146201_-|OB-fold-nucleic-acid-binding-domain-containing-protein
MGPTLSRFFTALRARRIVGVRGSDGRVHVPPVEYDPVTYEPLSEMVPVSSVGTVASWTWQPEPLAGQPLDRPFAWALIKLDGADTLLMHAVDVGTAGPSAIHTGARVHAHWADQPVGAITDIACFALGETAEPVAAHKTEDARDPVTMIVTPIQLEIQHTASHEESAYLRAIAQGKLVGARTGKTGKVYFPPHGADPATGKPTSEFVELPDKGTVTTFAIVNIPFLGQRIKPPYVAAYVLLDGADIPFLHLVSDVDAHQVRMGMRVEAVWKPRERWGLGIDNIEYFRPTGEPDADYDTYKHHL
>NZ_CP022577.1|WP_003419199.1|4144209_4145274_-|thiolase-domain-containing-protein
MSVRDIAVVGFAHAPHVRRTDGTTNGVEMLMPCFAQLYDELGITKADIGFWCSGSSDYLAGRAFSFISAIDSIGAVPPINESHVEMDAAWALYEAYIKLLTGEVDTALVYGFGKSSAGTLRRVLSRQTDPYTVAPLWPDSVSMAGLQARLGLDSGKWTHEQMARVAFDSFTNARRVDSVEPPITVGELLARPFFADPLRRHDIAPITDGAAAVVLAADNRARELRENPAWITGIEHRIESPALGARDITESPSTKLAAKIATGGHTGDIDVAEIHGPFTHQHLIVAEAIRIPGKTKVNPSGGPLAANPMFAAGLERIGFAAQHIWDGSARRVLAHATSGPALQQNLVAVMEGRG
>NZ_CP022577.1|WP_003906140.1|4143008_4144193_-|thiolase-domain-containing-protein
MAGKLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGSTFDDIDAVVVGKAPDFFEGVMMPELLMADAMGATGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLALAWEKQSESNAMWALSIPVPFTKPVGAGAGGYFAPHVRAYIRRSGAPAHIGAMVAVKDRLNGSRNPLAHLQQPDITLEKVMASQMLWDPIRFDETCPSSDGACAVVVGDEEIADARLAQGHPVAWIHGTALRTEPLAFAGRDQVNPQAGRDAAAALWKAAGITSPIDEIDAAEIYVPFSWFEPMWLENLGFAREGEGWKLTEAGETAIGGRLPVNPSGGVLSANPIGASGLIRFAEAAIQVMGKAEARQVPGARKALGHAYGGGSQYFSMWVVGCEKPKQAAA
>NZ_CP022577.1|WP_003419207.1|4141935_4142967_-|membrane-protein
MVKFTPDSQTSVLRAGKCSGTLSPSRSRLQRGSWPVDSERRRYGWPRNRRTLAITGAAVVVVVTLAAIGYLIFEPKISGSSTSRQAASPTTPSPPSQVVVPIDLWNPDGVTVDLADAVYVADSGHKRLLKLPAGSNTPTTLPFTDTIGPGGVAVNSNRDVYVIDEDSHHVLKLAAGIEPPVELPFGSLGDAHGLAVDRSDSVYVVDYDNAKVLKLPPGADTPTELPFVGLDHPYDVAVDGAGTVYVTDSGHNRVVALTAGSATPVHLPFADLSFPAGVTVDRDDSVYVADLNNNRVLKLAAGSNAQSQLPFTGLFSPTDVAVDNDGAVYVIDFYNRMLKLPTA
>NZ_CP022577.1|WP_003902513.1|4158170_4158827_+|fatty-acid--CoA-ligase
MAASLSENLSCHSSNMCRLSGNAATNLERPGEEPPGDRCTRRQAVRPARTLAKKGNIPVGYYKDEKKTAETFRTINGVRYAIPGDYAQVEEDGTVTMLGRGSVSINSGGEKVYPEEVEAALKGHPDVFDALVVGVPDPRYGQQVAAVVQARPGCRPSLAELDSFVRSEIAGYKVPRSLWFVDEVKRSPAGKPDYRWAKEQTEARPADDVHAGHVTSGS
>NZ_CP022577.1|WP_003421145.1|4165737_4166574_+|amidohydrolase
MTIDVWMQHPTQRFLHGDMFASLRRWTGGSIPETDIPIEATVSSMDAGGVTLGLLSAWRGPNGQDLISNDAVAEWVRLYPNRFAGLAAVDLDRPMAAVRELRRRVGEGFVGLRVVPWLWGAPPTDRRYYPLFAECVQSAVPFCTQVGHTGPLRPSETGRPIPYIDQVALDFPELVIVCGHVGYPWTEEMVAVARKHENVYIDTSAYTIKRLPGKLVRFMKTDTGQRKVLFGTNYPMIAHTHALTGLDELGLSDEARRDFLHGNAVRVFKLDPRGKVQT
>NZ_CP022577.1|WP_003900872.1|4166570_4168118_+|acetolactate-synthase-large-subunit
MNGAQALINTLVDGGVDVCFANPGTSEMHFVAALDAVPRMRGMLTLFEGVATGAADGYARIAGRPAAVLLHLGPGLGNGLANLHNARRARVPMVVVVGDHATYHKKYDAPLESDIDAVAGTVSGWVRRTEAAADVGADAEAAIAASRSGSQIATLILPADVCWSDGAHAAAGVPAQAAAAPVDVGPVAGVLRSGEPAMMLIGGDATRGPGLTAAARIVQATGARWLCETFPTCLERGAGIPAVERLAYFAEGAAAQLDGVKHLVLAGARSPVSFFAYPGMPSDLVPAGCEVHVLAEPGGAADALAALADEVAPGTVAPVAGASRPQLPTGDLTSVSAADVVGALLPERAIVVDESNTCGVLLPQATAGAPAHDWLTLTGGAIGYGIPAAVGAAVAAPDRPVLCLESDGSAMYTISGLWSQARENLDVTTVIYNNGAYDILRIELQRVGAGSDPGPKALDLLDISRPTMDFVKIAEGMGVPARRVTTCEEFADALRAAFAEPGPHLIDVVVPSLVG
>NZ_CP022577.1|WP_016330448.1|4168284_4173147_-|PE-family-protein
MSFVLIAPEFVTAAAGDLTNLGSSISAANASAASATTQVLAAGADEVSARIAALFGGFGLEYQAISAQVAAYHQRFVQALSTGAGAYASAEAAAAEQIVLGVINAPTQALLGRPLIGDGANATTPGGAGGAGGLLFGNGGAGAAGAPGQAGGAGGPAGLWGNGGPGGAGGSGGGTGGAGGAGGWLFGVGGAGGVGGAGGGTGGAGGPGGLIWGGGGAGGVGGAGGGTGGAGGRAELLFGAGGAGGAGGAGTDGGPGATGGTGGHGGVGGDGGWLAPGGAGGAGGQGGAGGAGSDGGALGGTGGTGGTGGAGGAGGRGALLLGAGGQGGLGGAGGQGGTGGAGGDGVLGGVGGTGGKGGVGGVAGLGGAGGAAGQLFSAGGAAGAVGVGGTGGQGGAGGAGAAGADAPASTGLTGGTGFAGGAGGVGGQGGNAIAGGINGSGGAGGTGGQGGAGGMGGSGADNASGIGADGGAGGTGGNAGAGGAGGAAGTGGTGGVVGAAGKAGIGGTGGQGGAGGAGSAGTDATATGATGGTGFSGGAGGAGGAGGNTGVGGTNGSGGQGGTGGAGGAGGAGGVGADNPTGIGGTGGTGGKGGAGGAGGAGADATATGATGGTGFAGGAGGAGGQGGSSGAGGTNGSGGAGGTGGQGGAGGAGGAGADNPTGIGGAGGTGGTGGAAGAGGAGGAIGTGGTGGAVGSVGNAGIGGTGGTGGVGGAGGAGAAAAAGSSATGGAGFAGGAGGEGGAGGNSGVGGTNGSGGAGGAGGKGGTGGAGGSGADNPTGAGFAGGAGGTGGAAGAGGAGGATGTGGTGGVVGATGSAGIGGAGGRGGDGGDGASGLGLGLSGFDGGQGGQGGAGGSAGAGGINGAGGAGGNGGDGGDGATGAAGLGDNGGVGGDGGAGGAAGNGGNAGVGLTAKAGDGGAAGNGGNGGAGGAGGAGDNNFNGGQGGAGGQGGQGGLGGASTTSINANGGAGGNGGTGGKGGAGGAGTLGVGGSGGTGGDGGDAGAGGGGGFGGAAGKAGGGGNGGVGGDGGEGASGLGLGLSGFDGGQGGQGGAGGNAGAGGINGAGGTGGTGGAGGDGAPATLIGGPDGGDGGQGGIGGDGGNAGFGAGVPGDGGDGGNAGFGAGVPGDGGIGGTGGAGGAGGAGADGDPSIDGGQGGAGGHGGQGGKGGLNSTGLASAASGDGGNGGAGGAGGNGGDGDGFIGGSGGTGGTGGDAGVGGLANTGGTAGNAGIGGAGGRGGDGGAGDSGALSQDGNGFAGGQGGQGGAGGNAGAGGINGAGGTGGTGGAGGDGAPATLIGGPDGGDGGQGGIGGDGGNAGFGAGVPGDGGIGGTGGAGGAGGAGADGDPSIDGGQGRAGGHGGQGGKGGLNSTGLASAASGDGGNGGAGGAGGTGGTGGAGGDGQNGTTGVASEGGAGGQGGDGGDGGEGGGAGFGSGVAGAAGAGGNGGKGGDGGTGGTGGTNFAGGQGGAGGRGGAGGNGANGVGDNAAGGDGGNGGAGGLGGGGGTGGTNGNGGLGGGGGNGGAGGAGGTPTGSGTEGTGGDGGDAGAGGNGGSATGVGNGGNGGDGGNGGDGGNGAPGGFGGGAGAGGLGGSGAGGGTDGDDGNGGSPGTDGS
>NZ_CP022577.1|WP_106420806.1|4173437_4177589_-|PE-family-protein
MSFVLVSPETVAAVATDLKRIGASLAHENASAAASTTAVVSAAADEVSTAVAALFSQHAQGYQAAAAQVAAFHSRFVQALTAGAGAYAFAEAANASPLQSAMGAVSASAQTLLSRPLIGNGANATTPGGNGGDGGWLFGSGGNGAPGAAGQSGGNGGSAGLWGNGGAGGAGGSGGAAGGNGGNGGWLFGAGGTGGIGGTGAPGAMGGTGGNGGNGALLIGGGGLGGAGGMGGTGGGTGGTGGNGGNGALLIGAGGVGGAGGIGGQGTGAGGAAGAGGTGGNGGAGGLFMNGGDGGAGGQGGDGAAGDAAASAGGTGGKGGQGGTGGMGGAGGDGTTVIAAGTGGEGGTGGAAGAGGAAGARGALTSGGLAGGVGAGGTGGTGGTGGNGADAAAVVGFGANGDPGFAGGKGGNGGIGGAAVTGGVAGDGGTGGKGGTGGAGGAGNDAGSTGNPGGKGGDGGIGGAGGAGGAAGTGNGGHAGNTGDGGDGGTGGNGGNGTGGVNGADNTLNPDTPGGAGEPGGAGGAGGAGGAAGGPGGTGGTGGNGGNGGNGGNGGNGGNAGNNSTNAPVGGEGGAGGDGGAGGAGGAANGGTAGSQGTGGVGGDGGAGGNGGGGKAGTGNSGNFGVDGEAGFSGGAGGNGGVGGAAGANGGTGGSGGNGGDGGAGGIGGAGGNGIPGTGTEPAGGTGAKGGDGGDGGAGGAGGNAGGAGGNGGAGGQGGNAGQGGAGGAGGNAVIPGDGVGKAPHGDAGGSGGDGGKGGQGGSGGTGGSGAPIGGGAGGTGGSGGHAGKGGAGGIGAQGTTITVPGNGGNAGDGGNGGGGGAGGTGGDGATGTPAGNGGDGGNGGNAGAGGNGGSGDFGGNTTSGASGSGGNGGNAGTAGSGGAGGTGGTGLSGGNGGNGGNGGNGGDGGNGAHGTVGAQFVPATSLPTPNGGAGGNGGTGSNGGAPGPAGAPGPTTGGNAGSQGIGGDGGNGGDGGKGGDGADAVNVVFMPTEPQAATGTAGSAGDPTGGNGGPGTPGSPMVAPPPPTPITQVQQGGDGGAGGTGSTNANDGTATGGKGGEGGVGSILGGPGGNGGTGGNASATGTNGVANAGNGGKGGDGGQFGAGGNGGAGGSVTDGSAGSTAGNGGNGGNATNGTIAGQPAGGNGSAGGKGGDGGNIAAGATGTAGNGGNGGNGNDGAVNAGTGGSGGNGGNAGGGGANGGDGGAGGAGGAGGRGGKGIDGGFGGDGGNGGSNNGTGAGGNGGNGGTGGVGSVGAAGGDGGNGGTGGFAGFGGTAGNGGSGGTGGAGGDGGTGGDGGNGGTGVIAGGGGTGGTGGASGAGGAGGTGGFAGNGNAGGNGGTGGASEDGDNGNAGSGATGGTGGNGGTGGDGGAAGLGGVA
>NZ_CP022577.1|WP_003901655.1|4177759_4179268_-|AMP-binding-protein
MTPTHPTVTELLLPLSEIDDRGVYFEDSFTSWRDHIRHGAAIAAALRERLDPARPPHVGVLLQNTPFFSATLVAGALSGIVPVGLNPVRRGAALAGDIAKADCQLVLTGSGSAEVPADVEHINVDSPEWTDEVAAHRDTEVRFRSADLADLFMLIFTSGTSGDPKAVKCSHRKVAIAGVTITQRFSLGRDDVCYVSMPLFHSNAVLVGWAVAAACQGSMALRRKFSASQFLADVRRYGATYANYVGKPLSYVLATPELPDDADNPLRAVYGNEGVPGDIDRFGRRFGCVVMDGFGSTEGGVAITRTLDTPAGALGPLPGGIQIVDPDTGEPCPTGVVGELVNTAGPGGFEGYYNDEAAEAERMAGGVYHSGDLAYRDDAGYAYFAGRLGDWMRVDGENLGTAPIERVLMRYPDATEVAVYPVPDPVVGDQVMAALVLAPGTKFDADKFRAFLTEQPDLGHKQWPSYVRVSAGLPRTMTFKVIKRQLSAEGVACADPVWPIRR
>NZ_CP022577.1|WP_003419000.1|4179338_4180460_-|acyl-CoA/acyl-ACP-dehydrogenase
MDFTTTEAAQDLGGLVDTIVDAVCTPEHQRELDKLEQRFDRELWRKLIDAGILSSAAPESLGGDGFGVLEQVAVLVALGHQLAAVPYLESVVLAAGALARFGSPELQQGWGVSAVSGDRILTVALDGEMGEGPVQAAGTGHGYRLTGTRTQVGYGPVADAFLVPAETDSGAAVFLVAAGDPGVAVTALATTGLGSVGHLELNGAKVDAARRVGGTDVAVWLGTLSTLSRTAFQLGVLERGLQMTAEYARTREQFDRPIGSFQAVGQRLADGYIDVKGLRLTLTQAAWRVAEDSLASRECPQPADIDVATAGFWAAEAGHRVAHTIVHVHGGVGVDTDHPVHRYFLAAKQTEFALGGATGQLRRIGRELAETPA
>NZ_CP022577.1|WP_003418997.1|4180484_4181687_-|acyl-CoA-dehydrogenase-family-protein
MRISYTPQQEELRRELRSYFATLMTPERREALSSVQGEYGVGNVYRETIAQMGRDGWLALGWPKEYGGQGRSAMDQLIFTDEAAIAGAPVPFLTINSVAPTIMAYGTDEQKRFFLPRIAAGDLHFSIGYSEPGAGTDLANLRTTAVRDGDDYVVNGQKMWTSLIQYADYVWLAVRTNPESSGAKKHRGISVLIVPTTAEGFSWTPVHTMAGPDTSATYYSDVRVPVANRVGEENAGWKLVTNQLNHERVALVSPAPIFGCLREVREWAQNTKDAGGTRLIDSEWVQLNLARVHAKAEVLKLINWELASSQSGPKDAGPSPADASAAKVFGTELATEAYRLLMEVLGTAATLRQNSPGALLRGRVERMHRACLILTFGGGTNEVQRDIIGMVALGLPRANR
>NZ_CP022577.1|WP_003418993.1|4181901_4182093_+|ferredoxin
MRVIVDRDRCEGNAVCLGIAPDIFDLDDEDYAVVKTDPIPVDQEDLAEQAIAECPRAALSRGE
>NZ_CP022577.1|WP_003418990.1|4182117_4183071_+|3-oxoacyl-ACP-reductase
MKLTESNRSPRTTNTTDLSGKVAVVTGAAAGLGRAEALGLARLGATVVVNDVASALDASDVVDEIGAAAADAGAKAVAVAGDISQRATADELLASAVGLGGLDIVVNNAGITRDRMLFNMSDEEWDAVIAVHLRGHFLLTRNAAAYWRDKAKDAEGGSVFGRLVNTSSEAGLVGPVGQANYAAAKAGITALTLSAARALGRYGVCANVICPRARTAMTADVFGAAPDVEAGQIDPLSPQHVVSLVQFLASPAAAEVNGQVFIVYGPQVTLVSPPHMERRFSADGTSWDPTELTATLRDYFAGRDPEQSFSATDLMRQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_13

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_13

4173467-4173899

Orphan

Consensus_repeat	Method
CGCCNGTGCCGCCGNTGCCGCC	CRT

7 spacers

The CRISPR arrays of NZ_CP022577_13

>merge|NZ_CP022577|13|4173467-4173899|CRT
CGCCGTCGCCGCCGGTGCCGCCGTTGCCGCCGGTACCGCCGGTGGCGCCGCTGCCAGCGTTGCCGTTGTCGCCGTCCTCGCTCGCGCCGCCGGTGCCGCCATTGCCGCCGGCATTGCCGTTGCCGGCGAACCCGCCCGTGCCGCCGGCGCCGCCGGCCCCGCTGGCGCCGCCGGTGCCGCCGGTCCCCCCGCCGCCGGCGATAACGCCGGTGCCGCCGTTGCCGCCGTCCCCGCCGGTGCCGCCGTCGCCGCCGGCCCCGCCCGTGCCGCCGGAACCGCCATTGCCTGCGGTGCCGCCGAAACCGGCGAAGCCGCCGGTGCCGCCGTTGCCGCCATCGCCACCAGCCGCGCCAACCGAGCCGACCCCGCCGGTGCCGCCGTTGCCGCCGTTGCCACCGGCGCCGGTGCCGTTGTTGCTGCCGCCGTTGCCGCC

>NZ_CP022577|13|7|4173467-4173899|CRT
CGCCGTCGCCGCCGGTGCCGCC	GTTGCCGCCGGTACCGCCGGTGGCGCCGCTGCCAGCGTTGCCGTTGTCGCCGTCCT
CGCTCGCGCCGCCGGTGCCGCC	ATTGCCGCCGGCATTGCCGTTGCCGGCGAACC
CGCCCGTGCCGCCGGCGCCGCC	GGCCCCGCTGGCGCCGCCGGTGCCGCCGGTCCCCCCGCCGCCGGCGATAA
CGCCGGTGCCGCCGTTGCCGCC	GTCCCCGCCGGTGCCGCCGTCGCCGCCGGCCC
CGCCCGTGCCGCCGGAACCGCC	ATTGCCTGCGGTGCCGCCGAAACCGGCGAAGC
CGCCGGTGCCGCCGTTGCCGCC	ATCGCCACCAGCCGCGCCAACCGAGCCGACCC
CGCCGGTGCCGCCGTTGCCGCC	GTTGCCACCGGCGCCGGTGCCGT
TGTTGCTGCCGCCGTTGCCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003418979.1\|4184957_4186160_+\|virulence-factor-Mce4A	unknown	unknown	gnl\|CDD\|273384
NZ_CP022577.1\|WP_003911024.1\|4151251_4152898_+\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|236100
NZ_CP022577.1\|WP_003421145.1\|4165737_4166574_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|225070
NZ_CP022577.1\|WP_003418983.1\|4184095_4184938_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223838
NZ_CP022577.1\|WP_003419184.1\|4149451_4150291_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003418972.1\|4186159_4187212_+\|virulence-factor-Mce-family-protein	unknown	unknown	gnl\|CDD\|273384
NZ_CP022577.1\|WP_003900872.1\|4166570_4168118_+\|acetolactate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|236063
NZ_CP022577.1\|WP_003418997.1\|4180484_4181687_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173841
NZ_CP022577.1\|WP_003901655.1\|4177759_4179268_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236120
NZ_CP022577.1\|WP_003902513.1\|4158170_4158827_+\|fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|236100
NZ_CP022577.1\|WP_003418990.1\|4182117_4183071_+\|3-oxoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|181120
NZ_CP022577.1\|WP_003419000.1\|4179338_4180460_-\|acyl-CoA/acyl-ACP-dehydrogenase	unknown	unknown	gnl\|CDD\|224871
NZ_CP022577.1\|WP_003418993.1\|4181901_4182093_+\|ferredoxin	unknown	unknown	gnl\|CDD\|224064
NZ_CP022577.1\|WP_003900082.1\|4148200_4149397_+\|steroid-C26-monooxygenase-Cyp142	unknown	unknown	gnl\|CDD\|225035
NZ_CP022577.1\|WP_031650494.1\|4147461_4148172_-\|acetoacetate-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|377649
NZ_CP022577.1\|WP_003900084.1\|4146353_4147397_+\|LLM-class-F420-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274647
NZ_CP022577.1\|WP_016330448.1\|4168284_4173147_-\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422
NZ_CP022577.1\|WP_003906120.1\|4187201_4188275_+\|virulence-factor-Mce-family-protein	unknown	unknown	gnl\|CDD\|273384
NZ_CP022577.1\|WP_003419179.1\|4150386_4151178_-\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|181122
NZ_CP022577.1\|WP_003418986.1\|4183296_4184061_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223838

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003418979.1\|4184957_4186160_+\|virulence-factor-Mce4A	gnl\|CDD\|273384	TIGR00996, Mtu_fam_mce, virulence factor Mce family protein. Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. [Cellular processes, Pathogenesis].	3.82434e-84
NZ_CP022577.1\|WP_003911024.1\|4151251_4152898_+\|acyl-CoA-synthetase	gnl\|CDD\|236100	PRK07798, PRK07798, acyl-CoA synthetase; Validated.	0
NZ_CP022577.1\|WP_003421145.1\|4165737_4166574_+\|amidohydrolase	gnl\|CDD\|225070	COG2159, COG2159, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	2.24025e-81
NZ_CP022577.1\|WP_003418983.1\|4184095_4184938_+\|ABC-transporter-permease	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	9.90895e-74
NZ_CP022577.1\|WP_003902513.1\|4158170_4158827_+\|fatty-acid--CoA-ligase	gnl\|CDD\|236100	PRK07798, PRK07798, acyl-CoA synthetase; Validated.	8.05622e-104
NZ_CP022577.1\|WP_003900872.1\|4166570_4168118_+\|acetolactate-synthase-large-subunit	gnl\|CDD\|236063	PRK07586, PRK07586, acetolactate synthase large subunit.	0
NZ_CP022577.1\|WP_003418997.1\|4180484_4181687_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.72908e-173
NZ_CP022577.1\|WP_003901655.1\|4177759_4179268_-\|AMP-binding-protein	gnl\|CDD\|236120	PRK07867, PRK07867, acyl-CoA synthetase; Validated.	0
NZ_CP022577.1\|WP_003418990.1\|4182117_4183071_+\|3-oxoacyl-ACP-reductase	gnl\|CDD\|181120	PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	2.1253e-180
NZ_CP022577.1\|WP_003418972.1\|4186159_4187212_+\|virulence-factor-Mce-family-protein	gnl\|CDD\|273384	TIGR00996, Mtu_fam_mce, virulence factor Mce family protein. Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. [Cellular processes, Pathogenesis].	6.61137e-85
NZ_CP022577.1\|WP_003419000.1\|4179338_4180460_-\|acyl-CoA/acyl-ACP-dehydrogenase	gnl\|CDD\|224871	COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism].	2.51968e-48
NZ_CP022577.1\|WP_003418993.1\|4181901_4182093_+\|ferredoxin	gnl\|CDD\|224064	COG1141, Fer, Ferredoxin [Energy production and conversion].	6.5974e-14
NZ_CP022577.1\|WP_003900082.1\|4148200_4149397_+\|steroid-C26-monooxygenase-Cyp142	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	1.72638e-107
NZ_CP022577.1\|WP_031650494.1\|4147461_4148172_-\|acetoacetate-decarboxylase-family-protein	gnl\|CDD\|377649	pfam06314, ADC, Acetoacetate decarboxylase (ADC). This family consists of several acetoacetate decarboxylase (ADC) proteins (EC:4.1.1.4).	9.37323e-27
NZ_CP022577.1\|WP_003900084.1\|4146353_4147397_+\|LLM-class-F420-dependent-oxidoreductase	gnl\|CDD\|274647	TIGR03559, F420_Rv3520c, probable F420-dependent oxidoreductase, Rv3520c family. Members of this protein family are predicted to be oxidoreductases dependent on coenzyme F420. The family includes a single member in Mycobacterium tuberculosis (Rv3520c/MT3621) but four in Mycobacterium smegmatis. Prediction that this family is F420-dependent is based primarily on Partial Phylogenetic Profiling vs. F420 biosynthesis. [Unknown function, Enzymes of unknown specificity].	0
NZ_CP022577.1\|WP_016330448.1\|4168284_4173147_-\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.63447e-28
NZ_CP022577.1\|WP_003906120.1\|4187201_4188275_+\|virulence-factor-Mce-family-protein	gnl\|CDD\|273384	TIGR00996, Mtu_fam_mce, virulence factor Mce family protein. Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. [Cellular processes, Pathogenesis].	1.64892e-87
NZ_CP022577.1\|WP_003419179.1\|4150386_4151178_-\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|181122	PRK07799, PRK07799, crotonase/enoyl-CoA hydratase family protein.	0
NZ_CP022577.1\|WP_003418986.1\|4183296_4184061_+\|ABC-transporter-permease	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	5.65389e-88

>NZ_CP022577.1|WP_016330448.1|4168284_4173147_-|PE-family-protein
MSFVLIAPEFVTAAAGDLTNLGSSISAANASAASATTQVLAAGADEVSARIAALFGGFGLEYQAISAQVAAYHQRFVQALSTGAGAYASAEAAAAEQIVLGVINAPTQALLGRPLIGDGANATTPGGAGGAGGLLFGNGGAGAAGAPGQAGGAGGPAGLWGNGGPGGAGGSGGGTGGAGGAGGWLFGVGGAGGVGGAGGGTGGAGGPGGLIWGGGGAGGVGGAGGGTGGAGGRAELLFGAGGAGGAGGAGTDGGPGATGGTGGHGGVGGDGGWLAPGGAGGAGGQGGAGGAGSDGGALGGTGGTGGTGGAGGAGGRGALLLGAGGQGGLGGAGGQGGTGGAGGDGVLGGVGGTGGKGGVGGVAGLGGAGGAAGQLFSAGGAAGAVGVGGTGGQGGAGGAGAAGADAPASTGLTGGTGFAGGAGGVGGQGGNAIAGGINGSGGAGGTGGQGGAGGMGGSGADNASGIGADGGAGGTGGNAGAGGAGGAAGTGGTGGVVGAAGKAGIGGTGGQGGAGGAGSAGTDATATGATGGTGFSGGAGGAGGAGGNTGVGGTNGSGGQGGTGGAGGAGGAGGVGADNPTGIGGTGGTGGKGGAGGAGGAGADATATGATGGTGFAGGAGGAGGQGGSSGAGGTNGSGGAGGTGGQGGAGGAGGAGADNPTGIGGAGGTGGTGGAAGAGGAGGAIGTGGTGGAVGSVGNAGIGGTGGTGGVGGAGGAGAAAAAGSSATGGAGFAGGAGGEGGAGGNSGVGGTNGSGGAGGAGGKGGTGGAGGSGADNPTGAGFAGGAGGTGGAAGAGGAGGATGTGGTGGVVGATGSAGIGGAGGRGGDGGDGASGLGLGLSGFDGGQGGQGGAGGSAGAGGINGAGGAGGNGGDGGDGATGAAGLGDNGGVGGDGGAGGAAGNGGNAGVGLTAKAGDGGAAGNGGNGGAGGAGGAGDNNFNGGQGGAGGQGGQGGLGGASTTSINANGGAGGNGGTGGKGGAGGAGTLGVGGSGGTGGDGGDAGAGGGGGFGGAAGKAGGGGNGGVGGDGGEGASGLGLGLSGFDGGQGGQGGAGGNAGAGGINGAGGTGGTGGAGGDGAPATLIGGPDGGDGGQGGIGGDGGNAGFGAGVPGDGGDGGNAGFGAGVPGDGGIGGTGGAGGAGGAGADGDPSIDGGQGGAGGHGGQGGKGGLNSTGLASAASGDGGNGGAGGAGGNGGDGDGFIGGSGGTGGTGGDAGVGGLANTGGTAGNAGIGGAGGRGGDGGAGDSGALSQDGNGFAGGQGGQGGAGGNAGAGGINGAGGTGGTGGAGGDGAPATLIGGPDGGDGGQGGIGGDGGNAGFGAGVPGDGGIGGTGGAGGAGGAGADGDPSIDGGQGRAGGHGGQGGKGGLNSTGLASAASGDGGNGGAGGAGGTGGTGGAGGDGQNGTTGVASEGGAGGQGGDGGDGGEGGGAGFGSGVAGAAGAGGNGGKGGDGGTGGTGGTNFAGGQGGAGGRGGAGGNGANGVGDNAAGGDGGNGGAGGLGGGGGTGGTNGNGGLGGGGGNGGAGGAGGTPTGSGTEGTGGDGGDAGAGGNGGSATGVGNGGNGGDGGNGGDGGNGAPGGFGGGAGAGGLGGSGAGGGTDGDDGNGGSPGTDGS
>NZ_CP022577.1|WP_003900872.1|4166570_4168118_+|acetolactate-synthase-large-subunit
MNGAQALINTLVDGGVDVCFANPGTSEMHFVAALDAVPRMRGMLTLFEGVATGAADGYARIAGRPAAVLLHLGPGLGNGLANLHNARRARVPMVVVVGDHATYHKKYDAPLESDIDAVAGTVSGWVRRTEAAADVGADAEAAIAASRSGSQIATLILPADVCWSDGAHAAAGVPAQAAAAPVDVGPVAGVLRSGEPAMMLIGGDATRGPGLTAAARIVQATGARWLCETFPTCLERGAGIPAVERLAYFAEGAAAQLDGVKHLVLAGARSPVSFFAYPGMPSDLVPAGCEVHVLAEPGGAADALAALADEVAPGTVAPVAGASRPQLPTGDLTSVSAADVVGALLPERAIVVDESNTCGVLLPQATAGAPAHDWLTLTGGAIGYGIPAAVGAAVAAPDRPVLCLESDGSAMYTISGLWSQARENLDVTTVIYNNGAYDILRIELQRVGAGSDPGPKALDLLDISRPTMDFVKIAEGMGVPARRVTTCEEFADALRAAFAEPGPHLIDVVVPSLVG
>NZ_CP022577.1|WP_003421145.1|4165737_4166574_+|amidohydrolase
MTIDVWMQHPTQRFLHGDMFASLRRWTGGSIPETDIPIEATVSSMDAGGVTLGLLSAWRGPNGQDLISNDAVAEWVRLYPNRFAGLAAVDLDRPMAAVRELRRRVGEGFVGLRVVPWLWGAPPTDRRYYPLFAECVQSAVPFCTQVGHTGPLRPSETGRPIPYIDQVALDFPELVIVCGHVGYPWTEEMVAVARKHENVYIDTSAYTIKRLPGKLVRFMKTDTGQRKVLFGTNYPMIAHTHALTGLDELGLSDEARRDFLHGNAVRVFKLDPRGKVQT
>NZ_CP022577.1|WP_003902513.1|4158170_4158827_+|fatty-acid--CoA-ligase
MAASLSENLSCHSSNMCRLSGNAATNLERPGEEPPGDRCTRRQAVRPARTLAKKGNIPVGYYKDEKKTAETFRTINGVRYAIPGDYAQVEEDGTVTMLGRGSVSINSGGEKVYPEEVEAALKGHPDVFDALVVGVPDPRYGQQVAAVVQARPGCRPSLAELDSFVRSEIAGYKVPRSLWFVDEVKRSPAGKPDYRWAKEQTEARPADDVHAGHVTSGS
>NZ_CP022577.1|WP_003911024.1|4151251_4152898_+|acyl-CoA-synthetase
MAVALNIADLAEHAIDAVPDRVAVICGDEQLTYAQLEDKANRLAHHLIDQGVQKYDKVGLYCRNRIEIVIAMLGIVKAGAILVNVNFRYVEGELRYLFDNSDMVALVHERRYADRVANVLPDTPHVRTILVVEDGSDQDYRRYGGVEFYSAIAAGSPERDFGERSADAIYLLYTGGTTGFPKGVMWRHEDIYRVLFGGTDFATGEFVKDEYDLAKAAAANPPMIRYPIPPMIHGATQSATWMALFSGQTTVLAPEFNADEVWRTIHKHKVNLLFFTGDAMARPLVDALVKGNDYDLSSLFLLASTAALFSPSIKEKLLELLPNRVITDSIGSSETGFGGTSVVAAGQAHGGGPRVRIDHRTVVLDDDGNEVKPGSGMRGVIAKKGNIPVGYYKDEKKTAETFRTINGVRYAIPGDYAQVEEDGTVTMLGRGSVSINSGGEKVYPEEVEAALKGHPDVFDALVVGVPDPRYGQQVAAVVQARPGCRPSLAELDSFVRSEIAGYKVPRSLWFVDEVKRSPAGKPDYRWAKEQTEARPADDVHAGHVTSGG
>NZ_CP022577.1|WP_003419179.1|4150386_4151178_-|crotonase/enoyl-CoA-hydratase-family-protein
MESGPDALVERRGHTLIVTMNRPAARNALSTEMMRIMVQAWDRVDNDPDIRCCILTGAGGYFCAGMDLKAATQKPPGDSFKDGSYDPSRIDALLKGRRLTKPLIAAVEGPAIAGGTEILQGTDIRVAGESAKFGISEAKWSLYPMGGSAVRLVRQIPYTLACDLLLTGRHITAAEAKEMGLIGHVVPDGQALTKALELADAISANGPLAVQAILRSIRETECMPENEAFKIDTQIGIKVFLSDDAKEGPRAFAEKRAPNFQNR
>NZ_CP022577.1|WP_003419184.1|4149451_4150291_-|hypothetical-protein
MIEPFLGSEAIASGALTRHRLRSAYATIHPDVYVSPGADLTAWSRAQAAWLWSRRRGVIAGQSAAAMHGAKWVDARQAAELLYDHRRPPAGIHTWSDRVADDEIQPISGMNTTTPARTALDLARRYPVGKAVAAIDALARATDLKLADVEMLAERYRGSRGIRNARIALDLVDPGAESPRETWLRLLLIRAGFPRPQTQIPVYDEYGQLVAVIDMGWAGIKVGVDYEGDHHRTDRRTFNKDIKRAEALTELGWTDVRVTVEDTEGGIIWRVSAAWQRRT
>NZ_CP022577.1|WP_003900082.1|4148200_4149397_+|steroid-C26-monooxygenase-Cyp142
MTEAPDVDLADGNFYASREARAAYRWMRANQPVFRDRNGLAAASTYQAVIDAERQPELFSNAGGIRPDQPALPMMIDMDDPAHLLRRKLVNAGFTRKRVKDKEASIAALCDTLIDAVCERGECDFVRDLAAPLPMAVIGDMLGVRPEQRDMFLRWSDDLVTFLSSHVSQEDFQITMDAFAAYNDFTRATIAARRADPTDDLVSVLVSSEVDGERLSDDELVMETLLILIGGDETTRHTLSGGTEQLLRNRDQWDLLQRDPSLLPGAIEEMLRWTAPVKNMCRVLTADTEFHGTALCAGEKMMLLFESANFDEAVFCEPEKFDVQRNPNSHLAFGFGTHFCLGNQLARLELSLMTERVLRRLPDLRLVADDSVLPLRPANFVSGLESMPVVFTPSPPLG
>NZ_CP022577.1|WP_031650494.1|4147461_4148172_-|acetoacetate-decarboxylase-family-protein
MPVSQHTIAGTVLTMPVRIRTGNLHSAMFSVPADPAQRLIDYSGLRVCEYLPGKAIVMQMLVRYVDGDLGRYHEYGTAIMVNPPGTQRRGPRALTRAAAFIHHLPVDQVFTLEAGRTIWGFPKIMADFNVTDGRRFGFDVSADGRLIAGIEFSTGLPVPTLGWQMLKTYSHHDGVTREIPWEMKVSGLRARLGGARLRLGDHPYAKELASLGLPKRALLSQSAANVEMTFGDGHPI
>NZ_CP022577.1|WP_003900084.1|4146353_4147397_+|LLM-class-F420-dependent-oxidoreductase
MEAGMKLGLQLGYWGAQPPQNHAELVAAAEDAGFDTVFTAEAWGSDAYTPLAWWGSSTQRVRLGTSVIQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQVVEGWYGQRFPKPLARTREYIDIVRQVWARESPVTSAGPHYRLPLTGEGTTGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIFYSPRMAGMYNEWLDEGFARPGARRSREDFEICATAQVVITDDRAAAFAGIKPFLALYMGGMGAEETNFHADVYRRMGYTQVVDEVTKLFRSGRKDEAAEIIPDELVDDAVIVGDIDHVRKQMAVWEAAGVTMMVVTAGSAEQVRDLAALV
>NZ_CP022577.1|WP_003901655.1|4177759_4179268_-|AMP-binding-protein
MTPTHPTVTELLLPLSEIDDRGVYFEDSFTSWRDHIRHGAAIAAALRERLDPARPPHVGVLLQNTPFFSATLVAGALSGIVPVGLNPVRRGAALAGDIAKADCQLVLTGSGSAEVPADVEHINVDSPEWTDEVAAHRDTEVRFRSADLADLFMLIFTSGTSGDPKAVKCSHRKVAIAGVTITQRFSLGRDDVCYVSMPLFHSNAVLVGWAVAAACQGSMALRRKFSASQFLADVRRYGATYANYVGKPLSYVLATPELPDDADNPLRAVYGNEGVPGDIDRFGRRFGCVVMDGFGSTEGGVAITRTLDTPAGALGPLPGGIQIVDPDTGEPCPTGVVGELVNTAGPGGFEGYYNDEAAEAERMAGGVYHSGDLAYRDDAGYAYFAGRLGDWMRVDGENLGTAPIERVLMRYPDATEVAVYPVPDPVVGDQVMAALVLAPGTKFDADKFRAFLTEQPDLGHKQWPSYVRVSAGLPRTMTFKVIKRQLSAEGVACADPVWPIRR
>NZ_CP022577.1|WP_003419000.1|4179338_4180460_-|acyl-CoA/acyl-ACP-dehydrogenase
MDFTTTEAAQDLGGLVDTIVDAVCTPEHQRELDKLEQRFDRELWRKLIDAGILSSAAPESLGGDGFGVLEQVAVLVALGHQLAAVPYLESVVLAAGALARFGSPELQQGWGVSAVSGDRILTVALDGEMGEGPVQAAGTGHGYRLTGTRTQVGYGPVADAFLVPAETDSGAAVFLVAAGDPGVAVTALATTGLGSVGHLELNGAKVDAARRVGGTDVAVWLGTLSTLSRTAFQLGVLERGLQMTAEYARTREQFDRPIGSFQAVGQRLADGYIDVKGLRLTLTQAAWRVAEDSLASRECPQPADIDVATAGFWAAEAGHRVAHTIVHVHGGVGVDTDHPVHRYFLAAKQTEFALGGATGQLRRIGRELAETPA
>NZ_CP022577.1|WP_003418997.1|4180484_4181687_-|acyl-CoA-dehydrogenase-family-protein
MRISYTPQQEELRRELRSYFATLMTPERREALSSVQGEYGVGNVYRETIAQMGRDGWLALGWPKEYGGQGRSAMDQLIFTDEAAIAGAPVPFLTINSVAPTIMAYGTDEQKRFFLPRIAAGDLHFSIGYSEPGAGTDLANLRTTAVRDGDDYVVNGQKMWTSLIQYADYVWLAVRTNPESSGAKKHRGISVLIVPTTAEGFSWTPVHTMAGPDTSATYYSDVRVPVANRVGEENAGWKLVTNQLNHERVALVSPAPIFGCLREVREWAQNTKDAGGTRLIDSEWVQLNLARVHAKAEVLKLINWELASSQSGPKDAGPSPADASAAKVFGTELATEAYRLLMEVLGTAATLRQNSPGALLRGRVERMHRACLILTFGGGTNEVQRDIIGMVALGLPRANR
>NZ_CP022577.1|WP_003418993.1|4181901_4182093_+|ferredoxin
MRVIVDRDRCEGNAVCLGIAPDIFDLDDEDYAVVKTDPIPVDQEDLAEQAIAECPRAALSRGE
>NZ_CP022577.1|WP_003418990.1|4182117_4183071_+|3-oxoacyl-ACP-reductase
MKLTESNRSPRTTNTTDLSGKVAVVTGAAAGLGRAEALGLARLGATVVVNDVASALDASDVVDEIGAAAADAGAKAVAVAGDISQRATADELLASAVGLGGLDIVVNNAGITRDRMLFNMSDEEWDAVIAVHLRGHFLLTRNAAAYWRDKAKDAEGGSVFGRLVNTSSEAGLVGPVGQANYAAAKAGITALTLSAARALGRYGVCANVICPRARTAMTADVFGAAPDVEAGQIDPLSPQHVVSLVQFLASPAAAEVNGQVFIVYGPQVTLVSPPHMERRFSADGTSWDPTELTATLRDYFAGRDPEQSFSATDLMRQ
>NZ_CP022577.1|WP_003418986.1|4183296_4184061_+|ABC-transporter-permease
MIQQLAVPARAVGGFFEMSMDTARAAFRRPFQFREFLDQTWMVARVSLVPTLLVSIPFTVLVAFTLNILLREIGAADLSGAGTAFGTITQLGPVVTVLVVAGAGATAICADLGARTIREEIDAMRVLGIDPIQRLVVPRVLASTLVALLLNGLVCAIGLSGGYAFSVFLQGVNPGAFINGLTVLTGLRELILAEIKALLFGVMAGLVGCYRGLTVKGGPKGVGNAVNETVVYAFICLFVINVVMTAIGVRISAQ
>NZ_CP022577.1|WP_003418983.1|4184095_4184938_+|ABC-transporter-permease
MSYDVTIRFRRFFSRLQRPVDNFGEQALFYGETMRYVPNAITRYRKETVRLVAEMTLGAGALVMIGGTVGVAAFLTLASGGVIAVQGYSSLGDIGIEALTGFLSAFLNVRVVAPVIAGIALAATIGAGATAQLGAMRVSEEIDAVECMAVHSVSYLVSTRLIAGLVAIIPLYSLSVLAAFFAARFTTVFVNGQSAGLYDHYFNTFLIPSDLLWSFMQAIAMSIAVMLVHTYYGYNASGGSVGVGVAVGQAVRTSLIVVVVITLFISLAVYGASGNFNLSG
>NZ_CP022577.1|WP_003418979.1|4184957_4186160_+|virulence-factor-Mce4A
MSGGGSRRTSVRVAAALLAGLMVGSAVLTYLSYTAAFTSTDTVTVSSPRAGLVMEKGAKVKYRGIQVGKVTDISYSGNQARLKLAIDSGEMGFIPSNATVRIAGNTIFGAKSVEFIPPKTPSPKPLSPNAHVAASQVQLEVNTLFQSLIDLLHKIDPLETNATLSALSEGLRGHGDDLGALLSGLNTLTRQANPKLPALQEDFRKAAVVANVYADAAGDLNTVFDNLPTINKTIVDQKDNLNDTLLATIGLSNNAYETLAPAEQNFIDAINRLRAPLKVTSDYSPVFGCLFKGIARGVKEFAPLIGVRKAGLFTSSSFVLGAPSYTYPESLPIVNASGGPNCRGLPDIPTKQTGGSFYRAPFLVTDNALIPYQPFTELQVDAPSTLQFLFNGAFAERDDF
>NZ_CP022577.1|WP_003418972.1|4186159_4187212_+|virulence-factor-Mce-family-protein
MAGSGVPSHRSMVIKVSVFAVVMLLVAAGLVVVFGDFRFGPTTVYHATFTDASRLKAGQKVRIAGVPVGSVKAVKLNPDHSIDVAFAIDRSYTLYSSTRAVIRYENLVGDRFLEITSGPGELRKLPPGGTINVAHTQPALDLDALLGGLRPVLKGFDADKINTITSAVIELLQGQGGPLANVLADTGAFSAALGARDQLIGEVITNLNAVLATVDAKSAQFSASVDQLQQLVSGLAKNRDPIAGAISPLASTTTDLTELLRNSRRPLQGILENARPLATELDNRKAEVNNDIEQLGEDYLRLSALGSYGAFFNIYFCSVTIKINGPAGSDILLPIGGQPDPSKGRCAFAK
>NZ_CP022577.1|WP_003906120.1|4187201_4188275_+|virulence-factor-Mce-family-protein
MLNRKPSSKHERDPLRTGIFGLVLVICVVLIAFGYSGLPFWPQGKTYDAYFTDAGGITPGNSVYVSGLKVGAVSAVSLAGNSAKVTFSVDRSIVVGDQSLAAIRTDTILGERSIAVSPAGSGKSTTIPLSRTTTPYTLNGVLQDLGRNANDLNRPQFEQALNVFTQALHDATPQVRGAVDGLTSLSRALNSRDEALQGLLAHAKSVTSVLSERAEQVNKLVEDGNQLFAALDARRAALSALISGIDDVAAQISGFVADNRKEFGPALSKLNLVLANLNERRDYITEALKRLPTYATTLGEVVGSGPGFNVNVYSVLPGPLVATVFDLVFQPGKLPDSLADYLRGFIQERWIIRPKSP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_14

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_14

4174655-4175334

Orphan

Consensus_repeat	Method
CGTTGCCGCCGTNGCCGCCGTTGCCNCCGTNNCCG	CRT

7 spacers

The CRISPR arrays of NZ_CP022577_14

>merge|NZ_CP022577|14|4174655-4175334|CRT
CTTTACCGCCGTCGCCGCCGTTGCCCCCGTCGCCGCCGATGCCCTGGCTGCCAGCGTTACCGCCGGTAGTGGGGCCGGGCGCCCCGGCGGGGCCGGGCGCGCCGCCGTTGCTTCCGGTGCCACCGTTGCCACCGGCCCCGCCGTTGGGTGTGGGCAAGCTGGTGGCCGGGACGAACTGGGCGCCGACGGTGCCGTGGGCGCCGTTACCGCCGTCACCGCCGTTGCCGCCGTTGCCGCCGTTGCCACCGTTGCCGCCGCTAAGGCCGGTGCCGCCGGTTCCGCCCGCACCGCCGCTACCCGCGGTGCCGGCGTTGCCGCCGTTGCCGCCGCTGCCGGAGGCGCCGCTGGTGGTATTGCCACCGAAGTCGCCGGAGCCGCCGTTTCCACCGGCGCCGGCGTTGCCGCCGTTGCCGCCGTCGCCGCCGTTGCCGGCTGGCGTGCCGGTGGCGCCGTCGCCGCCGGTGCCGCCCGCGCCGCCGCCACCGCCGTTGCCGCCGTCGCCGGCGTTGCCGCCGTTCCCGGGCACGGTGATGGTGGTGCCCTGTGCGCCGATGCCGCCGGCGCCACCCTTGCCGGCGTGTCCGCCGGACCCTCCGGTGCCTCCGGCGCCGCCACCGATCGGGGCACCGGATCCGCCGGTGCCGCCACTACCGCCCTGGCCGCCTTTGCCGCCGTCTCCG

>NZ_CP022577|14|8|4174655-4175334|CRT
CTTTACCGCCGTCGCCGCCGTTGCCCCCGTCGCCG	CCGATGCCCTGGCTGCCAGCGTTACCGCCGGTAGTGGGGCCGGGCGCCCCGGCGGGGCCGGGCGCGCCGC
CGTTGCTTCCGGTGCCACCGTTGCCACCGGCCCCG	CCGTTGGGTGTGGGCAAGCTGGTGGCCGGGACGAACTGGGCGCCGACGGTGCCGTGGGCGCCGTTACCGCCGTCACCGC
CGTTGCCGCCGTTGCCGCCGTTGCCACCGTTGCCG	CCGCTAAGGCCGGTGCCGCCGGTTCCGCCCGCACCGCCGCTACCCGCGGTGCCGG
CGTTGCCGCCGTTGCCGCCGCTGCCGGAGGCGCCG	CTGGTGGTATTGCCACCGAAGTCGCCGGAGCCGCCGTTTCCACCGGCGCCGG
CGTTGCCGCCGTTGCCGCCGTCGCCGCCGTTGCCG	GCTGGCGTGCCGGTGGCGCCGTCGCCGCCGGTGCCGCCCGCGCCGCCGCCACCGC
CGTTGCCGCCGTCGCCGGCGTTGCCGCCGTTCCCG	GGCACGGTGATGGTGGTGCCCTGTGCGC
CGATGCCGCCGGCGCCACCCTTGCCGGCGTGTCCG	CCGGACCCTCCGGTGCCTCCGGCGCCGCCACCGATCGGGGCACCGGATCCGCCGGTGCCGC
CACTACCGCCCTGGCCGCCTTTGCCGCCGTCTCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003418979.1\|4184957_4186160_+\|virulence-factor-Mce4A	unknown	unknown	gnl\|CDD\|273384
NZ_CP022577.1\|WP_003911024.1\|4151251_4152898_+\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|236100
NZ_CP022577.1\|WP_003421145.1\|4165737_4166574_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|225070
NZ_CP022577.1\|WP_003418983.1\|4184095_4184938_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223838
NZ_CP022577.1\|WP_003419184.1\|4149451_4150291_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003418972.1\|4186159_4187212_+\|virulence-factor-Mce-family-protein	unknown	unknown	gnl\|CDD\|273384
NZ_CP022577.1\|WP_003900872.1\|4166570_4168118_+\|acetolactate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|236063
NZ_CP022577.1\|WP_003418997.1\|4180484_4181687_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173841
NZ_CP022577.1\|WP_003901655.1\|4177759_4179268_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236120
NZ_CP022577.1\|WP_003902513.1\|4158170_4158827_+\|fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|236100
NZ_CP022577.1\|WP_003418990.1\|4182117_4183071_+\|3-oxoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|181120
NZ_CP022577.1\|WP_003419000.1\|4179338_4180460_-\|acyl-CoA/acyl-ACP-dehydrogenase	unknown	unknown	gnl\|CDD\|224871
NZ_CP022577.1\|WP_003418993.1\|4181901_4182093_+\|ferredoxin	unknown	unknown	gnl\|CDD\|224064
NZ_CP022577.1\|WP_003900082.1\|4148200_4149397_+\|steroid-C26-monooxygenase-Cyp142	unknown	unknown	gnl\|CDD\|225035
NZ_CP022577.1\|WP_031650494.1\|4147461_4148172_-\|acetoacetate-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|377649
NZ_CP022577.1\|WP_003900084.1\|4146353_4147397_+\|LLM-class-F420-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274647
NZ_CP022577.1\|WP_016330448.1\|4168284_4173147_-\|PE-family-protein	unknown	unknown	gnl\|CDD\|376422
NZ_CP022577.1\|WP_003906120.1\|4187201_4188275_+\|virulence-factor-Mce-family-protein	unknown	unknown	gnl\|CDD\|273384
NZ_CP022577.1\|WP_003419179.1\|4150386_4151178_-\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|181122
NZ_CP022577.1\|WP_003418986.1\|4183296_4184061_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223838

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003418979.1\|4184957_4186160_+\|virulence-factor-Mce4A	gnl\|CDD\|273384	TIGR00996, Mtu_fam_mce, virulence factor Mce family protein. Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. [Cellular processes, Pathogenesis].	3.82434e-84
NZ_CP022577.1\|WP_003911024.1\|4151251_4152898_+\|acyl-CoA-synthetase	gnl\|CDD\|236100	PRK07798, PRK07798, acyl-CoA synthetase; Validated.	0
NZ_CP022577.1\|WP_003421145.1\|4165737_4166574_+\|amidohydrolase	gnl\|CDD\|225070	COG2159, COG2159, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	2.24025e-81
NZ_CP022577.1\|WP_003418983.1\|4184095_4184938_+\|ABC-transporter-permease	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	9.90895e-74
NZ_CP022577.1\|WP_003902513.1\|4158170_4158827_+\|fatty-acid--CoA-ligase	gnl\|CDD\|236100	PRK07798, PRK07798, acyl-CoA synthetase; Validated.	8.05622e-104
NZ_CP022577.1\|WP_003900872.1\|4166570_4168118_+\|acetolactate-synthase-large-subunit	gnl\|CDD\|236063	PRK07586, PRK07586, acetolactate synthase large subunit.	0
NZ_CP022577.1\|WP_003418997.1\|4180484_4181687_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.72908e-173
NZ_CP022577.1\|WP_003901655.1\|4177759_4179268_-\|AMP-binding-protein	gnl\|CDD\|236120	PRK07867, PRK07867, acyl-CoA synthetase; Validated.	0
NZ_CP022577.1\|WP_003418990.1\|4182117_4183071_+\|3-oxoacyl-ACP-reductase	gnl\|CDD\|181120	PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	2.1253e-180
NZ_CP022577.1\|WP_003418972.1\|4186159_4187212_+\|virulence-factor-Mce-family-protein	gnl\|CDD\|273384	TIGR00996, Mtu_fam_mce, virulence factor Mce family protein. Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. [Cellular processes, Pathogenesis].	6.61137e-85
NZ_CP022577.1\|WP_003419000.1\|4179338_4180460_-\|acyl-CoA/acyl-ACP-dehydrogenase	gnl\|CDD\|224871	COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism].	2.51968e-48
NZ_CP022577.1\|WP_003418993.1\|4181901_4182093_+\|ferredoxin	gnl\|CDD\|224064	COG1141, Fer, Ferredoxin [Energy production and conversion].	6.5974e-14
NZ_CP022577.1\|WP_003900082.1\|4148200_4149397_+\|steroid-C26-monooxygenase-Cyp142	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	1.72638e-107
NZ_CP022577.1\|WP_031650494.1\|4147461_4148172_-\|acetoacetate-decarboxylase-family-protein	gnl\|CDD\|377649	pfam06314, ADC, Acetoacetate decarboxylase (ADC). This family consists of several acetoacetate decarboxylase (ADC) proteins (EC:4.1.1.4).	9.37323e-27
NZ_CP022577.1\|WP_003900084.1\|4146353_4147397_+\|LLM-class-F420-dependent-oxidoreductase	gnl\|CDD\|274647	TIGR03559, F420_Rv3520c, probable F420-dependent oxidoreductase, Rv3520c family. Members of this protein family are predicted to be oxidoreductases dependent on coenzyme F420. The family includes a single member in Mycobacterium tuberculosis (Rv3520c/MT3621) but four in Mycobacterium smegmatis. Prediction that this family is F420-dependent is based primarily on Partial Phylogenetic Profiling vs. F420 biosynthesis. [Unknown function, Enzymes of unknown specificity].	0
NZ_CP022577.1\|WP_016330448.1\|4168284_4173147_-\|PE-family-protein	gnl\|CDD\|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.63447e-28
NZ_CP022577.1\|WP_003906120.1\|4187201_4188275_+\|virulence-factor-Mce-family-protein	gnl\|CDD\|273384	TIGR00996, Mtu_fam_mce, virulence factor Mce family protein. Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. [Cellular processes, Pathogenesis].	1.64892e-87
NZ_CP022577.1\|WP_003419179.1\|4150386_4151178_-\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|181122	PRK07799, PRK07799, crotonase/enoyl-CoA hydratase family protein.	0
NZ_CP022577.1\|WP_003418986.1\|4183296_4184061_+\|ABC-transporter-permease	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	5.65389e-88

>NZ_CP022577.1|WP_016330448.1|4168284_4173147_-|PE-family-protein
MSFVLIAPEFVTAAAGDLTNLGSSISAANASAASATTQVLAAGADEVSARIAALFGGFGLEYQAISAQVAAYHQRFVQALSTGAGAYASAEAAAAEQIVLGVINAPTQALLGRPLIGDGANATTPGGAGGAGGLLFGNGGAGAAGAPGQAGGAGGPAGLWGNGGPGGAGGSGGGTGGAGGAGGWLFGVGGAGGVGGAGGGTGGAGGPGGLIWGGGGAGGVGGAGGGTGGAGGRAELLFGAGGAGGAGGAGTDGGPGATGGTGGHGGVGGDGGWLAPGGAGGAGGQGGAGGAGSDGGALGGTGGTGGTGGAGGAGGRGALLLGAGGQGGLGGAGGQGGTGGAGGDGVLGGVGGTGGKGGVGGVAGLGGAGGAAGQLFSAGGAAGAVGVGGTGGQGGAGGAGAAGADAPASTGLTGGTGFAGGAGGVGGQGGNAIAGGINGSGGAGGTGGQGGAGGMGGSGADNASGIGADGGAGGTGGNAGAGGAGGAAGTGGTGGVVGAAGKAGIGGTGGQGGAGGAGSAGTDATATGATGGTGFSGGAGGAGGAGGNTGVGGTNGSGGQGGTGGAGGAGGAGGVGADNPTGIGGTGGTGGKGGAGGAGGAGADATATGATGGTGFAGGAGGAGGQGGSSGAGGTNGSGGAGGTGGQGGAGGAGGAGADNPTGIGGAGGTGGTGGAAGAGGAGGAIGTGGTGGAVGSVGNAGIGGTGGTGGVGGAGGAGAAAAAGSSATGGAGFAGGAGGEGGAGGNSGVGGTNGSGGAGGAGGKGGTGGAGGSGADNPTGAGFAGGAGGTGGAAGAGGAGGATGTGGTGGVVGATGSAGIGGAGGRGGDGGDGASGLGLGLSGFDGGQGGQGGAGGSAGAGGINGAGGAGGNGGDGGDGATGAAGLGDNGGVGGDGGAGGAAGNGGNAGVGLTAKAGDGGAAGNGGNGGAGGAGGAGDNNFNGGQGGAGGQGGQGGLGGASTTSINANGGAGGNGGTGGKGGAGGAGTLGVGGSGGTGGDGGDAGAGGGGGFGGAAGKAGGGGNGGVGGDGGEGASGLGLGLSGFDGGQGGQGGAGGNAGAGGINGAGGTGGTGGAGGDGAPATLIGGPDGGDGGQGGIGGDGGNAGFGAGVPGDGGDGGNAGFGAGVPGDGGIGGTGGAGGAGGAGADGDPSIDGGQGGAGGHGGQGGKGGLNSTGLASAASGDGGNGGAGGAGGNGGDGDGFIGGSGGTGGTGGDAGVGGLANTGGTAGNAGIGGAGGRGGDGGAGDSGALSQDGNGFAGGQGGQGGAGGNAGAGGINGAGGTGGTGGAGGDGAPATLIGGPDGGDGGQGGIGGDGGNAGFGAGVPGDGGIGGTGGAGGAGGAGADGDPSIDGGQGRAGGHGGQGGKGGLNSTGLASAASGDGGNGGAGGAGGTGGTGGAGGDGQNGTTGVASEGGAGGQGGDGGDGGEGGGAGFGSGVAGAAGAGGNGGKGGDGGTGGTGGTNFAGGQGGAGGRGGAGGNGANGVGDNAAGGDGGNGGAGGLGGGGGTGGTNGNGGLGGGGGNGGAGGAGGTPTGSGTEGTGGDGGDAGAGGNGGSATGVGNGGNGGDGGNGGDGGNGAPGGFGGGAGAGGLGGSGAGGGTDGDDGNGGSPGTDGS
>NZ_CP022577.1|WP_003900872.1|4166570_4168118_+|acetolactate-synthase-large-subunit
MNGAQALINTLVDGGVDVCFANPGTSEMHFVAALDAVPRMRGMLTLFEGVATGAADGYARIAGRPAAVLLHLGPGLGNGLANLHNARRARVPMVVVVGDHATYHKKYDAPLESDIDAVAGTVSGWVRRTEAAADVGADAEAAIAASRSGSQIATLILPADVCWSDGAHAAAGVPAQAAAAPVDVGPVAGVLRSGEPAMMLIGGDATRGPGLTAAARIVQATGARWLCETFPTCLERGAGIPAVERLAYFAEGAAAQLDGVKHLVLAGARSPVSFFAYPGMPSDLVPAGCEVHVLAEPGGAADALAALADEVAPGTVAPVAGASRPQLPTGDLTSVSAADVVGALLPERAIVVDESNTCGVLLPQATAGAPAHDWLTLTGGAIGYGIPAAVGAAVAAPDRPVLCLESDGSAMYTISGLWSQARENLDVTTVIYNNGAYDILRIELQRVGAGSDPGPKALDLLDISRPTMDFVKIAEGMGVPARRVTTCEEFADALRAAFAEPGPHLIDVVVPSLVG
>NZ_CP022577.1|WP_003421145.1|4165737_4166574_+|amidohydrolase
MTIDVWMQHPTQRFLHGDMFASLRRWTGGSIPETDIPIEATVSSMDAGGVTLGLLSAWRGPNGQDLISNDAVAEWVRLYPNRFAGLAAVDLDRPMAAVRELRRRVGEGFVGLRVVPWLWGAPPTDRRYYPLFAECVQSAVPFCTQVGHTGPLRPSETGRPIPYIDQVALDFPELVIVCGHVGYPWTEEMVAVARKHENVYIDTSAYTIKRLPGKLVRFMKTDTGQRKVLFGTNYPMIAHTHALTGLDELGLSDEARRDFLHGNAVRVFKLDPRGKVQT
>NZ_CP022577.1|WP_003902513.1|4158170_4158827_+|fatty-acid--CoA-ligase
MAASLSENLSCHSSNMCRLSGNAATNLERPGEEPPGDRCTRRQAVRPARTLAKKGNIPVGYYKDEKKTAETFRTINGVRYAIPGDYAQVEEDGTVTMLGRGSVSINSGGEKVYPEEVEAALKGHPDVFDALVVGVPDPRYGQQVAAVVQARPGCRPSLAELDSFVRSEIAGYKVPRSLWFVDEVKRSPAGKPDYRWAKEQTEARPADDVHAGHVTSGS
>NZ_CP022577.1|WP_003911024.1|4151251_4152898_+|acyl-CoA-synthetase
MAVALNIADLAEHAIDAVPDRVAVICGDEQLTYAQLEDKANRLAHHLIDQGVQKYDKVGLYCRNRIEIVIAMLGIVKAGAILVNVNFRYVEGELRYLFDNSDMVALVHERRYADRVANVLPDTPHVRTILVVEDGSDQDYRRYGGVEFYSAIAAGSPERDFGERSADAIYLLYTGGTTGFPKGVMWRHEDIYRVLFGGTDFATGEFVKDEYDLAKAAAANPPMIRYPIPPMIHGATQSATWMALFSGQTTVLAPEFNADEVWRTIHKHKVNLLFFTGDAMARPLVDALVKGNDYDLSSLFLLASTAALFSPSIKEKLLELLPNRVITDSIGSSETGFGGTSVVAAGQAHGGGPRVRIDHRTVVLDDDGNEVKPGSGMRGVIAKKGNIPVGYYKDEKKTAETFRTINGVRYAIPGDYAQVEEDGTVTMLGRGSVSINSGGEKVYPEEVEAALKGHPDVFDALVVGVPDPRYGQQVAAVVQARPGCRPSLAELDSFVRSEIAGYKVPRSLWFVDEVKRSPAGKPDYRWAKEQTEARPADDVHAGHVTSGG
>NZ_CP022577.1|WP_003419179.1|4150386_4151178_-|crotonase/enoyl-CoA-hydratase-family-protein
MESGPDALVERRGHTLIVTMNRPAARNALSTEMMRIMVQAWDRVDNDPDIRCCILTGAGGYFCAGMDLKAATQKPPGDSFKDGSYDPSRIDALLKGRRLTKPLIAAVEGPAIAGGTEILQGTDIRVAGESAKFGISEAKWSLYPMGGSAVRLVRQIPYTLACDLLLTGRHITAAEAKEMGLIGHVVPDGQALTKALELADAISANGPLAVQAILRSIRETECMPENEAFKIDTQIGIKVFLSDDAKEGPRAFAEKRAPNFQNR
>NZ_CP022577.1|WP_003419184.1|4149451_4150291_-|hypothetical-protein
MIEPFLGSEAIASGALTRHRLRSAYATIHPDVYVSPGADLTAWSRAQAAWLWSRRRGVIAGQSAAAMHGAKWVDARQAAELLYDHRRPPAGIHTWSDRVADDEIQPISGMNTTTPARTALDLARRYPVGKAVAAIDALARATDLKLADVEMLAERYRGSRGIRNARIALDLVDPGAESPRETWLRLLLIRAGFPRPQTQIPVYDEYGQLVAVIDMGWAGIKVGVDYEGDHHRTDRRTFNKDIKRAEALTELGWTDVRVTVEDTEGGIIWRVSAAWQRRT
>NZ_CP022577.1|WP_003900082.1|4148200_4149397_+|steroid-C26-monooxygenase-Cyp142
MTEAPDVDLADGNFYASREARAAYRWMRANQPVFRDRNGLAAASTYQAVIDAERQPELFSNAGGIRPDQPALPMMIDMDDPAHLLRRKLVNAGFTRKRVKDKEASIAALCDTLIDAVCERGECDFVRDLAAPLPMAVIGDMLGVRPEQRDMFLRWSDDLVTFLSSHVSQEDFQITMDAFAAYNDFTRATIAARRADPTDDLVSVLVSSEVDGERLSDDELVMETLLILIGGDETTRHTLSGGTEQLLRNRDQWDLLQRDPSLLPGAIEEMLRWTAPVKNMCRVLTADTEFHGTALCAGEKMMLLFESANFDEAVFCEPEKFDVQRNPNSHLAFGFGTHFCLGNQLARLELSLMTERVLRRLPDLRLVADDSVLPLRPANFVSGLESMPVVFTPSPPLG
>NZ_CP022577.1|WP_031650494.1|4147461_4148172_-|acetoacetate-decarboxylase-family-protein
MPVSQHTIAGTVLTMPVRIRTGNLHSAMFSVPADPAQRLIDYSGLRVCEYLPGKAIVMQMLVRYVDGDLGRYHEYGTAIMVNPPGTQRRGPRALTRAAAFIHHLPVDQVFTLEAGRTIWGFPKIMADFNVTDGRRFGFDVSADGRLIAGIEFSTGLPVPTLGWQMLKTYSHHDGVTREIPWEMKVSGLRARLGGARLRLGDHPYAKELASLGLPKRALLSQSAANVEMTFGDGHPI
>NZ_CP022577.1|WP_003900084.1|4146353_4147397_+|LLM-class-F420-dependent-oxidoreductase
MEAGMKLGLQLGYWGAQPPQNHAELVAAAEDAGFDTVFTAEAWGSDAYTPLAWWGSSTQRVRLGTSVIQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQVVEGWYGQRFPKPLARTREYIDIVRQVWARESPVTSAGPHYRLPLTGEGTTGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIFYSPRMAGMYNEWLDEGFARPGARRSREDFEICATAQVVITDDRAAAFAGIKPFLALYMGGMGAEETNFHADVYRRMGYTQVVDEVTKLFRSGRKDEAAEIIPDELVDDAVIVGDIDHVRKQMAVWEAAGVTMMVVTAGSAEQVRDLAALV
>NZ_CP022577.1|WP_003901655.1|4177759_4179268_-|AMP-binding-protein
MTPTHPTVTELLLPLSEIDDRGVYFEDSFTSWRDHIRHGAAIAAALRERLDPARPPHVGVLLQNTPFFSATLVAGALSGIVPVGLNPVRRGAALAGDIAKADCQLVLTGSGSAEVPADVEHINVDSPEWTDEVAAHRDTEVRFRSADLADLFMLIFTSGTSGDPKAVKCSHRKVAIAGVTITQRFSLGRDDVCYVSMPLFHSNAVLVGWAVAAACQGSMALRRKFSASQFLADVRRYGATYANYVGKPLSYVLATPELPDDADNPLRAVYGNEGVPGDIDRFGRRFGCVVMDGFGSTEGGVAITRTLDTPAGALGPLPGGIQIVDPDTGEPCPTGVVGELVNTAGPGGFEGYYNDEAAEAERMAGGVYHSGDLAYRDDAGYAYFAGRLGDWMRVDGENLGTAPIERVLMRYPDATEVAVYPVPDPVVGDQVMAALVLAPGTKFDADKFRAFLTEQPDLGHKQWPSYVRVSAGLPRTMTFKVIKRQLSAEGVACADPVWPIRR
>NZ_CP022577.1|WP_003419000.1|4179338_4180460_-|acyl-CoA/acyl-ACP-dehydrogenase
MDFTTTEAAQDLGGLVDTIVDAVCTPEHQRELDKLEQRFDRELWRKLIDAGILSSAAPESLGGDGFGVLEQVAVLVALGHQLAAVPYLESVVLAAGALARFGSPELQQGWGVSAVSGDRILTVALDGEMGEGPVQAAGTGHGYRLTGTRTQVGYGPVADAFLVPAETDSGAAVFLVAAGDPGVAVTALATTGLGSVGHLELNGAKVDAARRVGGTDVAVWLGTLSTLSRTAFQLGVLERGLQMTAEYARTREQFDRPIGSFQAVGQRLADGYIDVKGLRLTLTQAAWRVAEDSLASRECPQPADIDVATAGFWAAEAGHRVAHTIVHVHGGVGVDTDHPVHRYFLAAKQTEFALGGATGQLRRIGRELAETPA
>NZ_CP022577.1|WP_003418997.1|4180484_4181687_-|acyl-CoA-dehydrogenase-family-protein
MRISYTPQQEELRRELRSYFATLMTPERREALSSVQGEYGVGNVYRETIAQMGRDGWLALGWPKEYGGQGRSAMDQLIFTDEAAIAGAPVPFLTINSVAPTIMAYGTDEQKRFFLPRIAAGDLHFSIGYSEPGAGTDLANLRTTAVRDGDDYVVNGQKMWTSLIQYADYVWLAVRTNPESSGAKKHRGISVLIVPTTAEGFSWTPVHTMAGPDTSATYYSDVRVPVANRVGEENAGWKLVTNQLNHERVALVSPAPIFGCLREVREWAQNTKDAGGTRLIDSEWVQLNLARVHAKAEVLKLINWELASSQSGPKDAGPSPADASAAKVFGTELATEAYRLLMEVLGTAATLRQNSPGALLRGRVERMHRACLILTFGGGTNEVQRDIIGMVALGLPRANR
>NZ_CP022577.1|WP_003418993.1|4181901_4182093_+|ferredoxin
MRVIVDRDRCEGNAVCLGIAPDIFDLDDEDYAVVKTDPIPVDQEDLAEQAIAECPRAALSRGE
>NZ_CP022577.1|WP_003418990.1|4182117_4183071_+|3-oxoacyl-ACP-reductase
MKLTESNRSPRTTNTTDLSGKVAVVTGAAAGLGRAEALGLARLGATVVVNDVASALDASDVVDEIGAAAADAGAKAVAVAGDISQRATADELLASAVGLGGLDIVVNNAGITRDRMLFNMSDEEWDAVIAVHLRGHFLLTRNAAAYWRDKAKDAEGGSVFGRLVNTSSEAGLVGPVGQANYAAAKAGITALTLSAARALGRYGVCANVICPRARTAMTADVFGAAPDVEAGQIDPLSPQHVVSLVQFLASPAAAEVNGQVFIVYGPQVTLVSPPHMERRFSADGTSWDPTELTATLRDYFAGRDPEQSFSATDLMRQ
>NZ_CP022577.1|WP_003418986.1|4183296_4184061_+|ABC-transporter-permease
MIQQLAVPARAVGGFFEMSMDTARAAFRRPFQFREFLDQTWMVARVSLVPTLLVSIPFTVLVAFTLNILLREIGAADLSGAGTAFGTITQLGPVVTVLVVAGAGATAICADLGARTIREEIDAMRVLGIDPIQRLVVPRVLASTLVALLLNGLVCAIGLSGGYAFSVFLQGVNPGAFINGLTVLTGLRELILAEIKALLFGVMAGLVGCYRGLTVKGGPKGVGNAVNETVVYAFICLFVINVVMTAIGVRISAQ
>NZ_CP022577.1|WP_003418983.1|4184095_4184938_+|ABC-transporter-permease
MSYDVTIRFRRFFSRLQRPVDNFGEQALFYGETMRYVPNAITRYRKETVRLVAEMTLGAGALVMIGGTVGVAAFLTLASGGVIAVQGYSSLGDIGIEALTGFLSAFLNVRVVAPVIAGIALAATIGAGATAQLGAMRVSEEIDAVECMAVHSVSYLVSTRLIAGLVAIIPLYSLSVLAAFFAARFTTVFVNGQSAGLYDHYFNTFLIPSDLLWSFMQAIAMSIAVMLVHTYYGYNASGGSVGVGVAVGQAVRTSLIVVVVITLFISLAVYGASGNFNLSG
>NZ_CP022577.1|WP_003418979.1|4184957_4186160_+|virulence-factor-Mce4A
MSGGGSRRTSVRVAAALLAGLMVGSAVLTYLSYTAAFTSTDTVTVSSPRAGLVMEKGAKVKYRGIQVGKVTDISYSGNQARLKLAIDSGEMGFIPSNATVRIAGNTIFGAKSVEFIPPKTPSPKPLSPNAHVAASQVQLEVNTLFQSLIDLLHKIDPLETNATLSALSEGLRGHGDDLGALLSGLNTLTRQANPKLPALQEDFRKAAVVANVYADAAGDLNTVFDNLPTINKTIVDQKDNLNDTLLATIGLSNNAYETLAPAEQNFIDAINRLRAPLKVTSDYSPVFGCLFKGIARGVKEFAPLIGVRKAGLFTSSSFVLGAPSYTYPESLPIVNASGGPNCRGLPDIPTKQTGGSFYRAPFLVTDNALIPYQPFTELQVDAPSTLQFLFNGAFAERDDF
>NZ_CP022577.1|WP_003418972.1|4186159_4187212_+|virulence-factor-Mce-family-protein
MAGSGVPSHRSMVIKVSVFAVVMLLVAAGLVVVFGDFRFGPTTVYHATFTDASRLKAGQKVRIAGVPVGSVKAVKLNPDHSIDVAFAIDRSYTLYSSTRAVIRYENLVGDRFLEITSGPGELRKLPPGGTINVAHTQPALDLDALLGGLRPVLKGFDADKINTITSAVIELLQGQGGPLANVLADTGAFSAALGARDQLIGEVITNLNAVLATVDAKSAQFSASVDQLQQLVSGLAKNRDPIAGAISPLASTTTDLTELLRNSRRPLQGILENARPLATELDNRKAEVNNDIEQLGEDYLRLSALGSYGAFFNIYFCSVTIKINGPAGSDILLPIGGQPDPSKGRCAFAK
>NZ_CP022577.1|WP_003906120.1|4187201_4188275_+|virulence-factor-Mce-family-protein
MLNRKPSSKHERDPLRTGIFGLVLVICVVLIAFGYSGLPFWPQGKTYDAYFTDAGGITPGNSVYVSGLKVGAVSAVSLAGNSAKVTFSVDRSIVVGDQSLAAIRTDTILGERSIAVSPAGSGKSTTIPLSRTTTPYTLNGVLQDLGRNANDLNRPQFEQALNVFTQALHDATPQVRGAVDGLTSLSRALNSRDEALQGLLAHAKSVTSVLSERAEQVNKLVEDGNQLFAALDARRAALSALISGIDDVAAQISGFVADNRKEFGPALSKLNLVLANLNERRDYITEALKRLPTYATTLGEVVGSGPGFNVNVYSVLPGPLVATVFDLVFQPGKLPDSLADYLRGFIQERWIIRPKSP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_15

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_15

4303639-4304907

Orphan

Consensus_repeat	Method
CCGCCGNCNCCGCCGNTGCCG	CRT

20 spacers

The CRISPR arrays of NZ_CP022577_15

>merge|NZ_CP022577|15|4303639-4304907|CRT
CCGCCGGCCCCGGCGTTGCCGCTTAGCAAGCCGCCATTCCCGCCGTTGCCGCCGTCCCCGCCGGTGCCGGCGATCGCGTCGGCCCTTCTGCCGGCGGTGTTCCCGCCGGCGCCGCCGTCCCCGCCGTGGCCGCCGGCTCCGATCAGCCGGGCGCTCCCGCCGGCCCCGCCGTGGCCGGCGGCGCCGCCGTCGCTGCCATTGCCGCCGGCGATGTTGGCCCCGCCGGCCCCGCCGTTGCCGCCGTCCCCGCCGTTGCCGTACAGCTGACCACCGGCCCCGCCGGCGCCGCCGTTCCCGCCGGCCCCGCCGTTGCCCACGCCACCGGTTTGGTTTCCGCCGGCGCCGCCGGCCCCGCCGTGGCCGCCGGCGCCGATCAGCCCGGCGTTTCCGCCGGTCCCGCCGCTAGCCCCGACACCACCGGTGCCGGCGCTGGTATTGTTGCCGCCGTTGCCGCCGGCCCCGGCGGCCCCGCCGTTGCCGTACAGCCACGCTCCAGAGCCGCCGGCTCCGCCGGTACCGCCGGTGCCGCCGGTGGCACCACCGGCGTTGTTGAGCCCGCCGGCGCCGCCGGCACCGCCGGCGCCGCCGCTGCCGTAGAGCCACCCGGCCGCCCCGCCGGCCCCGCCGGTCCCTCCGGTGCCCCCGGTGAGGGTGGCGCCACCGCTGGAATTCTTCCCGCCGGCCCCGCCGGTCCCGCCGGCGCCGCCATCGCCGACCAGGTACCCGCCGCCGCCACCGGCGCCGCCCGCGCCGCCGTTGCTGGCGGCCGGGCCGGTCTCGGTGTTTTGCCCGCCGATGCCGCCGGTCCCGCCGGTCCCGCCGGCGCCGAACAGCCCGGCGTGCCCACCGGCCCCGCCGGCGCCGCCGACCGAAGAGGTCAAGCTGTTAAAGCCGCTGCCGCCGTTGCCGCCGGTGCCGCCGGCCCCGCCGTCGCCGAACAACCAGCCGCCGTCACCGCCGGCTCCGCCGGCCCCGCCGGTGCCCCACAGCCAGGCCCGGCCGCCGGCCCCGCCGGCCCCGCCGTGACCACCGGTTCCGGTGCCCGCGCCCCCGATGCCGCCGGCCCCGCCGTTGCCGTACAGCCACCCGCCGTTGCCGCCGAGGCCGCCGGCGGCGCCGGCCCCGCCGTTGCCGATCAACCCCGCGCTGCCGCCGTTGCCGCCGGCCACCCCGGCGGTCGTCTGGGTAAAGCCGTTGCCGCCGTTGCCGAACAGCAGGCCGCCGTTTTGGCCGTCCGGGTTCTCCGCGGTCCCGTTGGCGCCGTCGCCG

>NZ_CP022577|15|9|4303639-4304907|CRT
CCGCCGGCCCCGGCGTTGCCG	CTTAGCAAGCCGCCATTCCCGCCGTTG
CCGCCGTCCCCGCCGGTGCCG	GCGATCGCGTCGGCCCTTCTGCCGGCGGTGTTCCCGCCGGCG
CCGCCGTCCCCGCCGTGGCCG	CCGGCTCCGATCAGCCGGGCGCTCCCGCCGGCCCCGCCGTGGCCGGCGGCG
CCGCCGTCGCTGCCATTGCCG	CCGGCGATGTTGGCCCCGCCGGCCCCGCCGTTG
CCGCCGTCCCCGCCGTTGCCG	TACAGCTGACCACCGGCCCCGCCGGCGCCGCCGTTC
CCGCCGGCCCCGCCGTTGCCC	ACGCCACCGGTTTGGTTTCCGCCGGCG
CCGCCGGCCCCGCCGTGGCCG	CCGGCGCCGATCAGCCCGGCGTTT
CCGCCGGTCCCGCCGCTAGCC	CCGACACCACCGGTGCCGGCGCTGGTATTGTTGCCGCCGTTGCCGCCGGCC
CCGGCGGCCCCGCCGTTGCCG	TACAGCCACGCTCCAGAGCCGCCGGCT
CCGCCGGTACCGCCGGTGCCG	CCGGTGGCACCACCGGCGTTGTTGAGCCCGCCGGCG
CCGCCGGCACCGCCGGCGCCG	CCGCTGCCGTAGAGCCACCCGGCCGCC
CCGCCGGCCCCGCCGGTCCCT	CCGGTGCCCCCGGTGAGGGTGGCGCCACCGCTGGAATTCTTC
CCGCCGGCCCCGCCGGTCCCG	CCGGCGCCGCCATCGCCGACCAGGTAC
CCGCCGCCGCCACCGGCGCCG	CCCGCGCCGCCGTTGCTGGCGGCCGGGCCGGTCTCGGTGTTTTGCCCGCCGATGCCGCCGGTC
CCGCCGGTCCCGCCGGCGCCG	AACAGCCCGGCGTGCCCACCGGCCCCGCCGGCGCCGCCGACCGAAGAGGTCAAGCTGTTAAAGCCGCTG
CCGCCGTTGCCGCCGGTGCCG	CCGGCCCCGCCGTCGCCGAACAACCAGCCGCCGTCACCGCCGGCT
CCGCCGGCCCCGCCGGTGCCC	CACAGCCAGGCCCGGCCGCCGGCCCCGCCGGCCCCGCCGTGACCACCGGTTCCGGTGCCCGCGCCCCCGATG
CCGCCGGCCCCGCCGTTGCCG	TACAGCCACCCGCCGTTGCCGCCGAGGCCGCCGGCG
GCGCCGGCCCCGCCGTTGCCG	ATCAACCCCGCGCTGCCGCCGTTGCCGCCGGCCACCCCGGCGGTCGTCTGGGTA
AAGCCGTTGCCGCCGTTGCCG	AACAGCAGGCCGCCGTTTTGGCCGTCCGGGTTCTCCGCG
GTCCCGTTGGCGCCGTCGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003417912.1\|4310827_4311817_+\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	unknown	unknown	gnl\|CDD\|234893
NZ_CP022577.1\|WP_003417952.1\|4292846_4294424_+\|glutamine-hydrolyzing-GMP-synthase	unknown	unknown	gnl\|CDD\|234614
NZ_CP022577.1\|WP_087902221.1\|4309124_4310386_-\|IS3-like-element-IS987-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP022577.1\|WP_003918607.1\|4311813_4313652_+\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|183601
NZ_CP022577.1\|WP_016810333.1\|4294579_4295290_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003417918.1\|4306963_4307272_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|226603
NZ_CP022577.1\|WP_003900043.1\|4295288_4295903_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003417954.1\|4291926_4292835_+\|presqualene-diphosphate-synthase-HpnD	unknown	unknown	gnl\|CDD\|163278
NZ_CP022577.1\|WP_003900041.1\|4298487_4299351_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|367049
NZ_CP022577.1\|WP_003906098.1\|4302133_4303006_+\|3-hydroxyacyl-thioester-dehydratase-HtdY	unknown	unknown	gnl\|CDD\|178455
NZ_CP022577.1\|WP_003417946.1\|4297537_4298464_-\|nucleoside-hydrolase-IunH	unknown	unknown	gnl\|CDD\|239119
NZ_CP022577.1\|WP_003417940.1\|4299351_4301304_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235962
NZ_CP022577.1\|WP_003417903.1\|4316099_4316753_-\|HAD-family-phosphatase	unknown	unknown	gnl\|CDD\|319790
NZ_CP022577.1\|WP_003417900.1\|4316860_4318288_-\|amidase	unknown	unknown	gnl\|CDD\|223232
NZ_CP022577.1\|WP_003417905.1\|4314555_4316061_+\|type-B-diterpene-cyclase	unknown	unknown	gnl\|CDD\|215321
NZ_CP022577.1\|WP_003417916.1\|4307271_4307664_+\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|350222
NZ_CP022577.1\|WP_003417908.1\|4313660_4314551_+\|diterpene-synthase	unknown	unknown	unknown
NZ_CP022577.1\|WP_003900042.1\|4295899_4297483_+\|DNA-polymerase-Y-family-protein	unknown	unknown	gnl\|CDD\|176458
NZ_CP022577.1\|WP_003417897.1\|4318292_4318541_-\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|180424
NZ_CP022577.1\|WP_003417932.1\|4301349_4302060_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|223483

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003417912.1\|4310827_4311817_+\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	gnl\|CDD\|234893	PRK01045, ispH, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed.	5.21815e-150
NZ_CP022577.1\|WP_003417952.1\|4292846_4294424_+\|glutamine-hydrolyzing-GMP-synthase	gnl\|CDD\|234614	PRK00074, guaA, GMP synthase; Reviewed.	0
NZ_CP022577.1\|WP_003918607.1\|4311813_4313652_+\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|183601	PRK12571, PRK12571, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional.	0
NZ_CP022577.1\|WP_003900042.1\|4295899_4297483_+\|DNA-polymerase-Y-family-protein	gnl\|CDD\|176458	cd03468, PolY_like, DNA Polymerase Y-family. Y-family DNA polymerases are a specialized subset of polymerases that facilitate translesion synthesis (TLS), a process that allows the bypass of a variety of DNA lesions. Unlike replicative polymerases, TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. The active sites of TLS polymerases are large and flexible to allow the accomodation of distorted bases. Expression of Y-family polymerases is often induced by DNA damage and is believed to be highly regulated. TLS is likely induced by the monoubiquitination of the replication clamp PCNA, which provides a scaffold for TLS polymerases to bind in order to access the lesion. Because of their high error rates, TLS polymerases are potential targets for cancer treatment and prevention.	6.31233e-43
NZ_CP022577.1\|WP_003417918.1\|4306963_4307272_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|226603	COG4118, Phd, Antitoxin of toxin-antitoxin stability system [Cell division and chromosome partitioning].	3.83621e-16
NZ_CP022577.1\|WP_003417954.1\|4291926_4292835_+\|presqualene-diphosphate-synthase-HpnD	gnl\|CDD\|163278	TIGR03465, HpnD, squalene synthase HpnD. The genes of this family are often found in the same genetic locus with squalene-hopene cyclase genes, and are never associated with genes for the metabolism of phytoene. In the organisms Zymomonas mobilis and Bradyrhizobium japonicum these genes have been characterized as squalene synthases (farnesyl-pyrophosphate ligases). Often, these genes appear in tandem with the HpnC gene which appears to have resulted from an ancient gene duplication event. Presumably these proteins form a heteromeric complex, but this has not yet been experimentally demonstrated.	3.21007e-104
NZ_CP022577.1\|WP_003900041.1\|4298487_4299351_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|367049	pfam02353, CMAS, Mycolic acid cyclopropane synthetase. This family consist of Cyclopropane-fatty-acyl-phospholipid synthase or CFA synthase EC:2.1.1.79 this enzyme catalyze the reaction: S-adenosyl-L-methionine + phospholipid olefinic fatty acid <=> S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid.	1.29364e-176
NZ_CP022577.1\|WP_003906098.1\|4302133_4303006_+\|3-hydroxyacyl-thioester-dehydratase-HtdY	gnl\|CDD\|178455	PLN02864, PLN02864, enoyl-CoA hydratase.	7.82411e-60
NZ_CP022577.1\|WP_003417946.1\|4297537_4298464_-\|nucleoside-hydrolase-IunH	gnl\|CDD\|239119	cd02653, nuc_hydro_3, NH_3: A subgroup of nucleoside hydrolases. This group contains eukaryotic and bacterial proteins similar to nucleoside hydrolases. Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity. .	3.23333e-150
NZ_CP022577.1\|WP_003417940.1\|4299351_4301304_-\|SDR-family-oxidoreductase	gnl\|CDD\|235962	PRK07201, PRK07201, SDR family oxidoreductase.	0
NZ_CP022577.1\|WP_003417900.1\|4316860_4318288_-\|amidase	gnl\|CDD\|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	1.97056e-152
NZ_CP022577.1\|WP_003417905.1\|4314555_4316061_+\|type-B-diterpene-cyclase	gnl\|CDD\|215321	PLN02592, PLN02592, ent-copalyl diphosphate synthase.	6.6629e-36
NZ_CP022577.1\|WP_003417916.1\|4307271_4307664_+\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|350222	cd09874, PIN_MT3492-like, VapC-like PIN domain of the hypothetical protein MT3492 of Mycobacterium tuberculosis CDC1551 and other uncharacterized, annotated PilT protein domain proteins. Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis CDC1551, hypothetical protein MT3492, and similar bacterial and archaeal proteins are included in this subfamily. They are PIN domain homologs of the Mycobacterium tuberculosis VapC and Neisseria gonorrhoeae FitB toxins of the prokaryotic toxin/antitoxin operons, VapBC and FitAB, respectively, which are believed to be involved in growth inhibition by regulating translation. These toxins are nearly always co-expressed with an antitoxin, a cognate protein inhibitor, forming an inert protein complex. Disassociation of the protein complex activates the ribonuclease activity of the toxin by an, as yet undefined mechanism. The PIN domain belongs to a large nuclease superfamily. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	1.15461e-24
NZ_CP022577.1\|WP_003417903.1\|4316099_4316753_-\|HAD-family-phosphatase	gnl\|CDD\|319790	cd02603, HAD_sEH-N_like, N-terminal lipase phosphatase domain of human soluble epoxide hydrolase, Escherichia coli YihX/HAD4 alpha-D-glucose 1-phosphate phosphatase, and related domains, may be inactive. This family includes the N-terminal phosphatase domain of human soluble epoxide hydrolase (sEH). sEH is a bifunctional enzyme with two distinct enzyme activities, the C-terminal domain has epoxide hydrolysis activity and the N-terminal domain (Ntermphos), which belongs to this family, has lipid phosphatase activity. The latter prefers mono-phosphate esters, and lysophosphatidic acids (LPAs) are the best natural substrates found to date. In addition this family includes Gallus gallus sEH and Xenopus sEH which appears to lack phosphatase activity, and Escherichia coli YihX/HAD4 which selectively hydrolyzes alpha-Glucose-1-P, phosphatase, has significant phosphatase activity against pyridoxal phosphate, and has low beta phosphoglucomutase activity. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.80545e-41
NZ_CP022577.1\|WP_087902221.1\|4309124_4310386_-\|IS3-like-element-IS987-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	4.28492e-102
NZ_CP022577.1\|WP_003417897.1\|4318292_4318541_-\|enoyl-CoA-hydratase	gnl\|CDD\|180424	PRK06144, PRK06144, enoyl-CoA hydratase; Provisional.	8.15675e-07
NZ_CP022577.1\|WP_003417932.1\|4301349_4302060_-\|histidine-phosphatase-family-protein	gnl\|CDD\|223483	COG0406, phoE, Broad specificity phosphatase PhoE and related phosphatases [General function prediction only].	1.48926e-26

>NZ_CP022577.1|WP_003906098.1|4302133_4303006_+|3-hydroxyacyl-thioester-dehydratase-HtdY
MAIDPNSIGAVTEPMLFEWTDRDTLLYAIGVGAGTGDLAFTTENSHGIDQQVLPTYAVICCPAFGAAAKVGTFNPAALLHGSQGIRLHAPLPAAGKLSVVTEVADIQDKGEGKNAIVVLRGRGCDPESGSLVAETLTTLVLRGQGGFGGARGERPAAPEFPDRHSDARIDMPTREDQALIYRLSGDRNPLHSDPWFATQLAGFPKPILHGLCTYGVAGRALVAELGGGVAANITSIAARFTKPVFPGETLSTVIWRTEPGRAVFRTEVAGSDGAEARVVLDDGAVEYVAG
>NZ_CP022577.1|WP_003417932.1|4301349_4302060_-|histidine-phosphatase-family-protein
MAKRTPVRKACTVLAVLAATLLLGACGGPTQPRSITLTFIRNAQSQANADGIIDTDMPGSGLSADGKAEAQQVAHQVSRRDVDSIYSSPMAADQQTAGPLAGELGKQVEILPGLQAINAGWFNGKPESMANSTYMLAPADWLAGDVHNTIPGSISGTEFNSQFSAAVRKIYDSGHNTPVVFSQGVAIMIWTLMNARNSRDSLLTTHPLPNIGRVVITGNPVTGWRLVEWDGIRNFT
>NZ_CP022577.1|WP_003417940.1|4299351_4301304_-|SDR-family-oxidoreductase
MRYVVTGGTGFIGRHVVSRLLDGRPEARLWALVRRQSLSRFERLAGQWGDRVRPLVGDLTELELSERTIAELGDIDHVLHCAAVHDTTWADATRAVIELAARLDATFHHVSSIAVAGDFAGHYTEADFDVGQRLPTPYHRMTFEAERLVRSTPGLRYRIYRPAVVVGDSRTGEMDTIDGPYYLFGVLAKLAVLPSFTPMLLPDIGRTNIVPVDYVADALVALMHADGRDGQTFHLTAPTAIGLRGIYRGIAGAAGLPPLLGTLPGFVAAPVLNARGRAKVLRNMAATQLGIPAEIFDVVGCAPTFTSDTTREALRGTGIHVPEFATYAPGLWRYWAEHLDPDRARRNDPLLGRHVIITGASSGIGRASAIAVAKRGATVFALARNGNALDELVTEIRAHGGQAHAFTCDVTDSASVEHTVKDILGRFDHVDYLVNNAGRSIRRSVVNSTDRLHDYERVMAVNYFGAVRMVLALLPHWRERRFGHVVNVSSAGVQARNPKYSSYLPTKAALDAFADVVASETLSDHITFTNIHMPLVATPMIVPSRRLNPVRAISAERAAAMVIRGLVEKPARIDTPLGTLAEAGNYVAPRLSRRILHQLYLGYPDSAAAQGISRPDADRPPAPRRPRRSARAGVPRPLRRLGRLVPGVHW
>NZ_CP022577.1|WP_003900041.1|4298487_4299351_+|class-I-SAM-dependent-methyltransferase
MPDELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK
>NZ_CP022577.1|WP_003417946.1|4297537_4298464_-|nucleoside-hydrolase-IunH
MSVVFADVDTGIDDALAVIYLLASPDADLVGIASTGGNIAVGQVCANNLSLLELCGAADIPVSKGADEPLGGRWPDHPKFHGPKGIGYAELPASNRRLTDYDATTAWIAAAHSHAGDLIGLVTGPLTNLALALRAEPALPRLLRRLVIMGGMFDGQPITEWNIRVDPEAASEVFTAWAGQRQLPIVCGLDLTRRVAMTPDILARLASVCGSSPVMRVIEDALRFYFESHEARGHGYLAYMHDPLAAAVAMDPELLTTRTATVDVDPTGATVTDWSGKRNPNARIGMSVDPAVFFDRFVERIGRFARRT
>NZ_CP022577.1|WP_003900042.1|4295899_4297483_+|DNA-polymerase-Y-family-protein
MMASARVLAIWCMDWPAVAAAAAAGLSATAPVAVTLANRVIACSATARAAGVRRGLRRREAAARCPQLFIATADADRDARLFEGVIAAVDDLVPRAELLRPGLLVLPVRGPARFFGSEQMAAERLIDAVAAAGAECQVGIADRLSTAVFAARAGRIVEPGGDARFLSLLSIRQLATEPSLSGPGRDDLTDLLWRMGIRTIGQFAALSRTDVASRFGADAVAAHRFARGEPERAPCGREPPPDLAAELACDPPIDRVDAAAFAGRSLAAELHRALMAAGVGCTRLAIHAVTANGEERSRVWRCAEPLTEDATADRVRWQLDGWLNNRNARDRPTAAVTLLRLQAVETVSASEGLQLPLWGGLGEQDRLRARRALVRVQGLLGPEAVRVPVLSGGHGPAERITLTVLGLVAPEPVPQADPGQPWPGRLPDPSPAVLFDDPVDLLDAQGNPIRVTSRGMFSADPARLRVRGRDDRLRWWAGPWPDDERWWDPDRASGRTARAQVLLDGDPGTALLLCYRQRRWYLEGSYE
>NZ_CP022577.1|WP_003900043.1|4295288_4295903_+|hypothetical-protein
MTAAFASDQRLENGAEQLESLRRQMALLSEKVSGGPSRSGDLVPAGPVSLPPGTVGVLSGARSLLLSMVASVTAAGGNAAIVGQPDIGLLAAVEMGADLSRLAVIPDPGTDPVEVAAVLIDGMDLVVLGLGGRRVTRARARAVVARARQKGCTLLVTDGDWQGVSTRLAARVCGYEITPALRGVPTPGLGRISGVRLQINGRGR
>NZ_CP022577.1|WP_016810333.1|4294579_4295290_-|hypothetical-protein
MTSLLFENMFEVIRHPSLESVKVMRGCLVQSRKTTSVLAAALLFCGLLGPGTAPPATGGGPACRPAELFATDNTTDGFELPAVATIALTGTVVTGSTLVDGVFWSNERQQIGYERSREFHLCVVDAPTLHNAAEALHRQFNQEAVLTFDYLPQNAPEADAILITVPDIGIARFRDAFASDLAAHHRLRGGSVTTADHTLILVAGNGDLDVARRLVEEAGGDWNATTIAHGRREFVN
>NZ_CP022577.1|WP_003417952.1|4292846_4294424_+|glutamine-hydrolyzing-GMP-synthase
MVQPADIDVPETPARPVLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVALVLSGGPASVYADGAPKLDPALLDLGVPVLGICYGFQAMAQALGGIVAHTGTREYGRTELKVLGGKLHSDLPEVQPVWMSHGDAVTAAPDGFDVVASSAGAPVAAFEAFDRRLAGVQYHPEVMHTPHGQQVLSRFLHDFAGLGAQWTPANIANALIEQVRTQIGDGHAICGLSGGVDSAVAAALVQRAIGDRLTCVFVDHGLLRAGERAQVQRDFVAATGANLVTVDAAETFLEALSGVSAPEGKRKIIGRQFIRAFEGAVRDVLDGKTAEFLVQGTLYPDVVESGGGSGTANIKSHHNVGGLPDDLKFTLVEPLRLLFKDEVRAVGRELGLPEEIVARQPFPGPGLGIRIVGEVTAKRLDTLRHADSIVREELTAAGLDNQIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRVPYEVLERISTRITNEVAEVNRVVLDITSKPPATIEWE
>NZ_CP022577.1|WP_003417954.1|4291926_4292835_+|presqualene-diphosphate-synthase-HpnD
MTEIEQAYRITESITRTAARNFYYGIRLLPREKRAALSAVYALGRRIDDVADGELAPETKITELDAIRKSLDNIDDSSDPVLVALADAARRFPVPIAMFAELIDGARMEIDWTGCRDFDELIVYCRRGAGTIGKLCLSIFGPVSTATSRYAEQLGIALQQTNILRDVREDFLNGRIYLPRDELDRLGVRLRLDDTGALDDPDGRLAALLRFSADRAADWYSLGLRLIPHLDRRSAACCAAMSGIYRRQLALIRASPAVVYDRRISLSGLKKAQVAAAALASSVTCGPAHGPLPADLGSHPSH
>NZ_CP022577.1|WP_003417918.1|4306963_4307272_+|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MTPTACATVSTMTSVGVRALRQRASELLRRVEAGETIEITDRGRPVALLSPLPQGGPYEQLLASGEIERATLDVVDLPEPLDLDAGVELPSVTLARLREHER
>NZ_CP022577.1|WP_003417916.1|4307271_4307664_+|type-II-toxin-antitoxin-system-VapC-family-toxin
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAGGLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
>NZ_CP022577.1|WP_087902221.1|4309124_4310386_-|IS3-like-element-IS987-family-transposase
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASGFLRGRARPASTLITRFIADHQGHREGPDGLRWGVESICTQLTELGVPIAPSTYYDHINREPSRRELRDGELKEHISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLGLSGTTRGKARRTTIADPATARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSERLAEAGIQPSVGAVGSSYDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHRRLYQYCGDVPPVELEAAYYAQRQRPAAG
>NZ_CP022577.1|WP_003417912.1|4310827_4311817_+|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase
MAEVFVGPVAQGYASGEVTVLLASPRSFCAGVERAIETVKRVLDVAEGPVYVRKQIVHNTVVVAELRDRGAVFVEDLDEIPDPPPPGAVVVFSAHGVSPAVRAGADERGLQVVDATCPLVAKVHAEAARFAARGDTVVFIGHAGHEETEGTLGVAPRSTLLVQTPADVAALNLPEGTQLSYLTQTTLALDETADVIDALRARFPTLGQPPSEDICYATTNRQRALQSMVGECDVVLVIGSCNSSNSRRLVELAQRSGTPAYLIDGPDDIEPEWLSSVSTIGVTAGASAPPRLVGQVIDALRGYASITVVERSIATETVRFGLPKQVRAQ
>NZ_CP022577.1|WP_003918607.1|4311813_4313652_+|1-deoxy-D-xylulose-5-phosphate-synthase
MTTTIRNGRGDLITAIGGPCDVQALPESQLPELAVQMRRRLIETVTATGGHLGAGLGMVELTIALHRVFTSPHDIVVFDTGHQTYPHKLLTGRGKDFATLRQADGLSGYPNRHESPHDWVENSHASVSLAWVDGIAKALALQGQCDRRVIAVIGDGALTGGVAWEGLNNLGAATRPVIVVLNDNGRSYDPTAGALAAHLEELRVGTPRGPNLFENMGFTYIGPVDGHNIPDTCAVLRKAAAAARPVVVHAVTSKGRGYPPAEADERDHMHACGVVDIATGLASTPSQRSWTDVFEDEIARIADDRSDVVGLTAAMRLPTGLGALSRRYPHRVFDSGIAEQHLLASAAGLAAAGTHPVVAVYSTFLHRAFDQLLFDIGLHRLPVTLVLDRAGVTGPDGPSHHGLWDLALLACVPGFQIACPRDAPRLRQQLRTAIATAAPTAVRFPKGAPGEPITAEHTIGGLDVLHTPPPHWRPDVLLVAVGAMSRPCMDAARCLSEEQIGVTVVDPQWVWPISPALTELAGRHRITVCVEDAIADVGIGAHLSHHIGRTHPRTRTYTLGLPPAYIPHASRDHILSSHGLTGPAIRIRCKSLLNALHEVPGPEDHPDSGDSY
>NZ_CP022577.1|WP_003417908.1|4313660_4314551_+|diterpene-synthase
MNLVSEKEFLDLPLVSVAEIVRCRGPKVSVFPFDGTRRWFHLECNPQYDDYQQAALRQSIRILKMLFEHGIETVISPIFSDDLLDRGDRYIVQALEGMALLANDEEILSFYKEHEVHVLFYGDYKKRLPSTAQGAAVVKSFDDLTISTSSNTEHRLCFGVFGNDAAESVAQFSISWNETHGKPPTRREIIEGYYGEYVDKADMFIGFGRFSTFDFPLLSSGKTSLYFTVAPSYYMTETTLRRILYDHIYLRHFRPKPDYSAMSADQLNVLRNRYRAQPDRVFGVGCVHDGIWFAEG
>NZ_CP022577.1|WP_003417905.1|4314555_4316061_+|type-B-diterpene-cyclase
METFRTLLAKAALGNGISSTAYDTAWVAKLGQLDDELSDLALNWLCERQLPDGSWGAEFPFCYEDRLLSTLAAMISLTSNKHRRRRAAQVEKGLLALKNLTSGAFEGPQLDIKDATVGFELIAPTLMAEAARLGLAICHEESILGELVGVREQKLRKLGGSKINKHITAAFSVELAGQDGVGMLDVDNLQETNGSVKYSPSASAYFALHVKPGDKRALAYISSIIQAGDGGAPAFYQAEIFEIVWSLWNLSRTDIDLSDPEIVRTYLPYLDHVEQHWVRGRGVGWTGNSTLEDCDTTSVAYDVLSKFGRSPDIGAVLQFEDADWFRTYFHEVGPSISTNVHVLGALKQAGYDKCHPRVRKVLEFIRSSKEPGRFCWRDKWHRSAYYTTAHLICAASNYDDALCSDAIGWILNTQRPDGSWGFFDGQATAEETAYCIQALAHWQRHSGTSLSAQISRAGGWLSQHCEPPYAPLWIAKTLYCSATVVKAAILSALRLVDESNQ
>NZ_CP022577.1|WP_003417903.1|4316099_4316753_-|HAD-family-phosphatase
MSISAVVFDRDGVLTSFDWTRAEEDVRRITGLPLEEIERRWGGWLNGLTIDDAFVETQPISEFLSSLARELELGSKARDELVRLDYMAFAQGYPDARPALEEARRRGLKVGVLTNNSLLVSARSLLQCAALHDLVDVVLSSQMIGAAKPDPRAYQAIAEALGVSTTSCLFFDDIADWVEGARCAGMRAYLVDRSGQTRDGVVRDLSSLGAILDGAGP
>NZ_CP022577.1|WP_003417900.1|4316860_4318288_-|amidase
MTDADSAVPPRLDEDAISKLELTEVADLIRTRQLTSAEVTESTLRRIERLDPQLKSYAFVMPETALAAARAADADIARGHYEGVLHGVPIGVKDLCYTVDAPTAAGTTIFRDFRPAYDATVVARLRAAGAVIIGKLAMTEGAYLGYHPSLPTPVNPWDPTAWAGVSSSGCGVATAAGLCFGSIGSDTGGSIRFPTSMCGVTGIKPTWGRVSRHGVVELAASYDHVGPITRSAHDAAVLLSVIAGSDIHDPSCSAEPVPDYAADLALTRIPRVGVDWSQTTSFDEDTTAMLADVVKTLDDIGWPVIDVKLPALAPMVAAFGKMRAVETAIAHADTYPARADEYGPIMRAMIDAGHRLAAVEYQTLTERRLEFTRSLRRVFHDVDILLMPSAGIASPTLETMRGLGQDPELTARLAMPTAPFNVSGNPAICLPAGTTARGTPLGVQFIGREFDEHLLVRAGHAFQQVTGYHRRRPPV
>NZ_CP022577.1|WP_003417897.1|4318292_4318541_-|enoyl-CoA-hydratase
MVQKVVAPQDLAAATAKLVGQVCRQSAVTMRAAKVVANMHGRALTGADTDALIRFGVEAYEGADLREGVAAFSQGRPPKFDD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022577_16

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022577_16

4344310-4344435

Orphan

Consensus_repeat	Method
TTTCAACACCGGCATCGGCAAC	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP022577_16

>merge|NZ_CP022577|16|4344310-4344435|PILER-CR
TTCAACACCGGCACCGGCAACTTCGGACTGTTCAACTCCGGTAGTTTCAACACCGGCATCGGTAATAGCGGAACCGGCAGTACTGGGCTCTTCAATGCCGGCAATTTCAACACCGGCATCGCCAAC

>NZ_CP022577|16|2|4344310-4344435|PILER-CR
TTCAACACCGGCACCGGCAACT	TCGGACTGTTCAACTCCGGTAGT
TTCAACACCGGCATCGGTAATA	GCGGAACCGGCAGTACTGGGCTCTTCAATGCCGGCAATTTCA
ACACCGGCATCGCCAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022577.1\|WP_003417741.1\|4337921_4338182_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_003900028.1\|4378014_4379364_-\|bifunctional-o-acetylhomoserine/o-acetylserine-sulfhydrylase	unknown	unknown	gnl\|CDD\|236105
NZ_CP022577.1\|WP_003417749.1\|4337110_4337404_+\|DUF3017-domain-containing-protein	unknown	unknown	gnl\|CDD\|378602
NZ_CP022577.1\|WP_003911006.1\|4351883_4352624_+\|transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP022577.1\|WP_003417461.1\|4376135_4376867_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NZ_CP022577.1\|WP_003900033.1\|4334383_4335574_-\|NADH:flavin-oxidoreductase	unknown	unknown	gnl\|CDD\|239201
NZ_CP022577.1\|WP_003417458.1\|4376863_4378003_-\|homoserine-O-acetyltransferase	unknown	unknown	gnl\|CDD\|234678
NZ_CP022577.1\|WP_049961743.1\|4352660_4353107_-\|transposase	unknown	unknown	gnl\|CDD\|376564
NZ_CP022577.1\|WP_003417751.1\|4336268_4337114_+\|bifunctional-methylenetetrahydrofolate-dehydrogenase/methenyltetrahydrofolate-cyclohydrolase	unknown	unknown	gnl\|CDD\|237637
NZ_CP022577.1\|WP_003417745.1\|4337417_4337807_-\|DUF732-domain-containing-protein	unknown	unknown	gnl\|CDD\|368380
NZ_CP022577.1\|WP_003417757.1\|4335869_4336145_-\|type-II-toxin-antitoxin-system-antitoxin-RelJ	unknown	unknown	gnl\|CDD\|225072
NZ_CP022577.1\|WP_157132559.1\|4338208_4338427_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366708
NZ_CP022577.1\|WP_003417739.1\|4338324_4338696_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_CP022577.1\|WP_009938650.1\|4351301_4351589_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022577.1\|WP_031654342.1\|4369107_4370088_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|312941
NZ_CP022577.1\|WP_003417452.1\|4379646_4380876_+\|NADP-dependent-isocitrate-dehydrogenase	unknown	unknown	gnl\|CDD\|236226
NZ_CP022577.1\|WP_003417619.1\|4363461_4363719_+\|DUF3017-domain-containing-protein	unknown	unknown	gnl\|CDD\|378602
NZ_CP022577.1\|WP_003901612.1\|4353732_4363206_+\|PPE-family-protein	unknown	unknown	gnl\|CDD\|366325
NZ_CP022577.1\|WP_003417738.1\|4338777_4339572_+\|BBE-domain-containing-protein	unknown	unknown	gnl\|CDD\|369658
NZ_CP022577.1\|WP_003417760.1\|4335615_4335873_-\|Txe/YoeB-family-addiction-module-toxin	unknown	unknown	gnl\|CDD\|284238

Protein	Function_ID	Function_description	E-value
NZ_CP022577.1\|WP_003417751.1\|4336268_4337114_+\|bifunctional-methylenetetrahydrofolate-dehydrogenase/methenyltetrahydrofolate-cyclohydrolase	gnl\|CDD\|237637	PRK14193, PRK14193, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional.	0
NZ_CP022577.1\|WP_003900028.1\|4378014_4379364_-\|bifunctional-o-acetylhomoserine/o-acetylserine-sulfhydrylase	gnl\|CDD\|236105	PRK07812, PRK07812, O-acetylhomoserine aminocarboxypropyltransferase; Validated.	0
NZ_CP022577.1\|WP_003417749.1\|4337110_4337404_+\|DUF3017-domain-containing-protein	gnl\|CDD\|378602	pfam11222, DUF3017, Protein of unknown function (DUF3017). This bacterial family of proteins with unknown function appear to be restricted to Actinobacteria.	7.01063e-14
NZ_CP022577.1\|WP_003911006.1\|4351883_4352624_+\|transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	1.74021e-20
NZ_CP022577.1\|WP_003417461.1\|4376135_4376867_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.03104e-26
NZ_CP022577.1\|WP_003900033.1\|4334383_4335574_-\|NADH:flavin-oxidoreductase	gnl\|CDD\|239201	cd02803, OYE_like_FMN_family, Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.	2.40238e-109
NZ_CP022577.1\|WP_003417458.1\|4376863_4378003_-\|homoserine-O-acetyltransferase	gnl\|CDD\|234678	PRK00175, metX, homoserine O-acetyltransferase; Provisional.	0
NZ_CP022577.1\|WP_049961743.1\|4352660_4353107_-\|transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	3.45693e-11
NZ_CP022577.1\|WP_003417745.1\|4337417_4337807_-\|DUF732-domain-containing-protein	gnl\|CDD\|368380	pfam05305, DUF732, Protein of unknown function (DUF732). This family consists of several uncharacterized Mycobacterium tuberculosis and leprae proteins of unknown function.	4.49035e-23
NZ_CP022577.1\|WP_003417757.1\|4335869_4336145_-\|type-II-toxin-antitoxin-system-antitoxin-RelJ	gnl\|CDD\|225072	COG2161, StbD, Antitoxin of toxin-antitoxin stability system [Cell division and chromosome partitioning].	4.97885e-20
NZ_CP022577.1\|WP_157132559.1\|4338208_4338427_+\|hypothetical-protein	gnl\|CDD\|366708	pfam01565, FAD_binding_4, FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.	3.12703e-05
NZ_CP022577.1\|WP_003417739.1\|4338324_4338696_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	7.3689e-14
NZ_CP022577.1\|WP_031654342.1\|4369107_4370088_+\|hypothetical-protein	gnl\|CDD\|312941	pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal. The approx. 70 residue Med15 domain of the ARC-Mediator co-activator is a three-helix bundle with marked similarity to the KIX domain. The sterol regulatory element binding protein (SREBP) family of transcription activators use the ARC105 subunit to activate target genes in the regulation of cholesterol and fatty acid homeostasis. In addition, Med15 is a critical transducer of gene activation signals that control early metazoan development.	0.00133744
NZ_CP022577.1\|WP_003417452.1\|4379646_4380876_+\|NADP-dependent-isocitrate-dehydrogenase	gnl\|CDD\|236226	PRK08299, PRK08299, NADP-dependent isocitrate dehydrogenase.	0
NZ_CP022577.1\|WP_003417619.1\|4363461_4363719_+\|DUF3017-domain-containing-protein	gnl\|CDD\|378602	pfam11222, DUF3017, Protein of unknown function (DUF3017). This bacterial family of proteins with unknown function appear to be restricted to Actinobacteria.	3.92596e-11
NZ_CP022577.1\|WP_003901612.1\|4353732_4363206_+\|PPE-family-protein	gnl\|CDD\|366325	pfam00823, PPE, PPE family. This family named after a PPE motif near to the amino terminus of the domain. The PPE family of proteins all contain an amino-terminal region of about 180 amino acids. The carboxyl terminus of this family are variable, and on the basis of this region fall into at least three groups. The MPTR subgroup has tandem copies of a motif NXGXGNXG. The second subgroup contains a conserved motif at about position 350. The third group are only related in the amino terminal region. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	9.79647e-79
NZ_CP022577.1\|WP_003417738.1\|4338777_4339572_+\|BBE-domain-containing-protein	gnl\|CDD\|369658	pfam08031, BBE, Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.	2.38492e-05
NZ_CP022577.1\|WP_003417760.1\|4335615_4335873_-\|Txe/YoeB-family-addiction-module-toxin	gnl\|CDD\|284238	pfam06769, YoeB_toxin, YoeB-like toxin of bacterial type II toxin-antitoxin system. YoeB_toxin is a family of bacterial toxins that forms one component of the type II toxin-antitoxin system in E. coli whose antitoxin is represented by YefM, found in pfam02604. The plasmid encoded Axe-Txe proteins in Enterococcus faecium act as an antitoxin-toxin pair. When the plasmid is lost, the antitoxin is degraded relatively quickly by host enzymes. This allows the toxin to interact with its intracellular target, thus killing the cell or impeding cell growth. These toxins are highly potent protein synthesis inhibitors, specifically blocking the initiation of translation. In the case of YoeB, it binds to the 50 S ribosomal subunit in 70 S ribosomes and interacts with the A site leading to mRNA cleavage at this site. As a result, the 3'-end portion of the mRNA is released from ribosomes, and translation initiation is effectively inhibited.	5.71893e-47

>NZ_CP022577.1|WP_003417738.1|4338777_4339572_+|BBE-domain-containing-protein
MLASCPARSGAAVADAIKSAVGVQPSGVEHKTLRRMDLVRYLAGGHTTYPPEGFVAGSDVIGTTNPAAAQAIVAAIGTWPPAAGRASALIDSLGGAVGDMDPEGSAFPWCRQSAVVQWYVNTPSDGQVATANKWLSDAHHAVQHFSVGGYVNYLEANAAASQYFGANLSRLTTVRRKYDPDRIMYSGLDFSTRQVAERLLPALGFRVRFGVLVIRCALCTDTVKRLGTLPNLTWSRLKVNVAVTQEQAGVMDLPALPVRRTPRR
>NZ_CP022577.1|WP_003417739.1|4338324_4338696_+|FAD-binding-oxidoreductase
MSAATDLYAVHQALAGESRAIPTGSCPTVGVAGLTLGGGLGADSRHAGLTCDALKSATVVLPGGDAVSASADDHAELFWALRGGGGGNFGVTTSMTFARFPTADCDVVRVDFAPSAAAQVLVG
>NZ_CP022577.1|WP_157132559.1|4338208_4338427_+|hypothetical-protein
MRGGGHSYIGASSANGAMVLDLLGLPGGVHFDSATRNVRCRPRPISMRSIKRWPVRAGRFRPAAARPWVWRV
>NZ_CP022577.1|WP_003417741.1|4337921_4338182_+|hypothetical-protein
MSRQTFLRGAVGAPATSAVFPTILARATPGDGWASLASSIGGQVLLPANGRAFTSGKQIFNSNYSGLNPAAVVTVASQADVRKAVS
>NZ_CP022577.1|WP_003417745.1|4337417_4337807_-|DUF732-domain-containing-protein
MNLRRHQTLTLRLLAASAGILSAAAFAAPAQANPVDDAFIAALNNAGVNYGDPVDAKALGQSVCPILAEPGGSFNTAVASVVARAQGMSQDMAQTFTSIAISMYCPSVMADVASGNLPALPDMPGLPGS
>NZ_CP022577.1|WP_003417749.1|4337110_4337404_+|DUF3017-domain-containing-protein
MTVRAVFRRTVGAQWPILLVGSIFAVGFVLAGANFWRRGALLIGIGVGVAAVLRLVLSEERAGLLVVRSKGIDFVTTVTVAAAMVYIASTIDPLGTG
>NZ_CP022577.1|WP_003417751.1|4336268_4337114_+|bifunctional-methylenetetrahydrofolate-dehydrogenase/methenyltetrahydrofolate-cyclohydrolase
MGAIMLDGKATRDEIFGDLKQRVAALDAAGRTPGLGTILVGDDPGSQAYVRGKHADCAKVGITSIRRDLPADISTATLNETIDELNANPDCTGYIVQLPLPKHLDENAALERVDPAKDADGLHPTNLGRLVLGTPAPLPCTPRGIVHLLRRYDISIAGAHVVVIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRDLPALTRQADIVVAAVGVAHLLTADMVRPGAAVIDVGVSRTDDGLVGDVHPDVWELAGHVSPNPGGVGPLTRAFLLTNVVELAERR
>NZ_CP022577.1|WP_003417757.1|4335869_4336145_-|type-II-toxin-antitoxin-system-antitoxin-RelJ
MSISASEARQRLFPLIEQVNTDHQPVRITSRAGDAVLMSADDYDAWQETVYLLRSPENARRLMEAVARDKAGHSAFTKSVDELREMAGGEE
>NZ_CP022577.1|WP_003417760.1|4335615_4335873_-|Txe/YoeB-family-addiction-module-toxin
MRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLKARYHY
>NZ_CP022577.1|WP_003900033.1|4334383_4335574_-|NADH:flavin-oxidoreductase
MAPGSCEAPDVFNPAKLGPLTLRNRVIKAATFEARTPDALVTDDLIEYHRLPAAGGVAMTTVAYCAVSPGGRTGGNQIWMRPHAVPGLRRLTEAIHAEGAAISAQIGHAGPVADARSNQATALAPVRFFNPIAMRFAQKATREDIDDVLAAHAHAARLAVDAGFDAVEIHLGHNYLASAFLSPLLNRRDDEFGGSLQNRAKVARGLVMAVRRAVRQQVAVTAKLNMTDGIRGGITVDEALTTARWLQDDGGLDAIELTAGSSLVNPMYLFRGDAPVKEFAAAFKPPLRWGIRMTGHRFFREYPYRDAYLLREARLFRAELTIPLILLGGITNRTTMDLAMAEGFEFVAMARALLAEPDLVNRIAAEGSQVRSACTHCNQCMATIYRRTHCVVTGAP
>NZ_CP022577.1|WP_009938650.1|4351301_4351589_+|hypothetical-protein
MSRRRRRARRAGVVSISVKEYAVTSPKDLPYGEDRIMVRWNKIRWRCREDYCKLGPFTEAITQVPARVRSTLRLRRQMAKAIGDAARSVGRGRPG
>NZ_CP022577.1|WP_003911006.1|4351883_4352624_+|transposase
MAIDPAAAYASAIRTPGLLPNAKLVVDHFHVTTLANDALTAVRRRVTWAFHDRRGRKIDPQWANRRRLLTARERLSDKSFAKMRNRINAVDPRAQILSAWIAKEELRTLLSTVRTGGDPHLARHHLHRFLPGASTRRSPNCSPWPPPLTSHPRSTPSWSPASPTRASVVGEVAEMVGDIDGQCVQVEVPVPERGPAGCGGLDGLGRAGVSATPRVCAAMTAVNVAGRCAGQQADVGPTPQHRCRGR
>NZ_CP022577.1|WP_049961743.1|4352660_4353107_-|transposase
MDAAITACHHIAIRDDVGARSIRFSVEPTLAGLRTLTDKLSGYDDIDATVEPTSMTWLPLTIAVENAGDTMHMAGARHCARLRGAIVGKSKSDVIDAEVLTRASEVFDLTPLTLPTPAQLALRRSVIRRAGAVIDANRSWRRLMSLAR
>NZ_CP022577.1|WP_003901612.1|4353732_4363206_+|PPE-family-protein
MNFPVLPPEINSVLMYSGAGSSPLLAAAAAWDGLAEELGSAAVSFGQVTSGLTAGVWQGAAAAAMAAAAAPYAGWLGSVAAQAVAVAGQARAAVAAFEAALAATVDPAAVAVNRMAMRALAMSNLLGQNAAAIAAVEAEYELMWAADVAAMAGYHSGASAAAAALPAFSPPAQALGGGVGAFLNALFAGPAKMLRLNAGLGNVGNYNVGLGNVGIFNLGAANVGAQNLGAANAGSGNFGFGNIGNANFGFGNSGLGLPPGMGNIGLGNAGSSNYGLANLGVGNIGFANTGSNNIGIGLTGDNLTGIGGLNSGTGNLGLFNSGTGNIGFFNSGTGNFGVFNSGSYNTGVGNAGTASTGLFNVGGFNTGVANVGSYNTGSFNAGNTNTGGFNPGNVNTGWLNTGNTNTGIANSGNVNTGAFISGNFSNGVLWRGDYEGLWGLSGGSTIPAIPIGLELNGGVGPITVLPIQILPTIPLNIHQTFSLGPLVVPDIVIPAFGGGTAIPISVGPITISPITLFPAQNFNTTFPVGPFFGLGVVNISGIEIKDLAGNVTLQLGNLNIDTRINQSFPVTVNWSTPAVTIFPNGISIPNNPLALLASASIGTLGFTIPGFTIPAAPLPLTIDIDGQIDGFSTPPITIDRIPLNLGASVTVGPILINGVNIPATPGFGNTTTAPSSGFFNSGDGGVSGFGNFGAGSSGWWNQAQTEVAGAGSGFANFGSLGSGVLNFGSGVSGLYNTGGLPPGTPAVVSGIGNVGEQLSGLSSAGTALNQSLIINLGLADVGSVNVGFGNVGDFNLGAANIGDLNVGLGNVGGGNVGFGNIGDANFGLGNAGLAAGLAGVGNIGLGNAGSGNVGFGNMGVGNIGFGNTGTNNLGIGLTGDNQTGIGGLNSGAGNIGLFNSGTGNVGLFNSGTGNFGLFNSGGYNTGIGNGGTGSTGLFNAGNFNTGVANPGSYNTGSFNVGDTNTGGFNPGSINTGWFNTGNANTGVANSGTVNTGAFITGNDSNGILWRGNFEGLFGLNVGITIPEFPIHWTSTGGIGPIIIPDTTILPPIHLGLTGQANYGFAVPDIPIPAIHIDFDGAADAGFTAPATTLLSALGITGQFRFGPITVSNVQLNPFNVNLKLQFLHDAFPNEFPDPTISVQIQVAIPLTSATLGGLALPLQQTIDAIELPAISFSQSIPIDIPPIDIPASTINGISMSEVVPIDVSVDIPAVTITGTRIDPIPLNFDVLSSAGPINISIIDIPALPGFGNSTELPSSGFFNTGGGGGSGIANFGAGVSGLLNQASSPMVGTLSGLGNAGSLASGVLNSGVDISGMFNVSTLGSAPAVISGFGNLGNHVSGVSIDGLLAMLTSGGSGGSGQPSIIDAAIAELRHLNPLNIVNLGNVGSYNLGFANVGDVNLGAGNLGNLNLGGGNLGGQNLGLGNLGDGNVGFGNLGHGNVGFGNSGLGALPGIGNIGLGNAGSNNVGFGNMGLGNIGFGNTGTNNLGIGLTGDNQTGFGGLNSGAGNLGLFNSGTGNIGFFNTGTGNWGLFNSGSYNTGIGNSGTGSTGLFNAGSFNTGLANAGSYNTGSLNAGNTNTGGFNPGNVNTGWFNAGHTNTGGFNTGNVNTGAFNSGSFNNGALWTGDHHGLVGFSYSIEITGSTLVDINETLNLGPVHIDQIDIPGMSLFDIHELVNIGPFRIEPIDVPAVVLDIHETMVIPPIVFLPSMTIGGQTYTIPLDTPPAPAPPPFRLPLLFVNALGDNWIVGASNSTGMSGGFVTAPTQGILIHTGPSSATTGSLALTLPTVTIPTITTSPIPLKIDVSGGLPAFTLFPGGLNIPQNAIPLTIDASGVLDPITIFPGGFTIDPLPLSLALNISVPDSSVPIIIVPPTPGFGNATATPSSGFFNSGAGGVSGFGNFGAGSSGWWNQAHAALAGAGSGVLNVGTLNSGVLNVGSGISGLYNTAIVGLGTPALVSGAGNVGQQLSGVLAAGTALTQSPIINLGLADVGNYNLGLGNVGDFNLGAANLGDLNLGLGNIGNANVGFGNIGHGNVGFGNSGLGAALGIGNIGLGNAGSTNVGLANMGVGNIGFANTGTNNLGIGLTGDNQTGIGGLNSGAGNIGLFNSGTGNIGFFNSGTGNWGLFNSGSFNTGIGNSGTGSTGLFNAGGFTTGLANAGSYNTGSFNVGDTNTGGFNPGSINTGWFNTGNANTGIANSGNVDTGALMSGNFSNGILWRGNYEGLFSYSYSLDVPRITILDAHFTGAFGPVVVPPIPVPAINAHLTGNAAMGAFTIPQIDIPALNPNVTGSVGFGPIAVPSVTIPALTAARAVLDMAASVGATSEIEPFIVWTSSGAIGPTWYSVGRIYNAGDLFVGGNIISGIPTLSTTGPVHAVFNAASQAFNTPALNIHQIPLGFQVPGSIDAITLFPGGLTFPANSLLNLDVFVGTPGATIPAITFPEIPANADGELYVIAGDIPLINIPPTPGIGNTTTVPSSGFFNTGAGGGSGFGNFGANMSGWWNQAHTALAGAGSGIANVGTLHSGVLNLGSGLSGIYNTSTLPLGTPALVSGLGNVGDHLSGLLASNVGQNPITIVNIGLANVGNGNVGLGNIGNLNLGAANIGDVNLGFGNIGDVNLGFGNIGGGNVGFGNIGDANFGFGNSGLAAGLAGMGNIGLGNAGSGNVGWANMGLGNIGFGNTGTNNLGIGLTGDNQSGIGGLNSGTGNIGLFNSGTGNIGFFNSGTANFGLFNSGSYNTGIGNSGVASTGLVNAGGFNTGVANAGSYNTGSFNAGDTNTGGFNPGSTNTGWFNTGNANTGVANAGNVNTGALITGNFSNGILWRGNYEGLAGFSFGYPIPLFPAVGADVTGDIGPATIIPPIHIPSIPLGFAAIGHIGPISIPNIAIPSIHLGIDPTFDVGPITVDPITLTIPGLSLDAAVSEIRMTSGSSSGFKVRPSFSFFAVGPDGMPGGEVSILQPFTVAPINLNPTTLHFPGFTIPTGPIHIGLPLSLTIPGFTIPGGTLIPQLPLGLGLSGGTPPFDLPTVVIDRIPVELHASTTIGPVSLPIFGFGGAPGFGNDTTAPSSGFFNTGGGGGSGFSNSGSGMSGVLNAISDPLLGSASGFANFGTQLSGILNRGAGISGVYNTGTLGLVTSAFVSGFMNVGQQLSGLLFAGTGP
>NZ_CP022577.1|WP_003417619.1|4363461_4363719_+|DUF3017-domain-containing-protein
MTVRAVLRRTVGAQWPILAGVNFWRRGALLIGIGVGVAAVLRLVLSEERAGLLVVRSKGIDFVTTVTVAAAMVYIASTIDPLGTG
>NZ_CP022577.1|WP_031654342.1|4369107_4370088_+|hypothetical-protein
MLGGKGGDGGNGDHGGPATNPGSGSRGGAGGSGGNGGAGGNATGSGGKGGAGGNGGDGSFGATSGPASIGVTGAPGGNGGKGGAGGSNPNGSGGDGGKGGNGGAGGNGGSIGANSGIVGGSGGAGGAGGAGGNGSLSSGEGGKGGDGGHGGDGVGGNSSVTQGGSGFFGGKGGFGGDGGQGGPNGGGTVGTVAGGGGNGGVGGRGGDGVFAGAGGQGGLGGQGGNGGGSTGGNGGLGGAGGGGGNAPDGGFGGNGGKGGQGGIGGGTQSATGLGGDGGDGGDGGNGGNSGAKAGGAGGKGQAGQPNSGTEPGFGGDGGLGGAGATP
>NZ_CP022577.1|WP_003417461.1|4376135_4376867_-|class-I-SAM-dependent-methyltransferase
MTCSRRDMSLSFGSAVGAYERGRPSYPPEAIDWLLPAAARRVLDLGAGTGKLTTRLVERGLDVVAVDPIPEMLDVLRAALPQTVALLGTAEEIPLDDNSVDAVLVAQAWHWVDPARAIPEVARVLRPGGRLGLVWNTRDERLGWVRELGEIIGRDGDPVRDRVTLPEPFTTVQRHQVEWTNYLTPQALIDLVASRSYCITSPAQVRTKTLDRVRQLLATHPALANSNGLALPYVTVCVRATLA
>NZ_CP022577.1|WP_003417458.1|4376863_4378003_-|homoserine-O-acetyltransferase
MTISDVPTQTLPAEGEIGLIDVGSLQLESGAVIDDVCIAVQRWGKLSPARDNVVVVLHALTGDSHITGPAGPGHPTPGWWDGVAGPGAPIDTTRWCAVATNVLGGCRGSTGPSSLARDGKPWGSRFPLISIRDQVQADVAALAALGITEVAAVVGGSMGGARALEWVVGYPDRVRAGLLLAVGARATADQIGTQTTQIAAIKADPDWQSGDYHETGRAPDAGLRLARRFAHLTYRGEIELDTRFANHNQGNEDPTAGGRYAVQSYLEHQGDKLLSRFDAGSYVILTEALNSHDVGRGRGGVSAALRACPVPVVVGGITSDRLYPLRLQQELADLLPGCAGLRVVESVYGHDGFLVETEAVGELIRQTLGLADREGACRR
>NZ_CP022577.1|WP_003900028.1|4378014_4379364_-|bifunctional-o-acetylhomoserine/o-acetylserine-sulfhydrylase
MSADSNSTDADPTAHWSFETKQIHAGQHPDPTTNARALPIYATTSYTFDDTAHAAALFGLEIPGNIYTRIGNPTTDVVEQRIAALEGGVAALFLSSGQAAETFAILNLAGAGDHIVSSPRLYGGTYNLFHYSLAKLGIEVSFVDDPDDLDTWQAAVRPNTKAFFAETISNPQIDLLDTPAVSEVAHRNGVPLIVDNTIATPYLIQPLAQGADIVVHSATKYLGGHGAAIAGVIVDGGNFDWTQGRFPGFTTPDPSYHGVVFAELGPPAFALKARVQLLRDYGSAASPFNAFLVAQGLETLSLRIERHVANAQRVAEFLAARDDVLSVNYAGLPSSPWHERAKRLAPKGTGAVLSFELAGGIEAGKAFVNALKLHSHVANIGDVRSLVIHPASTTHAQLSPAEQLATGVSPGLVRLAVGIEGIDDILADLELGFAAARRFSADPQSVAAF
>NZ_CP022577.1|WP_003417452.1|4379646_4380876_+|NADP-dependent-isocitrate-dehydrogenase
MSNAPKIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVTIDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTIFREPIVISNVPRLVPGWTKPIVIGRHAFGDQYRATNFKVDQPGTVTLTFTPADGSAPIVHEMVSIPEDGGVVLGMYNFKESIRDFARASFSYGLNAKWPVYLSTKNTILKAYDGMFKDEFERVYEEEFKAQFEAAGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTADGKTVEAEAAHGTVTRHYRQYQAGKPTSTNPIASIFAWTRGLQHRGKLDGTPEVIDFAHKLESVVIATVESGKMTKDLAILIGPEQDWLNSEEFLDAIADNLEKELAN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP022577.1	3356660-3356683	0	1.0
NZ_CP022577_12	12.4\|4153901\|20\|NZ_CP022577\|CRT	4153901-4153920	20	NZ_CP022577.1	4155116-4155135	0	1.0
NZ_CP022577_12	12.5\|4153964\|41\|NZ_CP022577\|CRT	4153964-4154004	41	NZ_CP022577.1	4155179-4155219	0	1.0
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP022577.1	4155263-4155291	0	1.0
NZ_CP022577_12	12.8\|4154189\|35\|NZ_CP022577\|CRT	4154189-4154223	35	NZ_CP022577.1	4154798-4154832	0	1.0
NZ_CP022577_12	12.9\|4154267\|47\|NZ_CP022577\|CRT	4154267-4154313	47	NZ_CP022577.1	4154876-4154922	0	1.0
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP022577.1	4154966-4154991	0	1.0
NZ_CP022577_12	12.12\|4154507\|29\|NZ_CP022577\|CRT	4154507-4154535	29	NZ_CP022577.1	4155116-4155144	0	1.0
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP022577.1	4155188-4155219	0	1.0
NZ_CP022577_12	12.14\|4154654\|56\|NZ_CP022577\|CRT	4154654-4154709	56	NZ_CP022577.1	4155263-4155318	0	1.0
NZ_CP022577_3	3.3\|1644224\|21\|NZ_CP022577\|CRT	1644224-1644244	21	NZ_CP022577.1	1335622-1335642	1	0.952
NZ_CP022577_3	3.3\|1644224\|21\|NZ_CP022577\|CRT	1644224-1644244	21	NZ_CP022577.1	2200516-2200536	1	0.952
NZ_CP022577_9	9.1\|3331152\|21\|NZ_CP022577\|CRISPRCasFinder	3331152-3331172	21	NZ_CP022577.1	3561036-3561056	1	0.952
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP022577.1	1269505-1269528	1	0.958
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP022577.1	2852086-2852109	1	0.958
NZ_CP022577_12	12.11\|4154426\|38\|NZ_CP022577\|CRT	4154426-4154463	38	NZ_CP022577.1	4155035-4155072	1	0.974
NZ_CP022577_3	3.3\|1644224\|21\|NZ_CP022577\|CRT	1644224-1644244	21	NZ_CP022577.1	2200675-2200695	2	0.905
NZ_CP022577_3	3.3\|1644224\|21\|NZ_CP022577\|CRT	1644224-1644244	21	NZ_CP022577.1	2531585-2531605	2	0.905
NZ_CP022577_3	3.5\|1644323\|21\|NZ_CP022577\|CRT	1644323-1644343	21	NZ_CP022577.1	2602081-2602101	2	0.905
NZ_CP022577_5	5.13\|2855460\|21\|NZ_CP022577\|CRT	2855460-2855480	21	NZ_CP022577.1	2138986-2139006	2	0.905
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP022577.1	1832786-1832809	2	0.917

1. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to position: 3356660-3356683, mismatch: 0, identity: 1.0

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgtgctgatcggcaacgg	Protospacer
************************

2. spacer 12.4|4153901|20|NZ_CP022577|CRT matches to position: 4155116-4155135, mismatch: 0, identity: 1.0

ttgaagttggccccgccgct	CRISPR spacer
ttgaagttggccccgccgct	Protospacer
********************

3. spacer 12.5|4153964|41|NZ_CP022577|CRT matches to position: 4155179-4155219, mismatch: 0, identity: 1.0

gtgccgcctttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gtgccgcctttgccggggtcgccggcgccggtgcctgcgtt	Protospacer
*****************************************

4. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to position: 4155263-4155291, mismatch: 0, identity: 1.0

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gtgccgccgttgctgccgttgctgaagct	Protospacer
*****************************

5. spacer 12.8|4154189|35|NZ_CP022577|CRT matches to position: 4154798-4154832, mismatch: 0, identity: 1.0

gcaaagccgggctggccgcccaatccggaaccgct	CRISPR spacer
gcaaagccgggctggccgcccaatccggaaccgct	Protospacer
***********************************

6. spacer 12.9|4154267|47|NZ_CP022577|CRT matches to position: 4154876-4154922, mismatch: 0, identity: 1.0

atgcccgcgttgcctgcggtgccgccggtgttggctaggccgccggc	CRISPR spacer
atgcccgcgttgcctgcggtgccgccggtgttggctaggccgccggc	Protospacer
***********************************************

7. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to position: 4154966-4154991, mismatch: 0, identity: 1.0

gcggagtcgtcgccggccccgccggt	CRISPR spacer
gcggagtcgtcgccggccccgccggt	Protospacer
**************************

8. spacer 12.12|4154507|29|NZ_CP022577|CRT matches to position: 4155116-4155144, mismatch: 0, identity: 1.0

ttgaagttggccccgccgctaccgccggc	CRISPR spacer
ttgaagttggccccgccgctaccgccggc	Protospacer
*****************************

9. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to position: 4155188-4155219, mismatch: 0, identity: 1.0

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
ttgccggggtcgccggcgccggtgcctgcgtt	Protospacer
********************************

10. spacer 12.14|4154654|56|NZ_CP022577|CRT matches to position: 4155263-4155318, mismatch: 0, identity: 1.0

gtgccgccgttgctgccgttgctgaagctgatgccagcacccccggcgccgccttg	CRISPR spacer
gtgccgccgttgctgccgttgctgaagctgatgccagcacccccggcgccgccttg	Protospacer
********************************************************

11. spacer 3.3|1644224|21|NZ_CP022577|CRT matches to position: 1335622-1335642, mismatch: 1, identity: 0.952

gccggcgggctgctctacggc	CRISPR spacer
gccggcgggctgctgtacggc	Protospacer
************** ******

12. spacer 3.3|1644224|21|NZ_CP022577|CRT matches to position: 2200516-2200536, mismatch: 1, identity: 0.952

gccggcgggctgctctacggc	CRISPR spacer
gccggcgggctgctgtacggc	Protospacer
************** ******

13. spacer 9.1|3331152|21|NZ_CP022577|CRISPRCasFinder matches to position: 3561036-3561056, mismatch: 1, identity: 0.952

gttgccgaagaacccggcgtt	CRISPR spacer
gttgccgacgaacccggcgtt	Protospacer
******** ************

14. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to position: 1269505-1269528, mismatch: 1, identity: 0.958

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgtggtgatcggcaacgg	Protospacer
********** *************

15. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to position: 2852086-2852109, mismatch: 1, identity: 0.958

caacgccgtgctgatcggcaacgg	CRISPR spacer
cagcgccgtgctgatcggcaacgg	Protospacer
**.*********************

16. spacer 12.11|4154426|38|NZ_CP022577|CRT matches to position: 4155035-4155072, mismatch: 1, identity: 0.974

gtggcgctgctgagtccgtcggtgtttaggccgccgtt	CRISPR spacer
gtggcgctgctgagtccgtcggtgtttaggccgccttt	Protospacer
*********************************** **

17. spacer 3.3|1644224|21|NZ_CP022577|CRT matches to position: 2200675-2200695, mismatch: 2, identity: 0.905

gccggcgggctgctctacggc	CRISPR spacer
gccggcgggctgctgttcggc	Protospacer
************** * ****

18. spacer 3.3|1644224|21|NZ_CP022577|CRT matches to position: 2531585-2531605, mismatch: 2, identity: 0.905

gccggcgggctgctctacggc	CRISPR spacer
gccggcggcctggtctacggc	Protospacer
******** *** ********

19. spacer 3.5|1644323|21|NZ_CP022577|CRT matches to position: 2602081-2602101, mismatch: 2, identity: 0.905

aatggcgggctgctgttcggc	CRISPR spacer
aacggcgggctgctattcggc	Protospacer
**.***********.******

20. spacer 5.13|2855460|21|NZ_CP022577|CRT matches to position: 2138986-2139006, mismatch: 2, identity: 0.905

tcgccgagcagccagccgccg	CRISPR spacer
tcgccgtgcacccagccgccg	Protospacer
****** *** **********

21. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to position: 1832786-1832809, mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccctgctgttcggcaacgg	Protospacer
******* ***** **********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022577_3	3.9\|1644497\|21\|NZ_CP022577\|CRT	1644497-1644517	21	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	60334-60354	1	0.952
NZ_CP022577_5	5.13\|2855460\|21\|NZ_CP022577\|CRT	2855460-2855480	21	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	35104-35124	1	0.952
NZ_CP022577_5	5.13\|2855460\|21\|NZ_CP022577\|CRT	2855460-2855480	21	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	261503-261523	1	0.952
NZ_CP022577_8	8.3\|3330750\|21\|NZ_CP022577\|CRISPRCasFinder	3330750-3330770	21	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	162990-163010	1	0.952
NZ_CP022577_8	8.3\|3330750\|21\|NZ_CP022577\|CRISPRCasFinder	3330750-3330770	21	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	334397-334417	1	0.952
NZ_CP022577_5	5.13\|2855460\|21\|NZ_CP022577\|CRT	2855460-2855480	21	NZ_CP009112	Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence	219663-219683	2	0.905
NZ_CP022577_9	9.1\|3331152\|21\|NZ_CP022577\|CRISPRCasFinder	3331152-3331172	21	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	263134-263154	2	0.905
NZ_CP022577_10	10.7\|3359047\|24\|NZ_CP022577\|CRT	3359047-3359070	24	MN585195	Pseudomonas phage AUS531phi, complete genome	7251-7274	2	0.917
NZ_CP022577_10	10.7\|3359047\|24\|NZ_CP022577\|CRT	3359047-3359070	24	NC_028657	Pseudomonas phage YMC11/02/R656, complete genome	31254-31277	2	0.917
NZ_CP022577_10	10.7\|3359047\|24\|NZ_CP022577\|CRT	3359047-3359070	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5507414-5507437	2	0.917
NZ_CP022577_10	10.7\|3359047\|24\|NZ_CP022577\|CRT	3359047-3359070	24	NZ_AP022607	Mycobacterium branderi strain JCM 12687 plasmid pJCM12687	756232-756255	2	0.917
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP032327	Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence	121532-121555	2	0.917
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP007798	Azospirillum brasilense strain Az39 plasmid AbAZ39_p5, complete sequence	102694-102717	2	0.917
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP005087	Sphingobium sp. TKS plasmid pTK3, complete sequence	86260-86283	2	0.917
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	569399-569422	2	0.917
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	157190-157213	2	0.917
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	163705-163728	2	0.917
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2209494-2209517	2	0.917
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	247640-247663	2	0.917
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	1138142-1138165	2	0.917
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	195459-195482	2	0.917
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP014802	Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence	15605-15628	2	0.917
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	CU468217	Azospirillum brasilense bacteriophage Cd, complete genome	19538-19561	2	0.917
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NC_010355	Azospirillum phage Cd, complete genome	19538-19561	2	0.917
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP010862	Marinovum algicola DG 898 plasmid pMaD7	541-566	2	0.923
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP010862	Marinovum algicola DG 898 plasmid pMaD7	115037-115062	2	0.923
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	1393349-1393371	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP025081	Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence	44810-44832	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP031258	Klebsiella quasipneumoniae strain L22 plasmid pL22-1, complete sequence	176002-176024	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP011600	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-215, complete sequence	136283-136305	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP011601	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence	203450-203472	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP030924	Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence	167406-167428	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP014011	Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence	170418-170440	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP037743	Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence	43734-43756	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052159	Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-1, complete sequence	43738-43760	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP042506	Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence	97842-97864	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP042507	Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence	20012-20034	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP033955	Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence	25318-25340	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MT077884	Escherichia coli plasmid p33, complete sequence	98619-98641	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MT077886	Escherichia coli plasmid p39, complete sequence	97842-97864	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP026170	Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence	93378-93400	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052432	Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence	43745-43767	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052144	Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-1, complete sequence	43738-43760	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052363	Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence	44821-44843	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MN423361	Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence	100130-100152	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP054602	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed3, complete sequence	107000-107022	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK347226	Klebsiella pneumoniae strain K185 plasmid pK185_rmpA2, complete sequence	30579-30601	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK347227	Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence	30578-30600	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK347228	Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence	30560-30582	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK347229	Klebsiella pneumoniae strain K199 plasmid pK199_rmpA2, complete sequence	30483-30505	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK347230	Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence	30571-30593	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK347231	Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence	30481-30503	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK347232	Klebsiella pneumoniae strain K211 plasmid pK211_rmpA2, complete sequence	30574-30596	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK347233	Klebsiella pneumoniae strain K214 plasmid pK214_rmpA2, complete sequence	30479-30501	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK347234	Klebsiella pneumoniae strain K230 plasmid pK230_rmpA2, complete sequence	30576-30598	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK347235	Klebsiella pneumoniae strain K232 plasmid pK232_rmpA2, complete sequence	30494-30516	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK347236	Klebsiella pneumoniae strain K234 plasmid pK234_rmpA2, complete sequence	30476-30498	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK347237	Klebsiella pneumoniae strain K235 plasmid pK235_rmpA2, complete sequence	30481-30503	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK347238	Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence	30571-30593	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP034776	Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence	95265-95287	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052357	Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-1, complete sequence	43738-43760	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP014009	Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence	105020-105042	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MN310380	Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence	90018-90040	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP008825	UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence	102106-102128	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP041374	Klebsiella pneumoniae strain KP58 plasmid pKP58-1, complete sequence	25318-25340	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052232	Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-1, complete sequence	43738-43760	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP040546	Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-VIR, complete sequence	49495-49517	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP044215	Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence	131326-131348	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP030355	Novosphingobium sp. P6W plasmid pP6W2, complete sequence	134948-134970	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP036191	Klebsiella pneumoniae strain BA34918 plasmid pvirulence_VBA34918, complete sequence	135541-135563	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052563	Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence	43733-43755	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP042494	Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence	97842-97864	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP042495	Leclercia adecarboxylata strain E61 plasmid pE61_002, complete sequence	19986-20008	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP040696	Citrobacter freundii strain R47 plasmid pR47-309, complete sequence	52890-52912	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_AP019666	Klebsiella pneumoniae strain TA6363 plasmid pTMTA63631, complete sequence	35068-35090	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP042552	Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence	97842-97864	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP016526	Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence	28882-28904	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP035906	Klebsiella pneumoniae strain BA4656 plasmid unnamed1, complete sequence	70393-70415	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	200679-200701	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP034416	Klebsiella pneumoniae strain C789 plasmid pVir-CR-hvKP-C789, complete sequence	45068-45090	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052190	Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence	43738-43760	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP030270	Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence	43747-43769	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP035384	Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence	176160-176182	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP040540	Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence	30480-30502	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	48684-48706	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP026166	Klebsiella pneumoniae strain F81 plasmid pF81_2, complete sequence	49139-49161	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052304	Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-1, complete sequence	45065-45087	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP052037	Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence	86243-86265	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052204	Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-1, complete sequence	43738-43760	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP023135	Klebsiella pneumoniae subsp. pneumoniae strain KpvK54 plasmid pKpvK54, complete sequence	178730-178752	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	237499-237521	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NC_012556	Enterobacter cloacae plasmid pEC-IMPQ, complete sequence	97842-97864	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NC_012555	Enterobacter cloacae plasmid pEC-IMP, complete sequence	97842-97864	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP042579	Enterobacter kobei strain C16 plasmid pC16_001, complete sequence	100158-100180	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP034124	Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence	25318-25340	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052178	Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-1, complete sequence	43739-43761	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP054751	Klebsiella pneumoniae strain KP20194c3 plasmid pKP20194c3-p1, complete sequence	25317-25339	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP054781	Klebsiella pneumoniae strain KP20194a plasmid pKP20194a-p1, complete sequence	25315-25337	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	43745-43767	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP032842	Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence	97842-97864	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP018338	Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-2, complete sequence	79589-79611	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP034083	Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence	43741-43763	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP050281	Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence	36795-36817	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP054763	Klebsiella pneumoniae strain KP20194b2 plasmid pKP20194b2-p1, complete sequence	25320-25342	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP026012	Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence	138756-138778	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP026024	Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence	174467-174489	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP042525	Citrobacter freundii strain E11 plasmid pE11_001, complete sequence	97842-97864	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP054745	Klebsiella pneumoniae strain KP20194c4 plasmid pKP20194c4-p1, complete sequence	25317-25339	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP054727	Klebsiella pneumoniae strain KP20194e plasmid pKP20194e-p1, complete sequence	25317-25339	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP054739	Klebsiella pneumoniae strain KP20194c5 plasmid pKP20194c5-p1, complete sequence	25318-25340	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP054775	Klebsiella pneumoniae strain KP20194a2 plasmid pKP20194a2-p1, complete sequence	25317-25339	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP054733	Klebsiella pneumoniae strain KP20194d plasmid pKP20194d-p1, complete sequence	25316-25338	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP054721	Klebsiella pneumoniae strain KP20194f plasmid pKP20194f-p1, complete sequence	25317-25339	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP054757	Klebsiella pneumoniae strain KP20194c plasmid pKP20194c-p1, complete sequence	25316-25338	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP054769	Klebsiella pneumoniae strain KP20194b plasmid pKP20194b-p1, complete sequence	25318-25340	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP022533	Enterobacter hormaechei strain MS7884A plasmid pMS7884A, complete sequence	329552-329574	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP041024	Klebsiella pneumoniae strain KP1692 plasmid pKP1692, complete sequence	169697-169719	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052317	Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-2, complete sequence	43738-43760	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP054064	Klebsiella pneumoniae strain WSHvKP plasmid pSWHvKp, complete sequence	41735-41757	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP029717	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed4, complete sequence	189620-189642	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP042489	Enterobacter hormaechei strain C15 plasmid pC15_001, complete sequence	96707-96729	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052495	Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-1, complete sequence	43738-43760	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_MK413722	Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence	227390-227412	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NC_017541	Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence	71058-71080	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP033103	Enterobacter hormaechei strain L51 plasmid pEHZJ1, complete sequence	103366-103388	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_MH263654	Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence	45068-45090	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_MF398271	Klebsiella pneumoniae subsp. pneumoniae strain 70-2 plasmid pKP70-2, complete sequence	43735-43757	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_MF344580	Enterobacter cloacae strain 30860 plasmid p30860-HI2, complete sequence	98908-98930	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_MH399264	Enterobacter cloacae strain RJ702 plasmid pIMP26, complete sequence	151606-151628	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_KY863418	Enterobacter asburiae strain AMA 497 plasmid pOXA436, complete sequence	98619-98641	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_KY978628	Cronobacter sakazakii strain 505108 plasmid p505108-MDR, complete sequence	99194-99216	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_MF788071	Raoultella ornithinolytica strain 23141 plasmid p23141-3, complete sequence	99072-99094	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP040534	Klebsiella pneumoniae strain CR-HvKP1 plasmid pCR-HvKP1-VIR, complete sequence	30480-30502	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MH727545	Mycobacterium phage DismalStressor, complete genome	31436-31458	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MN871473	UNVERIFIED: Pseudomonas virus Pa-Z, complete genome	34302-34324	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	KJ510412	Mycobacterium phage ZoeJ, complete genome	31097-31119	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NC_026598	Mycobacterium phage Milly, complete genome	31409-31431	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	AF068845	Mycobacteriophage TM4, complete genome	31079-31101	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MH834601	Mycobacterium phage BoostSeason, complete genome	31340-31362	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	KX688047	Mycobacterium phage Marcoliusprime, complete genome	31436-31458	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	KX171208	Pseudomonas phage vB_Pae436M-8, complete genome	39845-39867	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NC_028759	Mycobacterium phage Mufasa, complete genome	31330-31352	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK318076	Pseudomonas phage vB_PaeM_fHoPae01, complete genome	46520-46542	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MF140408	Mycobacterium phage DismalFunk, complete genome	31436-31458	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NC_003387	Mycobacterium phage TM4, complete genome	31079-31101	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MT119369	Pseudomonas phage sortsol, complete genome	39163-39185	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_KX810825	Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence	228718-228740	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP028197	Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence	26569-26591	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052163	Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-1, complete sequence	135652-135674	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP026022	Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence	13203-13225	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MN200128	Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence	152337-152359	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MN200130	Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence	152320-152342	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP048293	Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence	164935-164957	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP019049	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence	70400-70422	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP020529	Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence	35044-35066	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP024708	Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence	129894-129916	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_LR134257	Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence	16145-16167	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP031567	Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence	21993-22015	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP035380	Leclercia adecarboxylata strain R25 plasmid pLA-109, complete sequence	68028-68050	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	65988-66010	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NC_005249	Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence	155702-155724	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NC_008573	Shewanella sp. ANA-3 plasmid unnamed1, complete sequence	213321-213343	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP022696	Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence	242447-242469	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP052873	Enterobacter cloacae strain 3849 plasmid p3846III, complete sequence	75515-75537	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP032241	Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence	138375-138397	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_AP018757	Metakosakonia sp. MRY16-398 plasmid pMRY16-398_1, complete sequence	71908-71930	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NC_006625	Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence	85374-85396	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP026390	Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence	44008-44030	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP008899	Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence	185425-185447	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP047193	Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence	84048-84070	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP031575	Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence	233367-233389	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP032164	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence	101277-101299	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP047678	Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVF1 plasmid unnamed, complete sequence	90058-90080	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP047676	Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVL1 plasmid unnamed, complete sequence	90058-90080	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP025983	Enterobacteriaceae bacterium A-F18 plasmid pAF18_1, complete sequence	101604-101626	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP013215	Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence	250724-250746	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP029383	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence	119413-119435	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_AP019549	Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence	164360-164382	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP050276	Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence	275726-275748	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	52613-52635	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP052259	Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-1, complete sequence	106040-106062	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP026587	Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence	51437-51459	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_LR745046	Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166	96984-97006	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_LR745043	Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154	115656-115678	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_MK715436	Klebsiella pneumoniae subsp. pneumoniae strain SCNJ1 plasmid pVir-SCNJ1, complete sequence	180751-180773	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_MN058044	Klebsiella pneumoniae strain KP1677 plasmid pKP1677, complete sequence	140988-141010	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP016815	Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence	73197-73219	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP049047	Enterobacter hormaechei strain Y233 plasmid pIHI2-233, complete sequence	94082-94104	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_MG053312	Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence	67641-67663	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MT090958	Klebsiella pneumoniae strain KP18-2079 plasmid pKP18-2079_vir, complete sequence	40792-40814	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	MT118290	Pseudomonas phage Epa10, complete genome	14177-14199	2	0.913
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	KC787101	Mycobacterium phage 33D, partial genome	17312-17334	2	0.913
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	21024-21047	2	0.917
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	18854-18877	2	0.917
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1096444-1096467	2	0.917
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	2202213-2202236	2	0.917
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	2280709-2280732	2	0.917
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	MT723937	Gordonia phage JKSyngboy, complete genome	20058-20084	3	0.889
NZ_CP022577_3	3.8\|1644455\|24\|NZ_CP022577\|CRT	1644455-1644478	24	NZ_CP014599	Yangia sp. CCB-MM3 plasmid unnamed3, complete sequence	110878-110901	3	0.875
NZ_CP022577_3	3.8\|1644455\|24\|NZ_CP022577\|CRT	1644455-1644478	24	NZ_CP028945	Vibrio sp. dhg plasmid unnamed1, complete sequence	122425-122448	3	0.875
NZ_CP022577_4	4.2\|2765733\|24\|NZ_CP022577\|CRT	2765733-2765756	24	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	105500-105523	3	0.875
NZ_CP022577_4	4.2\|2765733\|24\|NZ_CP022577\|CRT	2765733-2765756	24	MH719194	Pseudomonas phage Ps60, complete genome	17612-17635	3	0.875
NZ_CP022577_4	4.2\|2765733\|24\|NZ_CP022577\|CRT	2765733-2765756	24	MK511059	Pseudomonas phage CF78, partial genome	17682-17705	3	0.875
NZ_CP022577_4	4.2\|2765733\|24\|NZ_CP022577\|CRT	2765733-2765756	24	MK511062	Pseudomonas phage CF127, partial genome	17686-17709	3	0.875
NZ_CP022577_4	4.2\|2765733\|24\|NZ_CP022577\|CRT	2765733-2765756	24	MK511061	Pseudomonas phage CF125, partial genome	17681-17704	3	0.875
NZ_CP022577_4	4.2\|2765733\|24\|NZ_CP022577\|CRT	2765733-2765756	24	JX495043	Pseudomonas phage JBD67, partial genome	16642-16665	3	0.875
NZ_CP022577_4	4.2\|2765733\|24\|NZ_CP022577\|CRT	2765733-2765756	24	LN898172	Pseudomonas phage vB_PaeS_PM105	17575-17598	3	0.875
NZ_CP022577_4	4.2\|2765733\|24\|NZ_CP022577\|CRT	2765733-2765756	24	MK511063	Pseudomonas phage CF177, partial genome	16804-16827	3	0.875
NZ_CP022577_4	4.2\|2765733\|24\|NZ_CP022577\|CRT	2765733-2765756	24	MN536027	Pseudomonas phage vB_Pae-SS2019XII, complete genome	2252-2275	3	0.875
NZ_CP022577_4	4.2\|2765733\|24\|NZ_CP022577\|CRT	2765733-2765756	24	JX495041	Pseudomonas phage JBD18, complete genome	16899-16922	3	0.875
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	120447-120476	3	0.9
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	24206-24235	3	0.9
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	44021-44050	3	0.9
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	62995-63024	3	0.9
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1403930-1403959	3	0.9
NZ_CP022577_5	5.17\|2855634\|24\|NZ_CP022577\|CRT	2855634-2855657	24	NC_010311	Streptomyces sp. HK1 plasmid pSHK1, complete sequence	130250-130273	3	0.875
NZ_CP022577_5	5.17\|2855634\|24\|NZ_CP022577\|CRT	2855634-2855657	24	NZ_CP026489	Streptomyces sp. 604F plasmid unnamed, complete sequence	134065-134088	3	0.875
NZ_CP022577_10	10.7\|3359047\|24\|NZ_CP022577\|CRT	3359047-3359070	24	NC_011987	Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence	35637-35660	3	0.875
NZ_CP022577_10	10.7\|3359047\|24\|NZ_CP022577\|CRT	3359047-3359070	24	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	161455-161478	3	0.875
NZ_CP022577_10	10.16\|3359527\|24\|NZ_CP022577\|CRT	3359527-3359550	24	MN103533	Mycobacterium phage Weirdo19, complete genome	26904-26927	3	0.875
NZ_CP022577_10	10.17\|3359572\|24\|NZ_CP022577\|CRT	3359572-3359595	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1931013-1931036	3	0.875
NZ_CP022577_10	10.17\|3359572\|24\|NZ_CP022577\|CRT	3359572-3359595	24	MN428050	Mycobacterium phage Apex, complete genome	66856-66879	3	0.875
NZ_CP022577_10	10.17\|3359572\|24\|NZ_CP022577\|CRT	3359572-3359595	24	NC_042035	Mycobacterium phage Zemanar, complete sequence	66569-66592	3	0.875
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1088836-1088859	3	0.875
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	428271-428294	3	0.875
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NC_022061	Mycobacterium phage KayaCho, complete genome	54386-54409	3	0.875
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP019938	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed1, complete sequence	212659-212682	3	0.875
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	427938-427961	3	0.875
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1996033-1996056	3	0.875
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	985412-985435	3	0.875
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1058931-1058954	3	0.875
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	41184-41207	3	0.875
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP054618	Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence	373463-373486	3	0.875
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	MK415401	Phage apr34_1789, complete genome	11948-11971	3	0.875
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	MK415401	Phage apr34_1789, complete genome	39191-39214	3	0.875
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	MK415401	Phage apr34_1789, complete genome	66320-66343	3	0.875
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_LR134451	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence	56824-56849	3	0.885
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	360267-360289	3	0.87
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	CP049262	Cronobacter sakazakii strain CS-09 plasmid pCsaCS09b, complete sequence	65353-65375	3	0.87
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1056097-1056119	3	0.87
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP016024	Ralstonia insidiosa strain ATCC 49129 plasmid pRI-1, complete sequence	164245-164267	3	0.87
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	341625-341647	3	0.87
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	AP014203	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C76-MedDCM-OCT-S35-C25, * SEQUENCING IN PROGRESS *	14236-14258	3	0.87
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	887752-887774	3	0.87
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	KJ680225	Uncultured bacterium plasmid PLAsvaD clone PLAsvaD-1, complete sequence	11452-11474	3	0.87
NZ_CP022577_13	13.7\|4173855\|23\|NZ_CP022577\|CRT	4173855-4173877	23	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1528049-1528071	3	0.87
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	35301-35324	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	291387-291410	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	325555-325578	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	655846-655869	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP044989	Deinococcus sp. AJ005 plasmid p380k, complete sequence	267879-267902	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	1875698-1875721	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	346568-346591	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	254516-254539	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP020897	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5a, complete sequence	246597-246620	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013524	Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence	327835-327858	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013553	Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence	325066-325089	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013586	Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence	339124-339147	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013559	Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence	335787-335810	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013576	Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence	336568-336591	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013548	Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence	336564-336587	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013528	Rhizobium phaseoli strain R723 plasmid pRphaR723a, complete sequence	334228-334251	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013533	Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence	336564-336587	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013538	Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence	329277-329300	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013543	Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence	340824-340847	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013564	Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence	325066-325089	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021368	Acidovorax carolinensis strain P4 plasmid pACP4.2, complete sequence	148853-148876	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013581	Rhizobium phaseoli strain N261 plasmid pRphaN261a, complete sequence	334231-334254	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013570	Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence	336568-336591	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021364	Acidovorax carolinensis strain P3 plasmid pACP3.2, complete sequence	11440-11463	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	21137-21160	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1301930-1301953	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1276369-1276392	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1369478-1369501	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	354438-354461	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1453767-1453790	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1456865-1456888	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	877468-877491	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	14409-14432	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	172006-172029	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	992654-992677	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	CP052389	Klebsiella pneumoniae strain C17KP0052 plasmid pC17KP0052-1	111819-111842	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	591834-591857	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP016453	Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence	778719-778742	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	18093-18116	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	368858-368881	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1433221-1433244	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1206221-1206244	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1301937-1301960	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	CU468217	Azospirillum brasilense bacteriophage Cd, complete genome	56616-56639	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_010355	Azospirillum phage Cd, complete genome	56616-56639	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1410926-1410949	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	222044-222067	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	427361-427384	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	1410904-1410927	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_007764	Rhizobium etli CFN 42 plasmid p42c, complete sequence	228267-228290	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	641369-641392	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021026	Rhizobium sp. TAL182 plasmid pRetTAL182b, complete sequence	258025-258048	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP020908	Rhizobium etli strain NXC12 plasmid pRetNXC12b, complete sequence	227510-227533	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	419355-419378	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	373597-373620	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	9852-9875	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013597	Rhizobium sp. N741 plasmid pRspN741b, complete sequence	292136-292159	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	422366-422389	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	416865-416888	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_021907	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1b, complete sequence	230035-230058	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013501	Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence	292502-292525	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013507	Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence	292136-292159	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013518	Rhizobium sp. N113 plasmid pRspN113a, complete sequence	292502-292525	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	164625-164648	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013491	Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence	292505-292528	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013513	Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence	313384-313407	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013496	Rhizobium sp. N621 plasmid pRspN621a, complete sequence	292505-292528	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013591	Rhizobium sp. N871 plasmid pRspN871a, complete sequence	292505-292528	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1083909-1083932	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	594657-594680	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	772752-772775	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	674210-674233	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	303720-303743	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1205658-1205681	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	568287-568310	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	216443-216466	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	437565-437588	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	447327-447350	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	182486-182509	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	504090-504113	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	189001-189024	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013603	Rhizobium sp. N731 plasmid pRspN731b, complete sequence	313384-313407	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	556202-556225	3	0.875
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1944556-1944579	3	0.875
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_LN831788	Streptomyces leeuwenhoekii strain type strain (C34 = DSM 42122 = NRRL B-24963) plasmid pSLE1, complete sequence	37853-37879	3	0.889
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1404466-1404492	4	0.852
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	408796-408822	4	0.852
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	872965-872991	4	0.852
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	817736-817762	4	0.852
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	NZ_CP050100	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b3, complete sequence	134253-134279	4	0.852
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	NZ_CP009439	Streptomyces glaucescens strain GLA.O plasmid pSglau1, complete sequence	64506-64532	4	0.852
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	448572-448598	4	0.852
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	351850-351876	4	0.852
NZ_CP022577_4	4.2\|2765733\|24\|NZ_CP022577\|CRT	2765733-2765756	24	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	473220-473243	4	0.833
NZ_CP022577_4	4.2\|2765733\|24\|NZ_CP022577\|CRT	2765733-2765756	24	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	138187-138210	4	0.833
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP054625	Cupriavidus gilardii strain FDAARGOS_639 plasmid unnamed1, complete sequence	22401-22430	4	0.867
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	92931-92960	4	0.867
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP018732	Xanthomonas gardneri strain ICMP 7383 plasmid pICMP7383.1, complete sequence	45657-45686	4	0.867
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP023976	Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence	134880-134912	4	0.879
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NC_003903	Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence	236159-236185	4	0.852
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	480868-480894	4	0.852
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NZ_CP049701	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence	734-760	4	0.852
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NZ_CP049701	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence	295647-295673	4	0.852
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NZ_CP049701	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence	416946-416972	4	0.852
NZ_CP022577_10	10.13\|3359374\|27\|NZ_CP022577\|CRT	3359374-3359400	27	NZ_CP050441	Tolypothrix sp. PCC 7910 plasmid unnamed1, complete sequence	21588-21614	4	0.852
NZ_CP022577_10	10.15\|3359479\|27\|NZ_CP022577\|CRT	3359479-3359505	27	NZ_CP018075	Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence	57662-57688	4	0.852
NZ_CP022577_10	10.17\|3359572\|24\|NZ_CP022577\|CRT	3359572-3359595	24	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	253003-253026	4	0.833
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP033583	Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence	153566-153589	4	0.833
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	2430241-2430264	4	0.833
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	2216018-2216041	4	0.833
NZ_CP022577_10	10.19\|3359666\|24\|NZ_CP022577\|CRT	3359666-3359689	24	NZ_CP041162	Leisingera aquaemixtae strain R2C4 plasmid unnamed6	26010-26033	4	0.833
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_DQ996271	Burkholderia glumae BGR1 plasmid pBGF3, complete sequence	15025-15050	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	493185-493210	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	65645-65670	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP026546	Cupriavidus metallidurans strain Ni-2 plasmid unnamed2	51548-51573	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	904666-904691	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	1012698-1012723	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	839293-839318	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	274169-274194	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	833395-833420	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	KT281796	Mycobacterium phage Zakhe101, complete genome	31092-31117	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	AY129335	Mycobacterium virus Corndog, complete genome	32037-32062	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	MK493325	Synechococcus phage S-RIM8 isolate RW_62_0316, complete genome	126816-126841	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	MK493322	Synechococcus phage S-RIM8 isolate RW_01_0115_WH8101, complete genome	126232-126257	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	KX349288	Synechococcus phage S-RIM8 isolate RW_08_0711, complete genome	126232-126257	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	MN428058	Mycobacterium phage Krili, complete genome	30504-30529	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	KX349286	Synechococcus phage S-RIM8 isolate RW_03_0807_WH8101, complete genome	126434-126459	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NC_004685	Mycobacterium phage Corndog, complete genome	32037-32062	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	JN698993	Mycobacterium phage Firecracker, complete genome	31190-31215	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	MK493324	Synechococcus phage S-RIM8 isolate RW_22_0214, complete genome	126230-126255	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	KX349290	Synechococcus phage S-RIM8 isolate RW_25_1112, complete genome	126816-126841	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	KX349287	Synechococcus phage S-RIM8 isolate RW_06_0613, complete genome	126816-126841	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	MN585964	Mycobacterium phage Blessica, complete genome	31307-31332	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NC_022057	Mycobacterium phage Catdawg, complete genome	30996-31021	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	MT818425	Mycobacterium phage NiebruSaylor, complete genome	30376-30401	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NC_022325	Mycobacterium phage Dylan, complete genome	31088-31113	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	MN428052	Mycobacterium phage Smooch, complete genome	32708-32733	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	858391-858416	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	857911-857936	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_AP022578	Mycolicibacterium aubagnense strain JCM 15296 plasmid pJCM15296, complete sequence	91147-91172	4	0.846
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NC_017590	Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence	129492-129517	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	72560-72585	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	91819-91844	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	380346-380371	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	373437-373462	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	583543-583568	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	591013-591038	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	1599-1624	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	636379-636404	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	164455-164480	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	70165-70190	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	128382-128407	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	110886-110911	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP015441	Erythrobacter atlanticus strain s21-N3 plasmid unnamed, complete sequence	172126-172151	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_LR134447	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence	87110-87135	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	282142-282167	4	0.846
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	62657-62682	4	0.846
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	389742-389773	4	0.875
NZ_CP022577_14	14.6\|4175176\|28\|NZ_CP022577\|CRT	4175176-4175203	28	NC_008712	Paenarthrobacter aurescens TC1 plasmid pTC1, complete sequence	304571-304598	4	0.857
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP035418	Leisingera sp. NJS204 plasmid unnamed1, complete sequence	36671-36694	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP038237	Leisingera sp. NJS201 plasmid unnamed3, complete sequence	98992-99015	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	449137-449160	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1451692-1451715	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	387125-387148	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1744538-1744561	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	LR134132	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 12	10708-10731	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	504872-504895	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	413337-413360	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	17298-17321	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	456993-457016	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	267198-267221	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	18955-18978	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	395965-395988	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	195123-195146	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1363739-1363762	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP054618	Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence	209300-209323	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	574427-574450	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP041043	Paracoccus sp. AK26 plasmid pAK3, complete sequence	26178-26201	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1043767-1043790	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP024583	Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence	120240-120263	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	41515-41538	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	47178-47201	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1043871-1043894	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP022191	Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence	368523-368546	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	43405-43428	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	43405-43428	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	43405-43428	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	122685-122708	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	43405-43428	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	392596-392619	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	409631-409654	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	MK494131	Mycobacterium phage GodPhather, complete genome	23250-23273	4	0.833
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	MH001450	Mycobacterium phage Jeon, complete genome	22992-23015	4	0.833
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	33469-33495	4	0.852
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	110878-110904	4	0.852
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	239569-239595	4	0.852
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	MN586047	Gordonia phage EMoore, complete genome	40681-40707	4	0.852
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	161496-161522	4	0.852
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_LR594663	Variovorax sp. RA8 plasmid 2	378846-378872	4	0.852
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	470375-470401	4	0.852
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	63908-63934	4	0.852
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP024940	Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence	661184-661210	4	0.852
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	MN657133	Cryobacterium sp. strain ANT_H10B plasmid pA10BH1, complete sequence	14846-14872	5	0.815
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	151977-152003	5	0.815
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	NZ_CP029834	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence	44267-44293	5	0.815
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	MK937603	Gordonia phage Bakery, complete genome	37715-37741	5	0.815
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	KM389402	UNVERIFIED: Pseudomonas phage F_HA1961sp/Pa1641 clone contig00002 genomic sequence	1379-1405	5	0.815
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	NC_003278	Pseudomonas phage phiCTX, complete genome	20233-20259	5	0.815
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	Y13918	Pseudomonas aeruginosa phage phi CTX DNA, complete genome	20233-20259	5	0.815
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	AB008550	Pseudomonas phage phiCTX DNA, complete genome	20233-20259	5	0.815
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	MK034952	Pseudomonas phage Dobby, complete genome	21003-21029	5	0.815
NZ_CP022577_3	3.7\|1644407\|30\|NZ_CP022577\|CRT	1644407-1644436	30	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1425504-1425533	5	0.833
NZ_CP022577_3	3.7\|1644407\|30\|NZ_CP022577\|CRT	1644407-1644436	30	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1378155-1378184	5	0.833
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	324020-324049	5	0.833
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	79089-79118	5	0.833
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP013631	Rhizobium sp. N324 plasmid pRspN324a, complete sequence	233390-233419	5	0.833
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP024582	Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence	357658-357687	5	0.833
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP025188	Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence	69646-69675	5	0.833
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	308125-308154	5	0.833
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	586737-586766	5	0.833
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	984258-984287	5	0.833
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	944302-944331	5	0.833
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1598942-1598971	5	0.833
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	102920-102949	5	0.833
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	369775-369804	5	0.833
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	650765-650794	5	0.833
NZ_CP022577_5	5.6\|2855127\|27\|NZ_CP022577\|CRT	2855127-2855153	27	MF415411	Klebsiella phage KPN U2874, complete genome	9606-9632	5	0.815
NZ_CP022577_5	5.6\|2855127\|27\|NZ_CP022577\|CRT	2855127-2855153	27	MF476924	Klebsiella phage YMC15/11/N53_KPN_BP, complete genome	9606-9632	5	0.815
NZ_CP022577_5	5.6\|2855127\|27\|NZ_CP022577\|CRT	2855127-2855153	27	MF415413	Klebsiella phage KPN N54, complete genome	9606-9632	5	0.815
NZ_CP022577_5	5.6\|2855127\|27\|NZ_CP022577\|CRT	2855127-2855153	27	MF415410	Klebsiella phage KPN N137, complete genome	9606-9632	5	0.815
NZ_CP022577_5	5.6\|2855127\|27\|NZ_CP022577\|CRT	2855127-2855153	27	MG835858	Klebsiella phage KPN N98, complete genome	9606-9632	5	0.815
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	320487-320516	5	0.833
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	791142-791171	5	0.833
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	622330-622359	5	0.833
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1218686-1218715	5	0.833
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	172926-172955	5	0.833
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1830574-1830603	5	0.833
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	275363-275392	5	0.833
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	213085-213114	5	0.833
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	32065-32097	5	0.848
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NZ_AP022611	Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574	191006-191032	5	0.815
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	KM389325	UNVERIFIED: Pseudomonas phage F_ET2439sp/ET602 clone ctg7180000000169 genomic sequence	195-221	5	0.815
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	201261-201287	5	0.815
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	52934-52960	5	0.815
NZ_CP022577_10	10.13\|3359374\|27\|NZ_CP022577\|CRT	3359374-3359400	27	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	1267859-1267885	5	0.815
NZ_CP022577_10	10.13\|3359374\|27\|NZ_CP022577\|CRT	3359374-3359400	27	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	475069-475095	5	0.815
NZ_CP022577_10	10.15\|3359479\|27\|NZ_CP022577\|CRT	3359479-3359505	27	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	475069-475095	5	0.815
NZ_CP022577_10	10.18\|3359617\|28\|NZ_CP022577\|CRT	3359617-3359644	28	NZ_CP011276	Planctomyces sp. SH-PL62 plasmid pPL62-3, complete sequence	45340-45367	5	0.821
NZ_CP022577_10	10.18\|3359617\|28\|NZ_CP022577\|CRT	3359617-3359644	28	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	180588-180615	5	0.821
NZ_CP022577_10	10.18\|3359617\|28\|NZ_CP022577\|CRT	3359617-3359644	28	CP048434	Collinsella aerofaciens ATCC 25986 strain JCM 10188 plasmid putative_pCaero1, complete sequence	1248-1275	5	0.821
NZ_CP022577_10	10.18\|3359617\|28\|NZ_CP022577\|CRT	3359617-3359644	28	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	547608-547635	5	0.821
NZ_CP022577_10	10.18\|3359617\|28\|NZ_CP022577\|CRT	3359617-3359644	28	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	46144-46171	5	0.821
NZ_CP022577_10	10.18\|3359617\|28\|NZ_CP022577\|CRT	3359617-3359644	28	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	293491-293518	5	0.821
NZ_CP022577_10	10.18\|3359617\|28\|NZ_CP022577\|CRT	3359617-3359644	28	NZ_CP043499	Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence	1836376-1836403	5	0.821
NZ_CP022577_10	10.18\|3359617\|28\|NZ_CP022577\|CRT	3359617-3359644	28	JN698994	Mycobacterium phage DS6A, complete genome	26497-26524	5	0.821
NZ_CP022577_12	12.1\|4153631\|29\|NZ_CP022577\|CRT	4153631-4153659	29	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	794861-794889	5	0.828
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	622905-622933	5	0.828
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	366233-366261	5	0.828
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350096-350124	5	0.828
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP022195	Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence	107935-107963	5	0.828
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	1246783-1246811	5	0.828
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1098549-1098577	5	0.828
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	806571-806596	5	0.808
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	450243-450268	5	0.808
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	454769-454794	5	0.808
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	453978-454003	5	0.808
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	364700-364725	5	0.808
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1448373-1448398	5	0.808
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	NZ_CP045120	Rubrobacter sp. SCSIO 52909 plasmid unnamed1, complete sequence	19670-19695	5	0.808
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	MT855965	Microcystis phage vB_MaeS-yong1, complete genome	36712-36737	5	0.808
NZ_CP022577_12	12.7\|4154120\|26\|NZ_CP022577\|CRT	4154120-4154145	26	MN585977	Mycobacterium phage Atcoo, complete genome	13801-13826	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	90829-90854	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	94051-94076	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	90196-90221	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	91954-91979	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	99406-99431	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	378246-378271	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	377376-377401	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	382104-382129	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	580909-580934	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	585397-585422	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	2589-2614	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	637369-637394	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	634147-634172	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	1464-1489	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	3222-3247	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	628792-628817	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	636244-636269	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	638002-638027	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	114567-114592	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	116667-116692	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	118425-118450	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1339243-1339268	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	206048-206073	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032676	Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence	76043-76068	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	941372-941397	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	109907-109932	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	598229-598254	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP014802	Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence	1547-1572	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP039640	Azospirillum sp. TSH100 plasmid p1, complete sequence	147207-147232	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP041042	Paracoccus sp. AK26 plasmid pAK4, complete sequence	65044-65069	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NC_019959	Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence	37871-37896	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_MN366361	Bacterium plasmid pALTS33, complete sequence	14146-14171	5	0.808
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032350	Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence	144699-144724	5	0.808
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP022569	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence	77729-77760	5	0.844
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	475336-475367	5	0.844
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	55536-55567	5	0.844
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	280084-280115	5	0.844
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	254573-254604	5	0.844
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	260674-260705	5	0.844
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	486394-486425	5	0.844
NZ_CP022577_14	14.6\|4175176\|28\|NZ_CP022577\|CRT	4175176-4175203	28	NC_034248	Rhizobium phage RHEph10, complete genome	882-909	5	0.821
NZ_CP022577_15	15.1\|4303660\|27\|NZ_CP022577\|CRT	4303660-4303686	27	MN583270	Pseudomonas aeruginosa strain NK546 plasmid pNK546b, complete sequence	202881-202907	5	0.815
NZ_CP022577_15	15.1\|4303660\|27\|NZ_CP022577\|CRT	4303660-4303686	27	NZ_MN433457	Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence	356185-356211	5	0.815
NZ_CP022577_15	15.1\|4303660\|27\|NZ_CP022577\|CRT	4303660-4303686	27	MF344569	Pseudomonas aeruginosa plasmid p12939-PER, complete sequence	328577-328603	5	0.815
NZ_CP022577_15	15.6\|4303954\|27\|NZ_CP022577\|CRT	4303954-4303980	27	NZ_CP030128	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence	347008-347034	5	0.815
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP041156	Leisingera aquaemixtae strain R2C4 plasmid unnamed1, complete sequence	134619-134642	5	0.792
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP016620	Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence	403908-403931	5	0.792
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	29587-29610	5	0.792
NZ_CP022577_15	15.7\|4304002\|24\|NZ_CP022577\|CRT	4304002-4304025	24	NZ_CP016619	Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence	268829-268852	5	0.792
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	NC_005241	Cupriavidus necator H16 megaplasmid pHG1, complete sequence	2099-2125	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	NZ_CP039289	Cupriavidus necator H16 plasmid pHG1, complete sequence	2099-2125	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MK359320	Mycobacterium phage Cookies, complete genome	58413-58439	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	KX611831	Mycobacterium phage Pharsalus, complete genome	58834-58860	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	NC_041844	Mycobacterium phage Optimus, complete genome	77610-77636	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MK967379	Mycobacterium phage HokkenD, complete genome	80092-80118	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MH230878	Mycobacterium phage Oogway, complete genome	40771-40797	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MN585999	Mycobacterium phage Briton15, complete genome	41723-41749	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MG962370	Mycobacterium phage Kykar, complete genome	40271-40297	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MH576975	Mycobacterium phage Target, complete genome	39125-39151	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MK359331	Mycobacterium phage Rajelicia, complete genome	41672-41698	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MH744414	Mycobacterium phage Arcanine, complete genome	41138-41164	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	KF493880	Mycobacterium phage HanShotFirst, complete genome	41672-41698	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	JF937103	Mycobacterium virus Museum, complete genome	41210-41236	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MH576971	Mycobacterium phage Arlo, complete genome	39521-39547	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MH697575	Mycobacterium phage Adahisdi, complete genome	41184-41210	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	KJ409696	Mycobacterium phage Lamina13, complete genome	41059-41085	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	NC_028784	Mycobacterium phage Tasp14, complete genome	41683-41709	5	0.815
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	KT259047	Mycobacterium phage Rufus, complete genome	40308-40334	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	207153-207179	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	994943-994969	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP024424	Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence	212744-212770	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP020440	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence	94785-94811	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	585833-585859	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	317095-317121	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	635-661	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	247982-248008	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP044082	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence	227894-227920	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP031080	Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence	119527-119553	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	181599-181625	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	506639-506665	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP042276	Agrobacterium tumefaciens strain 186 plasmid pAt, complete sequence	278724-278750	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_LR134461	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence	90925-90951	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_007491	Rhodococcus erythropolis PR4 plasmid pREL1, complete sequence	169292-169318	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP029339	Streptomyces sp. SM17 plasmid pSM17A, complete sequence	131132-131158	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	99679-99705	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	100069-100095	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP011297	Rhodococcus erythropolis strain BG43 plasmid pRLLBG43, complete sequence	184399-184425	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	1021631-1021657	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP017304	Rhodococcus sp. YL-1 plasmid pYLL2 sequence	153165-153191	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_005073	Rhodococcus erythropolis linear plasmid pBD2, complete sequence	91758-91784	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP016820	Rhodococcus sp. p52 plasmid pDF02, complete sequence	159620-159646	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP042915	Rhodococcus qingshengii strain RL1 plasmid unnamed2	439701-439727	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP042915	Rhodococcus qingshengii strain RL1 plasmid unnamed2	93748-93774	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP042915	Rhodococcus qingshengii strain RL1 plasmid unnamed2	252263-252289	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_010311	Streptomyces sp. HK1 plasmid pSHK1, complete sequence	38778-38804	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP015203	Rhodococcus sp. 008 plasmid pR8L1, complete sequence	126191-126217	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	286156-286182	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	CP000385	Mycobacterium sp. MCS Plasmid1, complete sequence	68541-68567	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	99012-99038	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	396755-396781	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	975997-976023	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	39259-39285	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP046100	Rhodococcus sp. AQ5-07 plasmid unnamed1, complete sequence	42420-42446	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	951354-951380	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	975997-976023	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP014942	Rhodococcus sp. BH4 plasmid, complete sequence	129884-129910	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP014942	Rhodococcus sp. BH4 plasmid, complete sequence	333630-333656	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP017300	Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence	273293-273319	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP017303	Rhodococcus sp. YL-1 plasmid pYLL1 sequence	224386-224412	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	7080-7106	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	546501-546527	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP050125	Rhodococcus erythropolis strain KB1 plasmid plas1, complete sequence	123696-123722	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_008704	Mycobacterium sp. KMS plasmid pMKMS02, complete sequence	94600-94626	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP026489	Streptomyces sp. 604F plasmid unnamed, complete sequence	57775-57801	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP022566	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence	175596-175622	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP045549	Streptomyces sp. SYP-A7193 plasmid unnamed2, complete sequence	29547-29573	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP034156	Rhodococcus sp. NJ-530 plasmid unnamed4, complete sequence	105961-105987	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP034156	Rhodococcus sp. NJ-530 plasmid unnamed4, complete sequence	426971-426997	5	0.815
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP032357	Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence	152523-152549	5	0.815
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	MN234199	Mycobacterium phage Ekdilam, complete genome	53598-53624	6	0.778
NZ_CP022577_3	3.6\|1644362\|27\|NZ_CP022577\|CRT	1644362-1644388	27	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	211346-211372	6	0.778
NZ_CP022577_3	3.7\|1644407\|30\|NZ_CP022577\|CRT	1644407-1644436	30	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	262130-262159	6	0.8
NZ_CP022577_3	3.7\|1644407\|30\|NZ_CP022577\|CRT	1644407-1644436	30	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1624787-1624816	6	0.8
NZ_CP022577_3	3.7\|1644407\|30\|NZ_CP022577\|CRT	1644407-1644436	30	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1624922-1624951	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	225451-225480	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	330490-330519	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	554429-554458	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	278609-278638	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	542117-542146	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	442774-442803	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	121721-121750	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	102532-102561	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	742909-742938	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	137512-137541	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	571171-571200	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	375834-375863	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP034473	Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_4, complete sequence	18571-18600	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP034478	Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_4, complete sequence	62171-62200	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP017592	Pantoea stewartii subsp. stewartii DC283 plasmid ppDSJ01, complete sequence	7329-7358	6	0.8
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP015989	Sphingobium sp. EP60837 plasmid pEP2, complete sequence	42967-42996	6	0.8
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	281164-281193	6	0.8
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	230942-230971	6	0.8
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	283048-283077	6	0.8
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1096466-1096495	6	0.8
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1067569-1067598	6	0.8
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	MH424444	Salmonella virus VSiP, complete genome	6940-6969	6	0.8
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP016082	Streptomyces sp. SAT1 plasmid unnamed2, complete sequence	208014-208043	6	0.8
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	MT012729	Salmonella phage vB_SenTO17, complete genome	801-830	6	0.8
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	AP017924	Ralstonia phage RP12 DNA, complete genome	277924-277953	6	0.8
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	44850-44879	6	0.8
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_011887	Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence	451314-451343	6	0.8
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	237363-237392	6	0.8
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	609724-609753	6	0.8
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	635366-635395	6	0.8
NZ_CP022577_5	5.12\|2855412\|30\|NZ_CP022577\|CRT	2855412-2855441	30	MN862068	Brevundimonas phage vB_BsubS-Delta, complete genome	6065-6094	6	0.8
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NZ_CP047175	Rathayibacter sp. VKM Ac-2760 plasmid unnamed2, complete sequence	54072-54101	6	0.8
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP014769	Hymenobacter sp. PAMC 26554 plasmid unnamed1, complete sequence	135076-135108	6	0.818
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	GQ141189	Bifidobacterium phage Bbif-1, complete sequence	38062-38092	6	0.806
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	88882-88911	6	0.8
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	4449-4478	6	0.8
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	287851-287877	6	0.778
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NZ_AP022334	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence	130130-130156	6	0.778
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NC_021279	Mycobacteroides abscessus subsp. bolletii 50594 plasmid 2, complete sequence	36882-36908	6	0.778
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NZ_CP024582	Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence	282765-282791	6	0.778
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NC_019847	Sinorhizobium meliloti GR4 plasmid pRmeGR4b, complete sequence	101111-101137	6	0.778
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NZ_AP022622	Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1	1096-1122	6	0.778
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NZ_AP022622	Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1	98302-98328	6	0.778
NZ_CP022577_10	10.6\|3358999\|27\|NZ_CP022577\|CRT	3358999-3359025	27	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1525220-1525246	6	0.778
NZ_CP022577_12	12.1\|4153631\|29\|NZ_CP022577\|CRT	4153631-4153659	29	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	529162-529190	6	0.793
NZ_CP022577_12	12.1\|4153631\|29\|NZ_CP022577\|CRT	4153631-4153659	29	MK305891	Streptomyces phage Gibson, complete genome	21789-21817	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	487068-487096	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	621642-621670	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP014799	Salipiger profundus strain JLT2016 plasmid pTPRO3, complete sequence	3172-3200	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	9795-9823	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	KC736071	Mycobacterium phage WIVsmall, complete genome	29696-29724	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350105-350133	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_012852	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132504, complete sequence	338806-338834	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP048283	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence	53689-53717	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP014600	Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence	174759-174787	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_031109	Gordonia phage Jumbo, complete genome	54641-54669	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK814754	Mycobacterium phage Sumter, complete genome	28142-28170	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK814754	Mycobacterium phage Sumter, complete genome	28640-28668	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MN369739	Mycobacterium phage Kenuha5, complete genome	22589-22617	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK494110	Mycobacterium phage SwagPigglett, complete genome	24954-24982	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH479919	Mycobacterium phage Moose, complete genome	28919-28947	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	KY012363	Mycobacterium phage Empress, complete genome	26300-26328	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK967397	Mycobacterium phage Mahavrat, complete genome	24815-24843	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH669010	Mycobacterium phage PHappiness, complete genome	24929-24957	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH669003	Mycobacterium phage Girr, complete genome	24926-24954	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MG925342	Mycobacterium phage Forsytheast, complete genome	28919-28947	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK359354	Mycobacterium phage PinkPlastic, complete genome	28500-28528	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH632118	Mycobacterium phage Zeeculate, complete genome	29465-29493	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MG872836	Mycobacterium phage Fajezeel, complete genome	29005-29033	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MN585999	Mycobacterium phage Briton15, complete genome	28984-29012	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MG872841	Mycobacterium phage Priscilla, complete genome	25144-25172	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH155865	Mycobacterium phage BobaPhett, complete genome	25107-25135	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MN585985	Mycobacterium phage Watermelon, complete genome	29572-29600	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	KY348865	Mycobacterium phage Bubbles123, complete genome	25541-25569	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MN428047	Mycobacterium phage Doomphist, complete genome	24963-24991	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH651169	Mycobacterium phage Burwell21, complete genome	25141-25169	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MG925344	Mycobacterium phage Ichabod, complete genome	28890-28918	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK359315	Mycobacterium phage MisterCuddles, complete genome	24926-24954	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH697581	Mycobacterium phage Crispicous1, complete genome	28240-28268	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK359299	Mycobacterium phage Petp2012, complete genome	29653-29681	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH371120	Mycobacterium phage OlympiaSaint, complete genome	25330-25358	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MF190168	Mycobacterium phage Spoonbill, complete genome	25141-25169	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MG925340	Mycobacterium phage Corvo, complete genome	29641-29669	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MT771340	Mycobacterium phage Jorgensen, complete genome	28477-28505	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MN735433	Mycobacterium phage Scottish, complete genome	26252-26280	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MG920060	Mycobacterium phage Bob3, complete genome	28226-28254	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH338239	Mycobacterium phage Mryolo, complete genome	28445-28473	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH651183	Mycobacterium phage Nivrat, complete genome	25115-25143	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_021297	Mycobacterium phage PattyP, complete genome	28982-29010	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	KY224001	Mycobacterium phage Blue, complete genome	29185-29213	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MF919508	Mycobacterium phage ILeeKay, complete genome	28856-28884	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	AY500152	Mycobacteriophage U2, complete genome	28818-28846	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MG770213	Mycobacterium phage OldBen, complete genome	24921-24949	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK967387	Mycobacterium phage Big3, complete genome	29344-29372	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH651188	Mycobacterium phage Ruby, complete genome	24926-24954	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_041989	Mycobacterium phage Shauna1, complete genome	22606-22634	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	JN020140	Mycobacterium virus MrGordo, complete genome	28429-28457	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH834617	Mycobacterium phage Lizziana, complete genome	25116-25144	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	EU744251	Mycobacterium phage Jasper, complete genome	28533-28561	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK524499	Mycobacterium phage Tripl3t, complete genome	29563-29591	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK820638	Mycobacterium phage HermioneGrange, complete genome	28614-28642	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_041988	Mycobacterium phage ShiLan, complete genome	25142-25170	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	KX522649	Mycobacterium phage Bircsak, complete genome	29189-29217	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK524517	Mycobacterium phage James, complete genome	25107-25135	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK305886	Mycobacterium phage Poenanya, complete genome	24963-24991	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	JN859129	Mycobacterium virus DotProduct, complete genome	24830-24858	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MG962372	Mycobacterium phage McGuire, complete genome	28727-28755	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK305893	Mycobacterium phage Beatrix, complete genome	30124-30152	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK016494	Mycobacterium phage Filuzino, complete genome	24946-24974	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	KM066034	Mycobacterium phage Inventum, complete genome	25082-25110	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MN586011	Mycobacterium phage LilMoolah, complete genome	25241-25269	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	KT438500	Mycobacterium phage Pari, complete genome	28446-28474	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH338238	Mycobacterium phage Michley, complete genome	28566-28594	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH399784	Mycobacterium phage NormanBulbieJr, complete genome	25130-25158	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MT310893	Mycobacterium phage DRBy19, complete genome	24977-25005	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH399771	Mycobacterium phage ByChance, complete genome	25118-25146	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	KX522943	Mycobacterium phage Gompeii16, complete genome	29190-29218	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	KY702574	Mycobacterium phage Kingsley, complete genome	22409-22437	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH450133	Mycobacterium phage SwissCheese, complete genome	29419-29447	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_009877	Mycobacterium phage U2, complete genome	28818-28846	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	KJ025956	Mycobacterium phage Saal, complete genome	24931-24959	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MN813700	Mycobacterium phage Atkinbua, complete genome	29150-29178	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_024136	Mycobacterium phage Seabiscuit, complete genome	28727-28755	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MN369751	Mycobacterium phage TDanisky, complete genome	24977-25005	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MT639644	Mycobacterium phage MaryBeth, complete genome	28847-28875	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MT639654	Mycobacterium phage Jerm2, complete genome	28880-28908	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH590602	Mycobacterium phage Gorge, complete genome	25111-25139	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	JF937108	Mycobacterium phage Switzer, complete genome	28833-28861	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	JN660814	Mycobacterium phage Dreamboat, complete genome	28647-28675	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_011054	Mycobacterium phage Boomer, complete genome	24638-24666	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH669011	Mycobacterium phage PherrisBueller, complete genome	28556-28584	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_023687	Mycobacterium phage Bruns, complete genome	28664-28692	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK310141	Mycobacterium phage Fenn, complete genome	30323-30351	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	JF937103	Mycobacterium virus Museum, complete genome	28773-28801	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH669005	Mycobacterium phage JoeyJr, complete genome	25119-25147	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_028654	Mycobacterium phage Sparkdehlily, complete genome	24977-25005	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK524523	Mycobacterium phage Naira, complete genome	30370-30398	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH450113	Mycobacterium phage BigMau, complete genome	28880-28908	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MN444869	Mycobacterium phage DreamCatcher, complete genome	30058-30086	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_023695	Mycobacterium phage Violet, complete genome	29236-29264	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MG812495	Mycobacterium phage Pippin, complete genome	29064-29092	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_023726	Mycobacterium phage Euphoria, complete genome	28737-28765	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MG812489	Mycobacterium phage Greg, complete genome	29005-29033	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MT310897	Mycobacterium phage Manatee, complete genome	28435-28463	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH155871	Mycobacterium phage Mattes, complete genome	25107-25135	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MN204502	Mycobacterium phage KingMidas, complete genome	26251-26279	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_022068	Mycobacteriophage Daenerys, complete genome	24951-24979	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK310142	Mycobacterium phage MetalQZJ, complete genome	28847-28875	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	KT895281	Mycobacterium phage Cabrinians, complete genome	25135-25163	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_031041	Mycobacterium phage Papez, complete genome	30400-30428	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH513971	Mycobacterium phage Hope4ever, complete genome	29092-29120	6	0.793
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH450130	Mycobacterium phage Rohr, complete genome	28919-28947	6	0.793
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	135403-135428	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	94486-94511	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	377811-377836	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	633712-633737	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	9254-9279	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	58977-59002	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	48043-48068	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	117792-117817	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	114132-114157	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	303401-303426	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP045303	Azotobacter salinestris strain KACC 13899 plasmid unnamed1, complete sequence	270828-270853	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	820542-820567	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	40667-40692	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP021127	Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence	423227-423252	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	440801-440826	6	0.769
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP014598	Yangia sp. CCB-MM3 plasmid unnamed2, complete sequence	73325-73350	6	0.769
NZ_CP022577_12	12.12\|4154507\|29\|NZ_CP022577\|CRT	4154507-4154535	29	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1269400-1269428	6	0.793
NZ_CP022577_12	12.12\|4154507\|29\|NZ_CP022577\|CRT	4154507-4154535	29	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2357907-2357935	6	0.793
NZ_CP022577_12	12.12\|4154507\|29\|NZ_CP022577\|CRT	4154507-4154535	29	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	448301-448329	6	0.793
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	AP017627	Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome	126742-126773	6	0.812
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	1287244-1287275	6	0.812
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	35379-35410	6	0.812
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	1145460-1145491	6	0.812
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP018466	Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.3, complete sequence	26645-26676	6	0.812
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	102513-102544	6	0.812
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP020976	Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pA	31697-31728	6	0.812
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP020965	Xanthomonas phaseoli pv. phaseoli strain CFBP412 plasmid pA, complete sequence	14916-14947	6	0.812
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP018727	Xanthomonas vesicatoria ATCC 35937 strain LMG911 plasmid pLMG911.2, complete sequence	16476-16507	6	0.812
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NC_012853	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence	213684-213715	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	24060-24091	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	27512-27543	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	164930-164961	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	326642-326673	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1773789-1773820	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	298129-298160	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	318546-318577	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	333102-333133	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	301273-301304	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	362911-362942	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210636-2210667	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	454698-454729	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	114578-114609	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	303386-303417	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	913358-913389	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	11036-11067	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	302533-302564	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	683734-683765	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	687348-687379	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	311647-311678	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	299307-299338	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	298391-298422	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	315320-315351	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	295588-295619	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	299550-299581	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	302550-302581	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	315320-315351	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	317013-317044	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	301318-301349	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	362983-363014	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	317013-317044	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	301318-301349	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	317013-317044	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	317013-317044	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	301318-301349	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	301318-301349	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	301318-301349	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1795331-1795362	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	311630-311661	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	311600-311631	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	306151-306182	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	304280-304311	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	299829-299860	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	317013-317044	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	315314-315345	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	301318-301349	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1777383-1777414	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1777383-1777414	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	82570-82601	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022571	Mycolicibacterium poriferae strain JCM 12603 plasmid pJCM12603, complete sequence	68738-68769	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	364384-364415	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1639384-1639415	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	619974-620005	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	2029088-2029119	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1292463-1292494	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	89190-89221	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	192209-192240	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	780405-780436	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	315319-315350	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	294173-294204	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	315320-315351	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	294176-294207	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	315320-315351	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	315320-315351	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	294176-294207	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	315320-315351	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	294176-294207	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	294176-294207	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	294176-294207	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	315320-315351	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	315320-315351	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	315320-315351	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_031109	Gordonia phage Jumbo, complete genome	20059-20090	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	929944-929975	6	0.812
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	209775-209806	6	0.812
NZ_CP022577_14	14.6\|4175176\|28\|NZ_CP022577\|CRT	4175176-4175203	28	LN997844	Streptomyces reticuli genome assembly TUE45, plasmid : III	46922-46949	6	0.786
NZ_CP022577_14	14.6\|4175176\|28\|NZ_CP022577\|CRT	4175176-4175203	28	DQ115854	Cyanobacteria phage AS-1 contig_47 genomic sequence	815-842	6	0.786
NZ_CP022577_14	14.6\|4175176\|28\|NZ_CP022577\|CRT	4175176-4175203	28	NC_009717	Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence	86709-86736	6	0.786
NZ_CP022577_14	14.6\|4175176\|28\|NZ_CP022577\|CRT	4175176-4175203	28	NZ_CP031752	Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence	175180-175207	6	0.786
NZ_CP022577_15	15.1\|4303660\|27\|NZ_CP022577\|CRT	4303660-4303686	27	NC_048759	Serratia phage MTx, partial genome	50157-50183	6	0.778
NZ_CP022577_15	15.6\|4303954\|27\|NZ_CP022577\|CRT	4303954-4303980	27	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	319826-319852	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MG872843	Mycobacterium phage Sotrice96, complete genome	58962-58988	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MT723943	Mycobacterium phage Cactus, complete genome	58219-58245	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MT114165	Mycobacterium phage BadStone, complete genome	58858-58884	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	KF493883	Mycobacterium phage Mosby, complete genome	58434-58460	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MF919529	Mycobacterium phage Sassay, complete genome	57396-57422	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MK359343	Mycobacterium phage Pollywog, complete genome	43646-43672	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	KU865303	Mycobacterium phage TeardropMSU, complete genome	58043-58069	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	KR080204	Mycobacterium phage Mindy, complete genome	58182-58208	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	NC_029079	Mycobacterium phage Dusk, complete genome	58518-58544	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	NC_022065	Mycobacterium phage Contagion, complete genome	58434-58460	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	KX817173	Mycobacterium phage Tuco, complete genome	60123-60149	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MT684595	Mycobacterium phage Mova, complete genome	43328-43354	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	KF188414	Mycobacterium phage ABCat, complete genome	59289-59315	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MF919540	Mycobacterium phage Willez, complete genome	57396-57422	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MN234212	Mycobacterium phage Paphu, complete genome	40417-40443	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MK061415	Mycobacterium phage Rhynn, complete genome	39582-39608	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MK524531	Mycobacterium phage Rutherferd, complete genome	41404-41430	6	0.778
NZ_CP022577_15	15.11\|4304224\|27\|NZ_CP022577\|CRT	4304224-4304250	27	MN617845	Mycobacterium phage BaconJack, complete genome	42888-42914	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	330036-330062	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_002699	Frankia sp. CpI1 plasmid pFQ12, complete plasmid sequence	8359-8385	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	501002-501028	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP015585	Roseomonas gilardii strain U14-5 plasmid 1, complete sequence	229195-229221	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	113102-113128	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	506092-506118	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	122717-122743	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	103719-103745	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	109506-109532	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	103719-103745	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	398793-398819	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	203705-203731	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	641102-641128	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	581085-581111	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	2350438-2350464	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP013069	Pannonibacter phragmitetus strain 31801 plasmid p.p-1, complete sequence	118179-118205	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_016115	Streptomyces pratensis ATCC 33331 plasmid pSFLA02, complete sequence	106743-106769	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1759817-1759843	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	557163-557189	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP015040	Rhodovulum sp. P5 plasmid pRGUI01, complete sequence	15924-15950	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	271657-271683	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP042268	Pseudomonas aeruginosa strain HOU1 plasmid pHOU1-1, complete sequence	2903-2929	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP045074	Paracoccus kondratievae strain BJQ0001 plasmid unnamed1, complete sequence	455498-455524	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_022995	Burkholderia sp. M701 plasmid pM7012 DNA, complete sequence	330124-330150	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP009975	Pseudomonas putida S12 plasmid pTTS12, complete sequence	323550-323576	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	731394-731420	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	213993-214019	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	385369-385395	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	1509591-1509617	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	107589-107615	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP016080	Mesorhizobium loti NZP2037 plasmid pML2037, complete sequence	121758-121784	6	0.778
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_022739	Pseudomonas sp. VLB120 plasmid pSTY, complete sequence	113279-113305	6	0.778
NZ_CP022577_15	15.18\|4304716\|36\|NZ_CP022577\|CRT	4304716-4304751	36	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	2067764-2067799	6	0.833
NZ_CP022577_4	4.1\|2765679\|36\|NZ_CP022577\|CRT	2765679-2765714	36	KY087993	Mycobacterium phage Hammy, complete genome	24351-24386	7	0.806
NZ_CP022577_4	4.1\|2765679\|36\|NZ_CP022577\|CRT	2765679-2765714	36	MF140398	Mycobacterium phage Amohnition, complete genome	24438-24473	7	0.806
NZ_CP022577_4	4.1\|2765679\|36\|NZ_CP022577\|CRT	2765679-2765714	36	MF140406	Mycobacterium phage DarthP, complete genome	24360-24395	7	0.806
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1096468-1096497	7	0.767
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	288572-288601	7	0.767
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_LT960615	Hartmannibacter diazotrophicus strain E19T plasmid HDIAp1, complete sequence	21203-21232	7	0.767
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2461296-2461325	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	349171-349200	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	MF158037	Salmonella phage St162, complete genome	25966-25995	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	239358-239387	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	227351-227380	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP041164	Leisingera aquaemixtae strain R2C4 plasmid unnamed3, complete sequence	74429-74458	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP017759	Cupriavidus necator strain NH9 plasmid pENH92, complete sequence	12410-12439	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	MF158036	Salmonella phage St161, complete genome	17940-17969	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NC_009339	Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence	151391-151420	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP039425	Citricoccus sp. SGAir0253 plasmid unnamed1, complete sequence	132578-132607	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP039430	Citricoccus sp. SGAir0453 plasmid unnamed1, complete sequence	132576-132605	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	KC139518	Salmonella phage FSL SP-031, complete genome	25899-25928	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	KC139662	Salmonella phage FSL SP-038 phage structural protein gene, partial cds; and head morphogenesis protein, hypothetical proteins, and coat protein genes, complete cds	4042-4071	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	KC139557	Salmonella phage FSL SP-049 hypothetical proteins, coat protein, hypothetical protein, putative tail protein, and hypothetical proteins genes, complete cds	1444-1473	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	MN070121	Salmonella phage Shemara, complete genome	7480-7509	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP019603	Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence	371287-371316	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NC_023136	Leisingera methylohalidivorans DSM 14336 plasmid unnamed, complete sequence	230364-230393	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NC_008703	Mycobacterium sp. KMS plasmid pMKMS01, complete sequence	104962-104991	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	233172-233201	7	0.767
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	MH697592	Mycobacterium phage Rando14, complete genome	23510-23539	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP032827	Sphingomonas sp. YZ-8 plasmid unnamed2, complete sequence	1586-1615	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	459240-459269	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279887	Mycobacterium phage Timmi, complete genome	23016-23045	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH651175	Mycobacterium phage Gophee, complete genome	23288-23317	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	GQ303264	Mycobacterium phage Puhltonio, complete genome	23309-23338	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MG925339	Mycobacterium phage Chunky, complete genome	23305-23334	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	GU247134	Mycobacterium phage Scoot17C, complete genome	23299-23328	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KX683293	Mycobacterium phage Daffy, complete genome	23025-23054	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279888	Mycobacterium phage TomBombadil, complete genome	23301-23330	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JF957056	Mycobacterium phage Thora, complete genome	23307-23336	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MT316463	Mycobacterium phage Slatt, complete genome	23313-23342	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH651184	Mycobacterium phage Phareon, complete genome	23009-23038	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JN006063	Mycobacterium phage Serendipity, complete genome	23324-23353	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH779500	Mycobacterium phage Crownjwl, complete genome	23072-23101	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH230875	Mycobacterium phage CheetO, complete genome	23299-23328	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MG962365	Mycobacterium phage DoesntMatter, complete genome	23284-23313	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279882	Mycobacterium phage Sophia, complete genome	23015-23044	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KX670813	Mycobacterium phage MitKao, complete genome	23007-23036	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH576970	Mycobacterium phage DonSanchon, complete genome	22998-23027	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279866	Mycobacterium phage MRabcd, complete genome	23000-23029	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK524512	Mycobacterium phage Carthage, complete genome	22212-22241	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MN945899	Mycobacterium phage Skippy, complete genome	23288-23317	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279908	Mycobacterium phage Roliet, complete genome	23296-23325	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_023727	Mycobacterium phage Vista, complete genome	23305-23334	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MT897909	Mycobacterium phage Maru, complete genome	23008-23037	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KM347890	Mycobacterium phage Vivaldi, complete genome	23331-23360	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH727555	Mycobacterium phage Mulan, complete genome	23025-23054	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KY006474	Mycobacterium phage Prann, complete genome	22966-22995	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_027985	Mycobacterium phage UncleHowie, complete genome	23004-23033	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JN698990	Mycobacterium phage IsaacEli, complete genome	23308-23337	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KY965066	Mycobacterium phage BlackStallion, complete genome	23304-23333	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MN703415	Mycobacterium phage Mcshane, complete genome	22998-23027	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KX592589	Mycobacterium phage Iridoclysis, complete genome	23284-23313	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279871	Mycobacterium phage Plmatters, complete genome	23302-23331	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MN096366	Mycobacterium phage AbsoluteMadLad, complete genome	23304-23333	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_028942	Mycobacterium phage Phipps, complete sequence	23275-23304	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KJ567044	Mycobacterium phage EmpTee, complete genome	23298-23327	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279881	Mycobacterium phage Solosis, complete genome	23015-23044	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MT897902	Mycobacterium phage Boehler, complete genome	23305-23334	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279855	Mycobacterium phage Haleema, complete genome	23021-23050	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JX649096	Mycobacterium phage Serpentine, complete genome	23305-23334	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK494104	Mycobacterium phage HenryJackson, complete genome	23021-23050	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MG944225	Mycobacterium phage Xavier, complete genome	23018-23047	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JX649099	Mycobacterium phage Gyarad, complete genome	23302-23331	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH450116	Mycobacterium phage Buckeye, complete genome	23322-23351	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JN638753	Mycobacterium phage Morgushi, complete genome	23008-23037	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MG757158	Mycobacterium phage HighStump, complete genome	23004-23033	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK112539	Mycobacterium phage Dione, complete genome	23004-23033	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279873	Mycobacterium phage QueenBeane, complete genome	23300-23329	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MF668276	Mycobacterium phage Lulumae, complete genome	23000-23029	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MT897903	Mycobacterium phage DirtJuice, complete genome	23288-23317	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH513980	Mycobacterium phage Roy17, complete genome	23000-23029	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279879	Mycobacterium phage SassyCat97, complete genome	23006-23035	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MN586058	Mycobacterium phage Vaishali24, complete genome	22966-22995	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MT316460	Mycobacterium phage Kimbrough, complete genome	23010-23039	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JF937097	Mycobacterium phage Hertubise, complete genome	23312-23341	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH230874	Mycobacterium phage Banjo, complete genome	22993-23022	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH651186	Mycobacterium phage Podrick, complete genome	23294-23323	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MG962362	Mycobacterium phage AltPhacts, complete genome	23282-23311	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JF704103	Mycobacterium phage Vortex, complete sequence	23011-23040	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	FJ174694	Mycobacterium phage Chah, complete genome	23317-23346	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK112536	Mycobacterium phage Cannibal, complete genome	23283-23312	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KX578071	Mycobacterium phage Mana, complete genome	23015-23044	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MF919539	Mycobacterium phage Virapocalypse, complete genome	23291-23320	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KC661274	Mycobacterium phage SDcharge11, complete genome	23274-23303	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KJ194579	Mycobacterium phage Swish, complete genome	23291-23320	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH371114	Mycobacterium phage Childish, complete genome	23025-23054	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279910	Mycobacterium phage Antonia, complete genome	22856-22885	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279852	Mycobacterium phage Fringe, complete genome	23286-23315	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KX576643	Mycobacterium phage FriarPreacher, complete genome	23322-23351	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JN699010	Mycobacterium phage TallGrassMM, complete genome	22930-22959	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MG757159	Mycobacterium phage JangoPhett, complete genome	23291-23320	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MF919503	Mycobacterium phage Dingo, complete genome	23282-23311	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KY676783	Mycobacterium phage Chorkpop, complete genome	23021-23050	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK112527	Mycobacterium phage Altwerkus, complete genome	22982-23011	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JX649100	Mycobacterium phage Alex, complete genome	23305-23334	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_028691	Mycobacterium phage Apizium, complete genome	23047-23076	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH371125	Mycobacterium phage Morty, complete genome	23308-23337	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JF937109	Mycobacterium phage Yoshand, complete genome	23304-23333	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279878	Mycobacterium phage Samaymay, complete genome	23300-23329	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH399786	Mycobacterium phage PhrodoBaggins, complete genome	23293-23322	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK112551	Mycobacterium phage Riggan, complete genome	23286-23315	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KR816508	Mycobacterium phage Phamished, complete genome	23305-23334	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JF937095	Mycobacterium phage Harvey, complete genome	23316-23345	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KF713485	Mycobacterium phage Suffolk, complete genome	23302-23331	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MG770212	Mycobacterium phage Haimas, complete genome	23298-23327	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279861	Mycobacterium phage Legolas, complete genome	23016-23045	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279843	Mycobacterium phage CamL, complete genome	23300-23329	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279846	Mycobacterium phage Cosmolli16, complete genome	23019-23048	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KM408320	Mycobacterium phage Lasso, complete genome	23275-23304	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH825705	Mycobacterium phage Mesh1, complete genome	23313-23342	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MT952849	Mycobacterium phage Windsor, complete genome	22995-23024	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH576954	Mycobacterium phage HSavage, complete genome	23307-23336	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK112555	Mycobacterium phage Zelda, complete genome	23295-23324	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_028803	Mycobacterium phage OSmaximus, complete genome	23334-23363	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279904	Mycobacterium phage RedMaple, complete genome	23304-23333	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JN699009	Mycobacterium phage ThreeOh3D2, complete genome	23305-23334	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_005259	Mycobacterium phage PG1, complete genome	23310-23339	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK112552	Mycobacterium phage Spartan300, complete genome	23294-23323	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MF919523	Mycobacterium phage Mikota, complete genome	23286-23315	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KU867907	Mycobacterium phage Potter, complete genome	23018-23047	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH590588	Mycobacterium phage Vaticameos, complete genome	22995-23024	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279885	Mycobacterium phage Surely, complete genome	23308-23337	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279870	Mycobacterium phage Omniscient, complete genome	23308-23337	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JN638752	Mycobacterium phage Murdoc, complete genome	23300-23329	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KT599441	Mycobacterium phage Squid, complete genome	23006-23035	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MG925346	Mycobacterium phage LeeLot, complete genome	23306-23335	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MG962375	Mycobacterium phage ProfessorX, complete genome	23289-23318	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MG925348	Mycobacterium phage Megatron, complete genome	23299-23328	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH077582	Mycobacterium phage Olive, complete genome	23289-23318	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MF155947	Mycobacterium phage LemonSlice, complete genome	23003-23032	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KP027209	Mycobacterium phage Sigman, complete genome	23290-23319	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH450122	Mycobacterium phage KingTut, complete genome	18679-18708	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279859	Mycobacterium phage Kwadwo, complete genome	23000-23029	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK112546	Mycobacterium phage LuckyMarjie, complete genome	23018-23047	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KX620786	Mycobacterium phage Lego3393, complete genome	23311-23340	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK112544	Mycobacterium phage Keitherie, complete genome	23349-23378	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KP027197	Mycobacterium phage FluffyNinja, complete genome	23304-23333	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH651177	Mycobacterium phage KlimbOn, complete genome	23296-23325	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279877	Mycobacterium phage Roscoe, complete genome	23534-23563	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JN698989	Mycobacterium phage JacAttac, complete genome	23290-23319	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK112553	Mycobacterium Phage Squiggle, complete genome	23018-23047	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_028907	Mycobacterium phage Kikipoo, complete genome	23308-23337	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK524526	Mycobacterium phage Robyn, complete genome	22871-22900	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279897	Mycobacterium phage Bishoperium, complete genome	23002-23031	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MT310868	Mycobacterium phage Telesworld, complete genome	23002-23031	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279865	Mycobacterium phage Mecca, complete genome	23001-23030	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KC576784	Mycobacterium phage ShiVal, complete genome	23298-23327	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KJ595576	Mycobacterium phage Manad, complete genome	22854-22883	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MN444868	Mycobacterium phage Prickles, complete genome	23294-23323	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH371117	Mycobacterium phage Kahve, complete genome	23018-23047	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH399773	Mycobacterium phage Craff, complete genome	23303-23332	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	GU247133	Mycobacterium phage Fang, complete genome	23311-23340	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KX683292	Mycobacterium phage Held, complete genome	23005-23034	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_008197	Mycobacterium phage Orion, complete genome	23297-23326	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH479921	Mycobacterium phage Placalicious, complete genome	22997-23026	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MT897901	Mycobacterium phage Adriana, complete genome	23293-23322	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KT364588	Mycobacterium phage Hetaeria, complete genome	23314-23343	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MF919530	Mycobacterium phage Sheila, complete genome	23294-23323	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MG925356	Mycobacterium phage OliverWalter, complete genome	23308-23337	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JX649098	Mycobacterium phage Nacho, complete genome	23299-23328	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH926060	Mycobacterium phage Schadenfreude, complete genome	22854-22883	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KP027208	Mycobacterium phage Pipsqueak, complete genome	23304-23333	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JF704109	Mycobacterium phage Oosterbaan, complete sequence	23299-23328	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KX369585	Mycobacterium phage PhatCats2014, complete genome	23314-23343	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK310139	Mycobacterium phage Emiris, complete genome	23288-23317	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH576967	Mycobacterium phage UAch1, complete genome	23314-23343	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KJ194580	Mycobacterium phage Badfish, complete genome	23317-23346	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279889	Mycobacterium phage Valjean, complete genome	23297-23326	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH399775	Mycobacterium phage Gareth, complete genome	23002-23031	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279894	Mycobacterium phage YouGoGlencoco, complete genome	23299-23328	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK279895	Mycobacterium phage Zaider, complete genome	23529-23558	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MN585967	Mycobacterium phage Kloppinator, complete genome	23319-23348	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	GQ303259	Mycobacterium phage Colbert, complete genome	23358-23387	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_028681	Mycobacterium phage Pops, complete genome	23314-23343	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH744417	Mycobacterium phage Grand2040, complete genome	23021-23050	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JX649097	Mycobacterium phage Piglet, complete genome	23305-23334	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MG925350	Mycobacterium phage Mosaic, complete genome	23013-23042	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH479914	Mycobacterium phage FugateOSU, complete genome	23000-23029	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH825702	Mycobacterium phage Hamish, complete genome	23290-23319	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JF704091	Mycobacterium phage ABU, complete sequence	23295-23324	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MF919528	Mycobacterium phage Phunky, complete genome	23306-23335	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_028690	Mycobacterium phage Eremos, complete genome	23297-23326	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KJ538723	Mycobacterium phage KingVeVeVe, complete genome	23283-23312	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_021310	Mycobacterium phage Newman, complete genome	23295-23324	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MK112542	Mycobacterium phage Jillium, complete genome	23014-23043	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MT310867	Mycobacterium phage Chaelin, complete genome	22997-23026	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KJ194583	Mycobacterium phage Numberten, complete genome	23305-23334	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	KJ174157	Mycobacterium phage Soto, complete genome	23308-23337	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH399780	Mycobacterium phage Mutante, complete genome	23007-23036	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	JF704099	Mycobacterium phage KLucky39, complete sequence	23302-23331	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MH779516	Mycobacterium phage Waterdiva, complete genome	23297-23326	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	MF919507	Mycobacterium phage Horchata, complete genome	23292-23321	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP013069	Pannonibacter phragmitetus strain 31801 plasmid p.p-1, complete sequence	61322-61351	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	551877-551906	7	0.767
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP014600	Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence	23057-23086	7	0.767
NZ_CP022577_5	5.12\|2855412\|30\|NZ_CP022577\|CRT	2855412-2855441	30	NC_021289	Burkholderia insecticola plasmid p1, complete sequence	784862-784891	7	0.767
NZ_CP022577_5	5.12\|2855412\|30\|NZ_CP022577\|CRT	2855412-2855441	30	NZ_CP014519	Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence	22599-22628	7	0.767
NZ_CP022577_5	5.12\|2855412\|30\|NZ_CP022577\|CRT	2855412-2855441	30	MN892485	Gordonia phage Kuwabara, complete genome	6-35	7	0.767
NZ_CP022577_5	5.12\|2855412\|30\|NZ_CP022577\|CRT	2855412-2855441	30	NC_048018	Gordonia phage Apricot, complete genome	6-35	7	0.767
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NZ_CP044073	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed2, complete sequence	138269-138298	7	0.767
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NC_003903	Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence	344648-344677	7	0.767
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NC_003903	Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence	11347-11376	7	0.767
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	226900-226932	7	0.788
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	MK977708	Mycobacterium phage Fulbright, complete genome	10281-10311	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	MG099948	Mycobacterium phage Philonius, complete genome	10281-10311	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	MH926055	Mycobacterium phage Chewbacca, complete genome	10281-10311	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	MT723932	Mycobacterium phage Schnauzer, complete genome	10281-10311	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	KU935726	Mycobacterium phage Xerxes, complete genome	10281-10311	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	KU935730	Mycobacterium phage Pipsqueaks, complete genome	10281-10311	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	MH316570	Mycobacterium phage Silvafighter, complete genome	10281-10311	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	MK524518	Mycobacterium phage Smurph, complete genome	10281-10311	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	MK524515	Mycobacterium phage Parmesanjohn, complete genome	10281-10311	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	MH697585	Mycobacterium phage Gex, complete genome	10280-10310	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	KM588359	Mycobacterium phage Carcharodon, complete genome	10281-10311	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	MH697576	Mycobacterium phage Aggie, complete genome	10282-10312	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	MH697593	Mycobacterium phage Tapioca, complete genome	10281-10311	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	MG099936	Mycobacterium phage Andies, complete genome	10281-10311	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	NC_031243	Mycobacterium phage Xeno, complete genome	10281-10311	7	0.774
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	JN256079	Mycobacterium phage Charlie, complete genome	10281-10311	7	0.774
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	MF417927	Uncultured Caudovirales phage clone 9F_2, partial genome	6978-7007	7	0.767
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NZ_CP022605	Ochrobactrum quorumnocens strain A44 plasmid unnamed1, complete sequence	732060-732089	7	0.767
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	87847-87876	7	0.767
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	JX469830	Uncultured bacterium plasmid pG527, complete sequence	62414-62443	7	0.767
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	JX469833	Uncultured bacterium plasmid pWEC911, complete sequence	55706-55735	7	0.767
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NC_008357	Pseudomonas aeruginosa plasmid pBS228, complete sequence	88668-88697	7	0.767
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	CP002151	Uncultured bacterium plasmid PB5, complete sequence	46922-46951	7	0.767
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	CP002152	Uncultured bacterium plasmid PB11, complete sequence	49405-49434	7	0.767
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	CP002153	Uncultured bacterium plasmid PSP21, complete sequence	51092-51121	7	0.767
NZ_CP022577_10	10.15\|3359479\|27\|NZ_CP022577\|CRT	3359479-3359505	27	NZ_AP018520	Sphingobium sp. YG1 plasmid pYGP1, complete sequence	54324-54350	7	0.741
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MN585973	Mycobacterium phage StAnnes, complete genome	24891-24919	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MG944221	Mycobacterium phage Scowl, complete genome	29090-29118	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	KT309034	Mycobacterium phage Dante, complete genome	24864-24892	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_048850	Mycobacterium phage Cornie, complete genome	23306-23334	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_021538	Mycobacterium phage Job42, complete genome	26532-26560	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_026584	Mycobacterium phage Minerva, complete genome	38743-38771	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	KJ409696	Mycobacterium phage Lamina13, complete genome	28205-28233	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_028784	Mycobacterium phage Tasp14, complete genome	28829-28857	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350114-350142	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350666-350694	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2211451-2211479	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	455349-455377	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_014819	Asticcacaulis excentricus CB 48 plasmid pASTEX02, complete sequence	68663-68691	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_LR134463	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 21, complete sequence	144921-144949	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_LT703506	Mycobacterium chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera plasmid 2	304359-304387	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP025615	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed3, complete sequence	36213-36241	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	445678-445706	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	455533-455561	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	2019770-2019798	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	119320-119348	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP040096	Pantoea sp. SO10 plasmid unnamed1, complete sequence	107446-107474	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	333785-333813	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_011887	Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence	348321-348349	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MT522000	Mycobacterium phage Soul22, complete genome	22193-22221	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MF919502	Mycobacterium phage Demsculpinboyz, complete genome	22191-22219	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	AY129336	Mycobacteriophage Che9d, complete genome	22206-22234	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK359343	Mycobacterium phage Pollywog, complete genome	23656-23684	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_042030	Mycobacterium phage Yoshi, complete sequence	22194-22222	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_048729	Mycobacterium phage Renaud18, complete genome	22866-22894	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MT889380	Mycobacterium phage Coco12, complete genome	22837-22865	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_026585	Mycobacteriophage Estave1, complete genome	22559-22587	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MG925354	Mycobacterium phage Ogopogo, complete genome	22786-22814	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_023698	Mycobacterium phage Avani, complete genome	22198-22226	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MT114167	Mycobacterium phage Phanphagia, complete genome	22492-22520	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH077585	Mycobacterium phage TChen, complete genome	22971-22999	7	0.759
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NC_048788	Mycobacterium phage ThetaBob, complete genome	22784-22812	7	0.759
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	134977-135002	7	0.731
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	580333-580358	7	0.731
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	9680-9705	7	0.731
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	58551-58576	7	0.731
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	48469-48494	7	0.731
NZ_CP022577_12	12.10\|4154357\|26\|NZ_CP022577\|CRT	4154357-4154382	26	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	582845-582870	7	0.731
NZ_CP022577_12	12.12\|4154507\|29\|NZ_CP022577\|CRT	4154507-4154535	29	NZ_CP047220	Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed3, complete sequence	33127-33155	7	0.759
NZ_CP022577_12	12.12\|4154507\|29\|NZ_CP022577\|CRT	4154507-4154535	29	MK510999	Pseudomonas phage BR58, partial genome	18164-18192	7	0.759
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP050094	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence	104974-105005	7	0.781
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	230840-230871	7	0.781
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP054025	Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence	19813-19844	7	0.781
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP051543	Paracoccus sanguinis strain OM2164 plasmid pPspOM122, complete sequence	106285-106316	7	0.781
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP054034	Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence	268526-268557	7	0.781
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	465925-465956	7	0.781
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	456256-456287	7	0.781
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	466109-466140	7	0.781
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	344363-344394	7	0.781
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	20371-20402	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	128423-128454	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	101685-101716	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	101829-101860	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	102057-102088	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	102099-102130	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	102285-102316	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	102327-102358	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	102471-102502	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416440-416471	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	210543-210574	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1974012-1974043	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NC_012853	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence	213747-213778	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	374789-374820	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	723914-723945	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP019063	Rahnella sp. ERMR1:05 plasmid unnamed1, complete sequence	394924-394955	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	134704-134735	7	0.781
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	105338-105369	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	916895-916926	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	333906-333937	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1727798-1727829	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1754493-1754524	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	917354-917385	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1783272-1783303	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1814773-1814804	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350104-350135	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2211449-2211480	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1959037-1959068	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	698830-698861	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1714018-1714049	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	329136-329167	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	579487-579518	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1792768-1792799	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1500392-1500423	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1735050-1735081	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1729871-1729902	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1798700-1798731	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	446057-446088	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1672859-1672890	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1729331-1729362	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1804248-1804279	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1798667-1798698	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1708136-1708167	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1783689-1783720	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	440080-440111	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1814775-1814806	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1708448-1708479	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1783689-1783720	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1708136-1708167	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1707339-1707370	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1783689-1783720	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1783689-1783720	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1783689-1783720	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	248523-248554	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1708334-1708365	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1688979-1689010	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1750023-1750054	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1782005-1782036	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1781004-1781035	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1708447-1708478	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1798491-1798522	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1783694-1783725	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	216325-216356	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	216325-216356	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	573838-573869	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_009339	Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence	80793-80824	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_LR134451	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence	315284-315315	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	83152-83183	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP045381	Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence	67805-67836	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP045381	Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence	71042-71073	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP045381	Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence	258325-258356	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	250537-250568	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	301071-301102	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	202914-202945	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	509871-509902	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_011879	Pseudarthrobacter chlorophenolicus A6 plasmid pACHL01, complete sequence	75980-76011	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_008703	Mycobacterium sp. KMS plasmid pMKMS01, complete sequence	170110-170141	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	261733-261764	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	308611-308642	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MT889380	Mycobacterium phage Coco12, complete genome	22835-22866	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MT114167	Mycobacterium phage Phanphagia, complete genome	22490-22521	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1797462-1797493	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	50134-50165	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	765883-765914	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1797460-1797491	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP014276	Martelella sp. AD-3 plasmid unnamed1, complete sequence	26313-26344	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP040820	Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence	245788-245819	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	52536-52567	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1462200-1462231	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	300484-300515	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	280825-280856	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	670169-670200	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	98683-98714	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MK494095	Mycobacterium phage Daegal, complete genome	5958-5989	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MK494105	Mycobacterium phage Pinnie, complete genome	23390-23421	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MK494105	Mycobacterium phage Pinnie, complete genome	23159-23190	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_028791	Mycobacterium phage MOOREtheMARYer, complete genome	23011-23042	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP023779	Nocardia terpenica strain NC_YFY_NT001 plasmid p_NC_YFY_NT001, complete sequence	6341-6372	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	318451-318482	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	396853-396884	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	391036-391067	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP019631	Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence	153727-153758	7	0.781
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	573119-573150	7	0.781
NZ_CP022577_13	13.6\|4173801\|32\|NZ_CP022577\|CRT	4173801-4173832	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2781975-2782006	7	0.781
NZ_CP022577_14	14.6\|4175176\|28\|NZ_CP022577\|CRT	4175176-4175203	28	NC_022050	Paracoccus aminophilus JCM 7686 plasmid pAMI8, complete sequence	39653-39680	7	0.75
NZ_CP022577_15	15.4\|4303843\|33\|NZ_CP022577\|CRT	4303843-4303875	33	NZ_CP021355	Rhodococcus sp. S2-17 plasmid pRB98, complete sequence	612195-612227	7	0.788
NZ_CP022577_15	15.9\|4304119\|27\|NZ_CP022577\|CRT	4304119-4304145	27	AP021851	Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome	369282-369308	7	0.741
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	663780-663806	7	0.741
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	286244-286270	7	0.741
NZ_CP022577_15	15.13\|4304335\|27\|NZ_CP022577\|CRT	4304335-4304361	27	NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	29168-29194	7	0.741
NZ_CP022577_4	4.1\|2765679\|36\|NZ_CP022577\|CRT	2765679-2765714	36	NC_022087	Mycobacterium phage AnnaL29, complete genome	5550-5585	8	0.778
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	294538-294567	8	0.733
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	563525-563554	8	0.733
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	378189-378218	8	0.733
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	462408-462437	8	0.733
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	507932-507961	8	0.733
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	535161-535190	8	0.733
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	259895-259924	8	0.733
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	GQ919031	Streptomyces phage ZL12, complete genome	31207-31236	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP046258	Gordonia sp. 135 plasmid pG135, complete sequence	116239-116268	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NC_018583	Gordonia sp. KTR9 plasmid pGKT3, complete sequence	48748-48777	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP017592	Pantoea stewartii subsp. stewartii DC283 plasmid ppDSJ01, complete sequence	7331-7360	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	334764-334793	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	334763-334792	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP029096	Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence	180870-180899	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP022192	Yangia pacifica strain YSBP01 plasmid unnamed2, complete sequence	113590-113619	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP010727	Phaeobacter inhibens strain P88 plasmid pP88_b, complete sequence	115285-115314	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	MN393079	Salmonella virus VSiA, complete genome	6820-6849	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	MN855773	Siphoviridae sp. isolate 219, complete genome	20930-20959	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	240007-240036	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	362492-362521	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP010602	Phaeobacter inhibens strain P83 plasmid pP83_c, complete sequence	42993-43022	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	641244-641273	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP010865	Marinovum algicola DG 898 plasmid pMaD10, complete sequence	48802-48831	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP010708	Phaeobacter inhibens strain P66 plasmid pP66_c, complete sequence	42990-43019	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NC_019337	Acetobacter pasteurianus plasmid pAC258-29, complete sequence	10352-10381	8	0.733
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP010737	Phaeobacter inhibens strain P72 plasmid pP72_b, complete sequence	118173-118202	8	0.733
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1103857-1103886	8	0.733
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	CP000662	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence	161983-162012	8	0.733
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	716861-716890	8	0.733
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP032313	Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence	257298-257327	8	0.733
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1452187-1452216	8	0.733
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	401613-401642	8	0.733
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NZ_CP047261	Pseudomonas syringae pv. maculicola str. ES4326 plasmid pPma4326F, complete sequence	122106-122135	8	0.733
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	NZ_CP029777	Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence	239388-239417	8	0.733
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	711893-711925	8	0.758
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	70963-70995	8	0.758
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	1241175-1241207	8	0.758
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1465470-1465499	8	0.733
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	251025-251054	8	0.733
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NZ_CP048283	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence	258423-258452	8	0.733
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NZ_CP021796	Sinorhizobium meliloti strain USDA1157 plasmid accessoryA, complete sequence	88284-88313	8	0.733
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NZ_CP050101	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence	52655-52684	8	0.733
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NZ_CP025016	Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence	190437-190466	8	0.733
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	273171-273200	8	0.733
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NZ_CP053442	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence	52528-52557	8	0.733
NZ_CP022577_9	9.2\|3331197\|30\|NZ_CP022577\|CRISPRCasFinder	3331197-3331226	30	NZ_CP022569	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence	163428-163457	8	0.733
NZ_CP022577_10	10.5\|3358942\|36\|NZ_CP022577\|CRT	3358942-3358977	36	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	24079-24114	8	0.778
NZ_CP022577_10	10.11\|3359281\|33\|NZ_CP022577\|CRT	3359281-3359313	33	NZ_CP020040	Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence	425301-425333	8	0.758
NZ_CP022577_12	12.1\|4153631\|29\|NZ_CP022577\|CRT	4153631-4153659	29	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	938431-938459	8	0.724
NZ_CP022577_12	12.1\|4153631\|29\|NZ_CP022577\|CRT	4153631-4153659	29	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1510083-1510111	8	0.724
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	NZ_CP048923	Lactobacillus plantarum strain X7022 plasmid unnamed2, complete sequence	17406-17434	8	0.724
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MK937593	Mycobacterium phage Flypotenuse, complete genome	26855-26883	8	0.724
NZ_CP022577_12	12.6\|4154048\|29\|NZ_CP022577\|CRT	4154048-4154076	29	MH536820	Mycobacterium phage Glexan, complete genome	26855-26883	8	0.724
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP050101	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence	223846-223877	8	0.75
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NC_008379	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence	87943-87974	8	0.75
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP053442	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence	223111-223142	8	0.75
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	73264-73295	8	0.75
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	624011-624042	8	0.75
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP046571	Xanthomonas albilineans strain Xa-FJ1 plasmid pXaFJ1, complete sequence	7592-7623	8	0.75
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	424526-424557	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	69206-69237	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416248-416279	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416296-416327	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416344-416375	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416128-416159	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416224-416255	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416368-416399	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	CP054927	Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence	222441-222472	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013525	Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence	393193-393224	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013554	Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence	416863-416894	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013560	Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence	393262-393293	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013577	Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence	399992-400023	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013549	Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence	398832-398863	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013534	Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence	398832-398863	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013545	Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence	398824-398855	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013565	Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence	416863-416894	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013571	Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence	399992-400023	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NC_010998	Rhizobium etli CIAT 652 plasmid pA, complete sequence	399470-399501	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	JN699011	Mycobacterium phage Stinger, complete genome	23830-23861	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_KM406416	Bifidobacterium breve strain JCM 7017 plasmid megaplasmid pMP7017, complete sequence	12241-12272	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NC_019018	Mycobacterium marinum DL240490 plasmid pMUM003, complete sequence	58948-58979	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NC_011355	Mycobacterium liflandii 128FXT plasmid pMUM002, complete sequence	5698-5729	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	599851-599882	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	173242-173273	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	5705-5736	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP027853	Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence	194754-194785	8	0.75
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	1389287-1389318	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	280285-280316	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	876589-876620	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350665-350696	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3466591-3466622	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210945-2210976	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2211119-2211150	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3467425-3467456	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350506-350537	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	752721-752752	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2211059-2211090	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3467362-3467393	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	684907-684938	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1552681-1552712	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	83251-83282	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	83422-83453	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_LR134461	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence	116486-116517	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1172375-1172406	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	306654-306685	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	302070-302101	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MF141540	Mycobacterium phage Avocado, complete genome	24054-24085	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	KR080198	Mycobacterium phage Cambiare, complete genome	24519-24550	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	258384-258415	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	806900-806931	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	94315-94346	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	473669-473700	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP026974	Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence	151628-151659	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_020275	Mycobacterium intracellulare subsp. yongonense 05-1390 plasmid pMyong1, complete sequence	117761-117792	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	713857-713888	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP047145	Streptomyces sp. HF10 plasmid plas1, complete sequence	41273-41304	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1755080-1755111	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	162817-162848	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	529169-529200	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1657444-1657475	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	408199-408230	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MK814754	Mycobacterium phage Sumter, complete genome	28140-28171	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MK814754	Mycobacterium phage Sumter, complete genome	28638-28669	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MN369739	Mycobacterium phage Kenuha5, complete genome	22587-22618	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MK967397	Mycobacterium phage Mahavrat, complete genome	24813-24844	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MH001451	Mycobacterium phage Nairb, complete genome	21241-21272	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MK524490	Mycobacterium phage Donny, complete genome	33810-33841	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MT522000	Mycobacterium phage Soul22, complete genome	22191-22222	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	KY348865	Mycobacterium phage Bubbles123, complete genome	25539-25570	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MN428047	Mycobacterium phage Doomphist, complete genome	24961-24992	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MF919502	Mycobacterium phage Demsculpinboyz, complete genome	22189-22220	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	AY129336	Mycobacteriophage Che9d, complete genome	22204-22235	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MT771340	Mycobacterium phage Jorgensen, complete genome	28475-28506	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MK359343	Mycobacterium phage Pollywog, complete genome	23654-23685	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MF155936	Mycobacterium phage ZenTime222, complete genome	21241-21272	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_042030	Mycobacterium phage Yoshi, complete sequence	22192-22223	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MH338241	Mycobacterium phage Tarynearal, complete genome	23683-23714	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_048729	Mycobacterium phage Renaud18, complete genome	22864-22895	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_026585	Mycobacteriophage Estave1, complete genome	22557-22588	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MK305886	Mycobacterium phage Poenanya, complete genome	24961-24992	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	JN859129	Mycobacterium virus DotProduct, complete genome	24828-24859	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MK494089	Mycobacterium phage Ibrahim, complete genome	21241-21272	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MG925354	Mycobacterium phage Ogopogo, complete genome	22784-22815	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_023698	Mycobacterium phage Avani, complete genome	22196-22227	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	JN699007	Mycobacterium phage Acadian, complete genome	33805-33836	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_024135	Mycobacterium phage Bernal13, complete genome	21241-21272	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_011054	Mycobacterium phage Boomer, complete genome	24636-24667	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MT889381	Mycobacterium phage Suigeneris, complete genome	33810-33841	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	KM591905	Mycobacterium phage RonRayGun, complete genome	21241-21272	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MH077585	Mycobacterium phage TChen, complete genome	22969-23000	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MN735432	Mycobacteriophage Whitty, complete genome	21241-21272	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_048788	Mycobacterium phage ThetaBob, complete genome	22782-22813	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP018471	Xanthomonas vesicatoria strain LM159 plasmid pLM159.2, complete sequence	13085-13116	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_008712	Paenarthrobacter aurescens TC1 plasmid pTC1, complete sequence	40934-40965	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	480125-480156	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	83601-83632	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_LR134446	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 4, complete sequence	52094-52125	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_LR134454	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence	288114-288145	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	572169-572200	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	335584-335615	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_008539	Arthrobacter sp. FB24 plasmid 3, complete sequence	16079-16110	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1246417-1246448	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	449577-449608	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP046330	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed1, complete sequence	94222-94253	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_019789	Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence	455292-455323	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	313198-313229	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022566	Mycolicibacterium alvei strain JCM 12272 plasmid pJCM12272, complete sequence	218474-218505	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	190142-190173	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	112997-113028	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_008766	Acidovorax sp. JS42 plasmid pAOVO02, complete sequence	13754-13785	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	645804-645835	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP023550	Rhodobacter sp. CZR27 plasmid unnamed2, complete sequence	151176-151207	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP049701	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence	219895-219926	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_006525	Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence	12466-12497	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	677364-677395	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MN096355	Mycobacterium phage Purky, complete genome	13504-13535	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MH669003	Mycobacterium phage Girr, complete genome	14385-14416	8	0.75
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MK016504	Mycobacterium phage Whouxphf, complete genome	14517-14548	8	0.75
NZ_CP022577_13	13.5\|4173747\|32\|NZ_CP022577\|CRT	4173747-4173778	32	NZ_CP021406	Celeribacter manganoxidans strain DY25 plasmid pDY25-B, complete sequence	151899-151930	8	0.75
NZ_CP022577_13	13.5\|4173747\|32\|NZ_CP022577\|CRT	4173747-4173778	32	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	300695-300726	8	0.75
NZ_CP022577_13	13.5\|4173747\|32\|NZ_CP022577\|CRT	4173747-4173778	32	NZ_CP010872	Confluentimicrobium sp. EMB200-NS6 strain EMBL200_NS6 plasmid pNS6003, complete sequence	102705-102736	8	0.75
NZ_CP022577_13	13.5\|4173747\|32\|NZ_CP022577\|CRT	4173747-4173778	32	NZ_CP040823	Paraoceanicella profunda strain D4M1 plasmid pD4M1E, complete sequence	5062-5093	8	0.75
NZ_CP022577_13	13.5\|4173747\|32\|NZ_CP022577\|CRT	4173747-4173778	32	NZ_CP040823	Paraoceanicella profunda strain D4M1 plasmid pD4M1E, complete sequence	111204-111235	8	0.75
NZ_CP022577_13	13.6\|4173801\|32\|NZ_CP022577\|CRT	4173801-4173832	32	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	279027-279058	8	0.75
NZ_CP022577_14	14.6\|4175176\|28\|NZ_CP022577\|CRT	4175176-4175203	28	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	783761-783788	8	0.714
NZ_CP022577_15	15.4\|4303843\|33\|NZ_CP022577\|CRT	4303843-4303875	33	MN234213	Gordonia phage Schiebs, complete genome	11497-11529	8	0.758
NZ_CP022577_15	15.4\|4303843\|33\|NZ_CP022577\|CRT	4303843-4303875	33	NC_012520	Rhodococcus opacus B4 plasmid pROB01, complete sequence	447918-447950	8	0.758
NZ_CP022577_15	15.5\|4303897\|36\|NZ_CP022577\|CRT	4303897-4303932	36	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	296417-296452	8	0.778
NZ_CP022577_15	15.5\|4303897\|36\|NZ_CP022577\|CRT	4303897-4303932	36	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	346479-346514	8	0.778
NZ_CP022577_15	15.18\|4304716\|36\|NZ_CP022577\|CRT	4304716-4304751	36	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	233810-233845	8	0.778
NZ_CP022577_15	15.18\|4304716\|36\|NZ_CP022577\|CRT	4304716-4304751	36	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	263517-263552	8	0.778
NZ_CP022577_15	15.18\|4304716\|36\|NZ_CP022577\|CRT	4304716-4304751	36	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	811469-811504	8	0.778
NZ_CP022577_3	3.7\|1644407\|30\|NZ_CP022577\|CRT	1644407-1644436	30	NZ_CP022197	Celeribacter ethanolicus strain TSPH2 plasmid unnamed, complete sequence	25141-25170	9	0.7
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_KY126370	Enterobacter cloacae subsp. cloacae strain MN201516 plasmid pOP-I, complete sequence	93254-93283	9	0.7
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_KP873172	Pseudomonas aeruginosa PAO1 plasmid pAMBL1, complete sequence	21058-21087	9	0.7
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP045203	Citrobacter sp. NMI7904_11 plasmid pCTEL-2, complete sequence	159095-159124	9	0.7
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NC_021492	Enterobacter sp. R4-368 plasmid pENT01, complete sequence	50096-50125	9	0.7
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP022156	Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence	15248-15277	9	0.7
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP024682	Citrobacter freundii strain UMH14 plasmid pUMH14_2, complete sequence	41942-41971	9	0.7
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP046347	Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence	30109-30138	9	0.7
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	NZ_CP044100	Citrobacter werkmanii strain FDAARGOS_616 plasmid unnamed1, complete sequence	32857-32886	9	0.7
NZ_CP022577_4	4.3\|2765775\|30\|NZ_CP022577\|CRT	2765775-2765804	30	MT316461	Streptomyces phage Galactica, complete genome	23009-23038	9	0.7
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	235439-235468	9	0.7
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP015739	Shinella sp. HZN7 plasmid pShin-03, complete sequence	57474-57503	9	0.7
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NC_005307	Gordonia westfalica strain DSM44215T plasmid pKB1 complete genome	55436-55465	9	0.7
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NC_017805	Deinococcus gobiensis I-0 plasmid P1, complete sequence	396453-396482	9	0.7
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NZ_CP010408	Streptomyces vietnamensis strain GIMV4.0001 plasmid pSVL1, complete sequence	104951-104980	9	0.7
NZ_CP022577_5	5.5\|2855079\|30\|NZ_CP022577\|CRT	2855079-2855108	30	NC_047756	Caulobacter phage Sansa, complete genome	24468-24497	9	0.7
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	1407770-1407799	9	0.7
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP021827	Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence	175487-175516	9	0.7
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	1072890-1072919	9	0.7
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	9429-9458	9	0.7
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	222065-222094	9	0.7
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	329623-329652	9	0.7
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP012664	Defluviimonas alba strain cai42 plasmid pcai42C, complete sequence	21184-21213	9	0.7
NZ_CP022577_5	5.7\|2855172\|30\|NZ_CP022577\|CRT	2855172-2855201	30	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	371553-371582	9	0.7
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	MH338239	Mycobacterium phage Mryolo, complete genome	49971-50000	9	0.7
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	MK305893	Mycobacterium phage Beatrix, complete genome	51772-51801	9	0.7
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	MN617845	Mycobacterium phage BaconJack, complete genome	53261-53290	9	0.7
NZ_CP022577_5	5.14\|2855499\|30\|NZ_CP022577\|CRT	2855499-2855528	30	MK359312	Mycobacterium phage Fushigi, complete genome	49867-49896	9	0.7
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	394281-394313	9	0.727
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP039433	Rhodococcus sp. SGAir0479 plasmid unnamed	22106-22138	9	0.727
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	697414-697446	9	0.727
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	694927-694959	9	0.727
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	693088-693120	9	0.727
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	358566-358598	9	0.727
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	351190-351222	9	0.727
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	NZ_CP014964	Geobacter anodireducens strain SD-1 plasmid pSD, complete sequence	13698-13728	9	0.71
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	NC_015974	Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence	20960-20990	9	0.71
NZ_CP022577_6	6.1\|3001221\|31\|NZ_CP022577\|CRISPRCasFinder	3001221-3001251	31	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	15390-15420	9	0.71
NZ_CP022577_10	10.5\|3358942\|36\|NZ_CP022577\|CRT	3358942-3358977	36	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	479403-479438	9	0.75
NZ_CP022577_10	10.5\|3358942\|36\|NZ_CP022577\|CRT	3358942-3358977	36	NZ_CP018172	Mesorhizobium oceanicum strain B7 plasmid unnamed1, complete sequence	78278-78313	9	0.75
NZ_CP022577_10	10.5\|3358942\|36\|NZ_CP022577\|CRT	3358942-3358977	36	NZ_CP024313	Rhizobium sp. NXC24 plasmid pRspNXC24b, complete sequence	45037-45072	9	0.75
NZ_CP022577_10	10.10\|3359227\|33\|NZ_CP022577\|CRT	3359227-3359259	33	NZ_LR134445	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 3, complete sequence	53681-53713	9	0.727
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NC_010509	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence	4245-4276	9	0.719
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	426519-426550	9	0.719
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	160488-160519	9	0.719
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	414196-414227	9	0.719
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	204646-204677	9	0.719
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	209773-209804	9	0.719
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NC_023286	Streptomyces sp. F12 plasmid pFRL6, complete sequence	139549-139580	9	0.719
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NC_012852	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132504, complete sequence	143-174	9	0.719
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP017300	Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence	340876-340907	9	0.719
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	177208-177239	9	0.719
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	1525216-1525247	9	0.719
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	443295-443326	9	0.719
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	MH632120	Mycobacterium phage Thonko, complete genome	12336-12367	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416392-416423	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416080-416111	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416176-416207	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416200-416231	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416320-416351	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416416-416447	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	1010316-1010347	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	985673-985704	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	880738-880769	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	1010316-1010347	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	880737-880768	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP032678	Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence	723992-724023	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	1019170-1019201	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_LR723676	Rhizobium sp. TCK plasmid 2	121353-121384	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	379096-379127	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	293535-293566	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	293535-293566	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	97913-97944	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	238635-238666	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP053022	Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence	72142-72173	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	2084374-2084405	9	0.719
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	CP003952	Rhodococcus opacus PD630 plasmid 3, complete sequence	60533-60564	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350095-350126	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3465304-3465335	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4086145-4086176	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4571813-4571844	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4863684-4863715	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1271064-1271095	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3466267-3466298	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3467023-3467054	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	687357-687388	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP045381	Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence	69755-69786	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	13863-13894	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	306606-306637	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MT889380	Mycobacterium phage Coco12, complete genome	14812-14843	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MT114167	Mycobacterium phage Phanphagia, complete genome	14467-14498	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	364375-364406	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	531166-531197	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	342003-342034	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	13742-13773	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	14621-14652	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP006989	Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence	14824-14855	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP006989	Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence	274043-274074	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013525	Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence	13743-13774	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013554	Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence	13743-13774	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	479451-479482	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013588	Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence	13742-13773	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013560	Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence	13738-13769	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013577	Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence	18613-18644	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013549	Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence	18613-18644	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	13750-13781	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013534	Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence	18613-18644	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	13861-13892	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013545	Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence	18613-18644	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013565	Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence	13743-13774	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	557389-557420	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	14599-14630	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1333618-1333649	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	13750-13781	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	534054-534085	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	14599-14630	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	14599-14630	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013571	Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence	18613-18644	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP021126	Rhizobium sp. Kim5 plasmid pRetKim5b, complete sequence	14821-14852	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	14599-14630	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	14599-14630	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	CP007642	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence	14826-14857	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	CP007642	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence	262378-262409	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_010998	Rhizobium etli CIAT 652 plasmid pA, complete sequence	13741-13772	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1022655-1022686	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	918752-918783	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MN428047	Mycobacterium phage Doomphist, complete genome	14549-14580	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MK305886	Mycobacterium phage Poenanya, complete genome	14549-14580	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	JN859129	Mycobacterium virus DotProduct, complete genome	14425-14456	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	659488-659519	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	600186-600217	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_015184	Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence	72745-72776	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	126716-126747	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP019631	Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence	152440-152471	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP019631	Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence	152668-152699	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_AP022334	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence	27567-27598	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_001759	Streptomyces phaeochromogenes plasmid pJV1, complete sequence	409-440	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	125962-125993	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	686343-686374	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MH051248	Mycobacterium phage BigPhil, complete genome	14271-14302	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MF668281	Mycobacterium phage RitaG, complete genome	14558-14589	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MN369749	Mycobacterium phage MinionDave, complete genome	15113-15144	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MT684597	Mycobacterium phage Mandlovu, complete genome	14527-14558	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	KY012363	Mycobacterium phage Empress, complete genome	15766-15797	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MN585973	Mycobacterium phage StAnnes, complete genome	14462-14493	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MH077578	Mycobacterium phage DillTech15, complete genome	14464-14495	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MH020235	Mycobacterium phage Batiatus, complete genome	14465-14496	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	KY471267	Mycobacterium phage SassyB, complete genome	14466-14497	9	0.719
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MG872841	Mycobacterium phage Priscilla, complete genome	14423-14454	9	0.719
NZ_CP022577_13	13.5\|4173747\|32\|NZ_CP022577\|CRT	4173747-4173778	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	917199-917230	9	0.719
NZ_CP022577_13	13.5\|4173747\|32\|NZ_CP022577\|CRT	4173747-4173778	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	895925-895956	9	0.719
NZ_CP022577_13	13.5\|4173747\|32\|NZ_CP022577\|CRT	4173747-4173778	32	NZ_CP040820	Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence	232436-232467	9	0.719
NZ_CP022577_13	13.5\|4173747\|32\|NZ_CP022577\|CRT	4173747-4173778	32	NZ_CP015221	Rhodococcus sp. PBTS 2 plasmid unnamed1, complete sequence	130163-130194	9	0.719
NZ_CP022577_13	13.6\|4173801\|32\|NZ_CP022577\|CRT	4173801-4173832	32	NZ_CP013071	Sphingobium indicum B90A plasmid pSRL1, complete sequence	86867-86898	9	0.719
NZ_CP022577_13	13.6\|4173801\|32\|NZ_CP022577\|CRT	4173801-4173832	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1334636-1334667	9	0.719
NZ_CP022577_13	13.6\|4173801\|32\|NZ_CP022577\|CRT	4173801-4173832	32	NZ_CP021819	Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence	44253-44284	9	0.719
NZ_CP022577_15	15.4\|4303843\|33\|NZ_CP022577\|CRT	4303843-4303875	33	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	444168-444200	9	0.727
NZ_CP022577_15	15.18\|4304716\|36\|NZ_CP022577\|CRT	4304716-4304751	36	NC_031262	Mycobacterium phage Brocalys, complete genome	19446-19481	9	0.75
NZ_CP022577_15	15.18\|4304716\|36\|NZ_CP022577\|CRT	4304716-4304751	36	NC_004683	Mycobacterium phage Che9c, complete genome	20558-20593	9	0.75
NZ_CP022577_15	15.18\|4304716\|36\|NZ_CP022577\|CRT	4304716-4304751	36	AY129333	Mycobacterium virus Che9c, complete genome	20558-20593	9	0.75
NZ_CP022577_15	15.18\|4304716\|36\|NZ_CP022577\|CRT	4304716-4304751	36	MN234184	Mycobacterium phage IdentityCrisis, complete genome	18582-18617	9	0.75
NZ_CP022577_15	15.18\|4304716\|36\|NZ_CP022577\|CRT	4304716-4304751	36	KM083128	Mycobacterium phage Sparky, complete genome	21436-21471	9	0.75
NZ_CP022577_15	15.18\|4304716\|36\|NZ_CP022577\|CRT	4304716-4304751	36	MT889380	Mycobacterium phage Coco12, complete genome	22836-22871	9	0.75
NZ_CP022577_15	15.18\|4304716\|36\|NZ_CP022577\|CRT	4304716-4304751	36	MT114167	Mycobacterium phage Phanphagia, complete genome	22491-22526	9	0.75
NZ_CP022577_1	1.7\|576139\|35\|NZ_CP022577\|CRT,PILER-CR,CRISPRCasFinder	576139-576173	35	NZ_AP022607	Mycobacterium branderi strain JCM 12687 plasmid pJCM12687	414652-414686	10	0.714
NZ_CP022577_5	5.16\|2855583\|33\|NZ_CP022577\|CRT	2855583-2855615	33	NZ_CP017756	Cupriavidus malaysiensis strain USMAA1020 isolate pure plasmid unnamed1, complete sequence	62322-62354	10	0.697
NZ_CP022577_10	10.5\|3358942\|36\|NZ_CP022577\|CRT	3358942-3358977	36	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	367714-367749	10	0.722
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_KU140623	Sinorhizobium sp. M14 plasmid pSinB, complete sequence	65269-65300	10	0.688
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	152547-152578	10	0.688
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP048631	Ancylobacter pratisalsi strain DSM 102029 plasmid pLGM, complete sequence	130266-130297	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416152-416183	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	416272-416303	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	865209-865240	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	824526-824557	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013525	Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence	224222-224253	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013554	Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence	244313-244344	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013560	Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence	226869-226900	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013577	Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence	224416-224447	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013549	Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence	224786-224817	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013534	Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence	224786-224817	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013545	Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence	224781-224812	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013565	Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence	244313-244344	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013571	Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence	224416-224447	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NC_010998	Rhizobium etli CIAT 652 plasmid pA, complete sequence	230392-230423	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013588	Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence	219568-219599	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	238684-238715	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	238684-238715	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP024200	Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence	222088-222119	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	243141-243172	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013523	Rhizobium phaseoli strain R744 plasmid pRphaR744a, complete sequence	68631-68662	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	260131-260162	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	249908-249939	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	1008420-1008451	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	227840-227871	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	902801-902832	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	1008420-1008451	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	KU935731	Mycobacterium phage Phrann, complete genome	21013-21044	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	MK224497	Mycobacterium phage Henu3, complete genome	33343-33374	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	MT498061	Mycobacterium phage Jung, complete genome	21826-21857	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	MH230879	Mycobacterium phage Xavia, complete genome	22489-22520	10	0.688
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	MN585977	Mycobacterium phage Atcoo, complete genome	22360-22391	10	0.688
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	685570-685601	10	0.688
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	684352-684383	10	0.688
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP034352	Streptomyces sp. W1SF4 plasmid p2, complete sequence	107037-107068	10	0.688
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	377424-377455	10	0.688
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	507464-507495	10	0.688
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP009112	Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence	768792-768823	10	0.688
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	MG812488	Mycobacterium phage Frankie, complete genome	14521-14552	10	0.688
NZ_CP022577_15	15.5\|4303897\|36\|NZ_CP022577\|CRT	4303897-4303932	36	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2211249-2211284	10	0.722
NZ_CP022577_15	15.5\|4303897\|36\|NZ_CP022577\|CRT	4303897-4303932	36	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350879-350914	10	0.722
NZ_CP022577_10	10.8\|3359092\|42\|NZ_CP022577\|CRT	3359092-3359133	42	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350477-350518	11	0.738
NZ_CP022577_12	12.13\|4154579\|32\|NZ_CP022577\|CRT	4154579-4154610	32	NZ_CP015743	Shinella sp. HZN7 plasmid pShin-07, complete sequence	96148-96179	11	0.656
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	247382-247413	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	302631-302662	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	109051-109082	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1435597-1435628	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	682268-682299	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1797409-1797440	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1694606-1694637	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1797508-1797539	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1695253-1695284	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1797504-1797535	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1797493-1797524	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1694629-1694660	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1797493-1797524	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1694629-1694660	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1694629-1694660	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1694629-1694660	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1797504-1797535	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1797515-1797546	11	0.656
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1797316-1797347	11	0.656
NZ_CP022577_13	13.2\|4173567\|32\|NZ_CP022577\|CRT	4173567-4173598	32	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	71709-71740	12	0.625
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1603109-1603140	13	0.594
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1403949-1403980	13	0.594
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1603236-1603267	13	0.594
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1355265-1355296	13	0.594
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	CP000662	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence	700709-700740	13	0.594
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1602738-1602769	13	0.594
NZ_CP022577_13	13.4\|4173693\|32\|NZ_CP022577\|CRT	4173693-4173724	32	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	155711-155742	13	0.594

1. spacer 3.9|1644497|21|NZ_CP022577|CRT matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 1, identity: 0.952

aatggcgggctcctgttcggc	CRISPR spacer
aatggcgggctcctgctcggc	Protospacer
***************.*****

2. spacer 5.13|2855460|21|NZ_CP022577|CRT matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

tcgccgagcagccagccgccg	CRISPR spacer
tcgccgagcacccagccgccg	Protospacer
********** **********

3. spacer 5.13|2855460|21|NZ_CP022577|CRT matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

tcgccgagcagccagccgccg	CRISPR spacer
tcgccaagcagccagccgccg	Protospacer
*****.***************

4. spacer 8.3|3330750|21|NZ_CP022577|CRISPRCasFinder matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 1, identity: 0.952

ggcaccgccgggcgcaccgac	CRISPR spacer
ggcaccaccgggcgcaccgac	Protospacer
******.**************

5. spacer 8.3|3330750|21|NZ_CP022577|CRISPRCasFinder matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 1, identity: 0.952

ggcaccgccgggcgcaccgac	CRISPR spacer
ggcaccaccgggcgcaccgac	Protospacer
******.**************

6. spacer 5.13|2855460|21|NZ_CP022577|CRT matches to NZ_CP009112 (Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence) position: , mismatch: 2, identity: 0.905

tcgccgagcagccagccgccg	CRISPR spacer
ctgccgagcagccagccgccg	Protospacer
..*******************

7. spacer 9.1|3331152|21|NZ_CP022577|CRISPRCasFinder matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.905

gttgccgaagaacccggcgtt	CRISPR spacer
gttgccgaagaacccggcgac	Protospacer
******************* .

8. spacer 10.7|3359047|24|NZ_CP022577|CRT matches to MN585195 (Pseudomonas phage AUS531phi, complete genome) position: , mismatch: 2, identity: 0.917

caacggcggactgttcgccaacgg	CRISPR spacer
caacagcgggctgttcgccaacgg	Protospacer
****.****.**************

9. spacer 10.7|3359047|24|NZ_CP022577|CRT matches to NC_028657 (Pseudomonas phage YMC11/02/R656, complete genome) position: , mismatch: 2, identity: 0.917

caacggcggactgttcgccaacgg	CRISPR spacer
caacagcgggctgttcgccaacgg	Protospacer
****.****.**************

10. spacer 10.7|3359047|24|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 2, identity: 0.917

caacggcggactgttcgccaacgg	CRISPR spacer
cgacggcggactgatcgccaacgg	Protospacer
*.*********** **********

11. spacer 10.7|3359047|24|NZ_CP022577|CRT matches to NZ_AP022607 (Mycobacterium branderi strain JCM 12687 plasmid pJCM12687) position: , mismatch: 2, identity: 0.917

caacggcggactgttcgccaacgg	CRISPR spacer
cgacggcggactgatcgccaacgg	Protospacer
*.*********** **********

12. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP032327 (Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgacgttctgatcggcaacgg	Protospacer
***** *** **************

13. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP007798 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p5, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgacgttctgatcggcaacgg	Protospacer
***** *** **************

14. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP005087 (Sphingobium sp. TKS plasmid pTK3, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
cgacgccgtgctgatcggcagcgg	Protospacer
*.******************.***

15. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
ccacgccgtgctgaccggcaacgg	Protospacer
* ************.*********

16. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
ccacgccgtgctgaccggcaacgg	Protospacer
* ************.*********

17. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
ccacgccgtgctgaccggcaacgg	Protospacer
* ************.*********

18. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgggctgatcggaaacgg	Protospacer
******** ********* *****

19. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacggcgtgctgctcggcaacgg	Protospacer
***** ******* **********

20. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgtgctgctcggcatcgg	Protospacer
************* ****** ***

21. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
ccacgccgtgctgaccggcaacgg	Protospacer
* ************.*********

22. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP014802 (Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgacgagctgatcggcaacgg	Protospacer
***** ** ***************

23. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to CU468217 (Azospirillum brasilense bacteriophage Cd, complete genome) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
ccacgccgtgctgaccggcaacgg	Protospacer
* ************.*********

24. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NC_010355 (Azospirillum phage Cd, complete genome) position: , mismatch: 2, identity: 0.917

caacgccgtgctgatcggcaacgg	CRISPR spacer
ccacgccgtgctgaccggcaacgg	Protospacer
* ************.*********

25. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP010862 (Marinovum algicola DG 898 plasmid pMaD7) position: , mismatch: 2, identity: 0.923

gcgccggagccgttggtgccgccggt	CRISPR spacer
gtgccggagcctttggtgccgccggt	Protospacer
*.********* **************

26. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP010862 (Marinovum algicola DG 898 plasmid pMaD7) position: , mismatch: 2, identity: 0.923

gcgccggagccgttggtgccgccggt	CRISPR spacer
gtgccggagcctttggtgccgccggt	Protospacer
*.********* **************

27. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gtcgccaccggcgccggtgccgc	Protospacer
**.*******************.

28. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP025081 (Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

29. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP031258 (Klebsiella quasipneumoniae strain L22 plasmid pL22-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

30. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP011600 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-215, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

31. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP011601 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

32. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP030924 (Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

33. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP014011 (Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

34. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP037743 (Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

35. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052159 (Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

36. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP042506 (Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

37. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP042507 (Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

38. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP033955 (Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

39. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MT077884 (Escherichia coli plasmid p33, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

40. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MT077886 (Escherichia coli plasmid p39, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

41. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP026170 (Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

42. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052432 (Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

43. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052144 (Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

44. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052363 (Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

45. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MN423361 (Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

46. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP054602 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gctgacaccggcgccggtgccgt	Protospacer
*.** ******************

47. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK347226 (Klebsiella pneumoniae strain K185 plasmid pK185_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

48. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK347227 (Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

49. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK347228 (Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

50. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK347229 (Klebsiella pneumoniae strain K199 plasmid pK199_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

51. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK347230 (Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

52. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK347231 (Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

53. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK347232 (Klebsiella pneumoniae strain K211 plasmid pK211_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

54. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK347233 (Klebsiella pneumoniae strain K214 plasmid pK214_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

55. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK347234 (Klebsiella pneumoniae strain K230 plasmid pK230_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

56. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK347235 (Klebsiella pneumoniae strain K232 plasmid pK232_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

57. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK347236 (Klebsiella pneumoniae strain K234 plasmid pK234_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

58. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK347237 (Klebsiella pneumoniae strain K235 plasmid pK235_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

59. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK347238 (Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

60. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP034776 (Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

61. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052357 (Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

62. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP014009 (Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

63. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MN310380 (Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

64. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP008825 (UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

65. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP041374 (Klebsiella pneumoniae strain KP58 plasmid pKP58-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

66. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052232 (Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

67. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP040546 (Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-VIR, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

68. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP044215 (Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

69. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP030355 (Novosphingobium sp. P6W plasmid pP6W2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gatgccaccggcggcggtgccgt	Protospacer
* *********** *********

70. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP036191 (Klebsiella pneumoniae strain BA34918 plasmid pvirulence_VBA34918, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

71. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052563 (Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

72. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP042494 (Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

73. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP042495 (Leclercia adecarboxylata strain E61 plasmid pE61_002, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

74. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP040696 (Citrobacter freundii strain R47 plasmid pR47-309, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

75. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_AP019666 (Klebsiella pneumoniae strain TA6363 plasmid pTMTA63631, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

76. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP042552 (Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

77. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP016526 (Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

78. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP035906 (Klebsiella pneumoniae strain BA4656 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

79. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

80. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP034416 (Klebsiella pneumoniae strain C789 plasmid pVir-CR-hvKP-C789, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

81. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052190 (Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

82. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP030270 (Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

83. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP035384 (Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

84. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP040540 (Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

85. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

86. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP026166 (Klebsiella pneumoniae strain F81 plasmid pF81_2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

87. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052304 (Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

88. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP052037 (Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

89. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052204 (Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

90. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP023135 (Klebsiella pneumoniae subsp. pneumoniae strain KpvK54 plasmid pKpvK54, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

91. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

92. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NC_012556 (Enterobacter cloacae plasmid pEC-IMPQ, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

93. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NC_012555 (Enterobacter cloacae plasmid pEC-IMP, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

94. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP042579 (Enterobacter kobei strain C16 plasmid pC16_001, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

95. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP034124 (Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

96. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052178 (Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

97. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP054751 (Klebsiella pneumoniae strain KP20194c3 plasmid pKP20194c3-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

98. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP054781 (Klebsiella pneumoniae strain KP20194a plasmid pKP20194a-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

99. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

100. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP032842 (Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

101. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP018338 (Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

102. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP034083 (Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

103. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP050281 (Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

104. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP054763 (Klebsiella pneumoniae strain KP20194b2 plasmid pKP20194b2-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

105. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP026012 (Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

106. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP026024 (Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

107. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP042525 (Citrobacter freundii strain E11 plasmid pE11_001, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

108. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP054745 (Klebsiella pneumoniae strain KP20194c4 plasmid pKP20194c4-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

109. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP054727 (Klebsiella pneumoniae strain KP20194e plasmid pKP20194e-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

110. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP054739 (Klebsiella pneumoniae strain KP20194c5 plasmid pKP20194c5-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

111. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP054775 (Klebsiella pneumoniae strain KP20194a2 plasmid pKP20194a2-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

112. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP054733 (Klebsiella pneumoniae strain KP20194d plasmid pKP20194d-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

113. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP054721 (Klebsiella pneumoniae strain KP20194f plasmid pKP20194f-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

114. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP054757 (Klebsiella pneumoniae strain KP20194c plasmid pKP20194c-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

115. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP054769 (Klebsiella pneumoniae strain KP20194b plasmid pKP20194b-p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

116. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP022533 (Enterobacter hormaechei strain MS7884A plasmid pMS7884A, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

117. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP041024 (Klebsiella pneumoniae strain KP1692 plasmid pKP1692, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

118. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052317 (Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

119. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP054064 (Klebsiella pneumoniae strain WSHvKP plasmid pSWHvKp, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

120. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP029717 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed4, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

121. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP042489 (Enterobacter hormaechei strain C15 plasmid pC15_001, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

122. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052495 (Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

123. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_MK413722 (Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

124. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NC_017541 (Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

125. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP033103 (Enterobacter hormaechei strain L51 plasmid pEHZJ1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

126. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_MH263654 (Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

127. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_MF398271 (Klebsiella pneumoniae subsp. pneumoniae strain 70-2 plasmid pKP70-2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

128. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_MF344580 (Enterobacter cloacae strain 30860 plasmid p30860-HI2, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

129. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_MH399264 (Enterobacter cloacae strain RJ702 plasmid pIMP26, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

130. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_KY863418 (Enterobacter asburiae strain AMA 497 plasmid pOXA436, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

131. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_KY978628 (Cronobacter sakazakii strain 505108 plasmid p505108-MDR, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

132. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_MF788071 (Raoultella ornithinolytica strain 23141 plasmid p23141-3, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

133. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP040534 (Klebsiella pneumoniae strain CR-HvKP1 plasmid pCR-HvKP1-VIR, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

134. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MH727545 (Mycobacterium phage DismalStressor, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

135. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MN871473 (UNVERIFIED: Pseudomonas virus Pa-Z, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccaccggcggcggcgccgt	Protospacer
************* ***.*****

136. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to KJ510412 (Mycobacterium phage ZoeJ, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

137. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NC_026598 (Mycobacterium phage Milly, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

138. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to AF068845 (Mycobacteriophage TM4, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

139. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MH834601 (Mycobacterium phage BoostSeason, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

140. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to KX688047 (Mycobacterium phage Marcoliusprime, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

141. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to KX171208 (Pseudomonas phage vB_Pae436M-8, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccaccggcggcggcgccgt	Protospacer
************* ***.*****

142. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NC_028759 (Mycobacterium phage Mufasa, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

143. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK318076 (Pseudomonas phage vB_PaeM_fHoPae01, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccaccggcggcggcgccgt	Protospacer
************* ***.*****

144. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MF140408 (Mycobacterium phage DismalFunk, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

145. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NC_003387 (Mycobacterium phage TM4, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

146. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MT119369 (Pseudomonas phage sortsol, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccaccggcggcggcgccgt	Protospacer
************* ***.*****

147. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_KX810825 (Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

148. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP028197 (Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

149. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052163 (Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

150. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP026022 (Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

151. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MN200128 (Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

152. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MN200130 (Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

153. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP048293 (Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

154. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP019049 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

155. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP020529 (Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

156. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP024708 (Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

157. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_LR134257 (Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

158. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP031567 (Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

159. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP035380 (Leclercia adecarboxylata strain R25 plasmid pLA-109, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

160. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

161. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NC_005249 (Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

162. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NC_008573 (Shewanella sp. ANA-3 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

163. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP022696 (Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

164. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP052873 (Enterobacter cloacae strain 3849 plasmid p3846III, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

165. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP032241 (Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

166. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_AP018757 (Metakosakonia sp. MRY16-398 plasmid pMRY16-398_1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

167. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NC_006625 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

168. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP026390 (Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

169. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP008899 (Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

170. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP047193 (Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

171. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP031575 (Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

172. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP032164 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

173. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP047678 (Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVF1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

174. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP047676 (Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVL1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

175. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP025983 (Enterobacteriaceae bacterium A-F18 plasmid pAF18_1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

176. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP013215 (Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

177. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP029383 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

178. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_AP019549 (Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

179. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP050276 (Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

180. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

181. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP052259 (Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

182. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP026587 (Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

183. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_LR745046 (Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

184. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_LR745043 (Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

185. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_MK715436 (Klebsiella pneumoniae subsp. pneumoniae strain SCNJ1 plasmid pVir-SCNJ1, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

186. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_MN058044 (Klebsiella pneumoniae strain KP1677 plasmid pKP1677, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

187. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP016815 (Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

188. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP049047 (Enterobacter hormaechei strain Y233 plasmid pIHI2-233, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

189. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_MG053312 (Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

190. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MT090958 (Klebsiella pneumoniae strain KP18-2079 plasmid pKP18-2079_vir, complete sequence) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccagcggggccggtgccgt	Protospacer
******* *** ***********

191. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to MT118290 (Pseudomonas phage Epa10, complete genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgccaccggcggcggcgccgt	Protospacer
************* ***.*****

192. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to KC787101 (Mycobacterium phage 33D, partial genome) position: , mismatch: 2, identity: 0.913

gttgccaccggcgccggtgccgt	CRISPR spacer
ggtgccatcggcgccggtgccgt	Protospacer
* *****.***************

193. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 2, identity: 0.917

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggccttc	Protospacer
******************** **.

194. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 2, identity: 0.917

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggccttc	Protospacer
******************** **.

195. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 2, identity: 0.917

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggccttc	Protospacer
******************** **.

196. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 2, identity: 0.917

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggccttt	Protospacer
************** ***** ***

197. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 2, identity: 0.917

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggccttt	Protospacer
************** ***** ***

198. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to MT723937 (Gordonia phage JKSyngboy, complete genome) position: , mismatch: 3, identity: 0.889

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ttcggcggactcgcgtacgacgccggt	Protospacer
 **************  **********

199. spacer 3.8|1644455|24|NZ_CP022577|CRT matches to NZ_CP014599 (Yangia sp. CCB-MM3 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.875

accggcactaatgtcaccggcggt	CRISPR spacer
aacggcactaatgtcaccggcgtg	Protospacer
* ********************

200. spacer 3.8|1644455|24|NZ_CP022577|CRT matches to NZ_CP028945 (Vibrio sp. dhg plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

accggcactaatgtcaccggcggt	CRISPR spacer
accggcactaatgtcaccgccaga	Protospacer
******************* *.*

201. spacer 4.2|2765733|24|NZ_CP022577|CRT matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 3, identity: 0.875

gccgccgaggtcggttcggccgga	CRISPR spacer
gccgccgatgtcggtgcggccggt	Protospacer
******** ****** *******

202. spacer 4.2|2765733|24|NZ_CP022577|CRT matches to MH719194 (Pseudomonas phage Ps60, complete genome) position: , mismatch: 3, identity: 0.875

gccgccgaggtcggttcggccgga	CRISPR spacer
gcctccgaggtcggtgcggccggc	Protospacer
*** *********** *******

203. spacer 4.2|2765733|24|NZ_CP022577|CRT matches to MK511059 (Pseudomonas phage CF78, partial genome) position: , mismatch: 3, identity: 0.875

gccgccgaggtcggttcggccgga	CRISPR spacer
gcctccgaggtcggtgcggccggc	Protospacer
*** *********** *******

204. spacer 4.2|2765733|24|NZ_CP022577|CRT matches to MK511062 (Pseudomonas phage CF127, partial genome) position: , mismatch: 3, identity: 0.875

gccgccgaggtcggttcggccgga	CRISPR spacer
gcctccgaggtcggtgcggccggc	Protospacer
*** *********** *******

205. spacer 4.2|2765733|24|NZ_CP022577|CRT matches to MK511061 (Pseudomonas phage CF125, partial genome) position: , mismatch: 3, identity: 0.875

gccgccgaggtcggttcggccgga	CRISPR spacer
gcctccgaggtcggtgcggccggc	Protospacer
*** *********** *******

206. spacer 4.2|2765733|24|NZ_CP022577|CRT matches to JX495043 (Pseudomonas phage JBD67, partial genome) position: , mismatch: 3, identity: 0.875

gccgccgaggtcggttcggccgga	CRISPR spacer
gcctccgaggtcggtgcggccggc	Protospacer
*** *********** *******

207. spacer 4.2|2765733|24|NZ_CP022577|CRT matches to LN898172 (Pseudomonas phage vB_PaeS_PM105) position: , mismatch: 3, identity: 0.875

gccgccgaggtcggttcggccgga	CRISPR spacer
gcctccgaggtcggtgcggccggc	Protospacer
*** *********** *******

208. spacer 4.2|2765733|24|NZ_CP022577|CRT matches to MK511063 (Pseudomonas phage CF177, partial genome) position: , mismatch: 3, identity: 0.875

gccgccgaggtcggttcggccgga	CRISPR spacer
gcctccgaggtcggtgcggccggc	Protospacer
*** *********** *******

209. spacer 4.2|2765733|24|NZ_CP022577|CRT matches to MN536027 (Pseudomonas phage vB_Pae-SS2019XII, complete genome) position: , mismatch: 3, identity: 0.875

gccgccgaggtcggttcggccgga	CRISPR spacer
gcctccgaggtcggtgcggccggc	Protospacer
*** *********** *******

210. spacer 4.2|2765733|24|NZ_CP022577|CRT matches to JX495041 (Pseudomonas phage JBD18, complete genome) position: , mismatch: 3, identity: 0.875

gccgccgaggtcggttcggccgga	CRISPR spacer
gcctccgaggtcggtgcggccggc	Protospacer
*** *********** *******

211. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 3, identity: 0.9

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gccgccggcggcgaacagcaggccggcgac	Protospacer
******** * ***************** *

212. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 3, identity: 0.9

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gccgccggcggcgaacagcaggccggcgac	Protospacer
******** * ***************** *

213. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 3, identity: 0.9

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gccgccggcggcgaacagcaggccggcgac	Protospacer
******** * ***************** *

214. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 3, identity: 0.9

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gccgccggcggcgaacagcaggccggcgac	Protospacer
******** * ***************** *

215. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.9

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgttgccgaacagcagccctccc	Protospacer
*********.***************** *

216. spacer 5.17|2855634|24|NZ_CP022577|CRT matches to NC_010311 (Streptomyces sp. HK1 plasmid pSHK1, complete sequence) position: , mismatch: 3, identity: 0.875

agccacccaccgggggccccggtg	CRISPR spacer
tgccacccaccgggggcgctggtg	Protospacer
 **************** *.****

217. spacer 5.17|2855634|24|NZ_CP022577|CRT matches to NZ_CP026489 (Streptomyces sp. 604F plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

agccacccaccgggggccccggtg	CRISPR spacer
tgccacccaccgggggcgctggtg	Protospacer
 **************** *.****

218. spacer 10.7|3359047|24|NZ_CP022577|CRT matches to NC_011987 (Agrobacterium radiobacter K84 plasmid pAtK84c, complete sequence) position: , mismatch: 3, identity: 0.875

caacggcggactgttcgccaacgg	CRISPR spacer
caacggcggtctgttcgacaacgc	Protospacer
********* ******* *****

219. spacer 10.7|3359047|24|NZ_CP022577|CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 3, identity: 0.875

caacggcggactgttcgccaacgg	CRISPR spacer
caacggcggactgttctccgacga	Protospacer
**************** **.***.

220. spacer 10.16|3359527|24|NZ_CP022577|CRT matches to MN103533 (Mycobacterium phage Weirdo19, complete genome) position: , mismatch: 3, identity: 0.875

cagcggtgccaacgctctaggcgc	CRISPR spacer
ccacggtgccaacgctctaggccc	Protospacer
* .******************* *

221. spacer 10.17|3359572|24|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.875

tgacggtggccacgccggggtgtt	CRISPR spacer
cgacggtgaccgcgccggggtgtt	Protospacer
.*******.**.************

222. spacer 10.17|3359572|24|NZ_CP022577|CRT matches to MN428050 (Mycobacterium phage Apex, complete genome) position: , mismatch: 3, identity: 0.875

tgacggtggccacgccggggtgtt	CRISPR spacer
tgccggtggccacaccggggtgta	Protospacer
** **********.*********

223. spacer 10.17|3359572|24|NZ_CP022577|CRT matches to NC_042035 (Mycobacterium phage Zemanar, complete sequence) position: , mismatch: 3, identity: 0.875

tgacggtggccacgccggggtgtt	CRISPR spacer
tgccggtggccacaccggggtgta	Protospacer
** **********.*********

224. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgcggtgctgatcgccaacgc	Protospacer
****** ********** *****

225. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgcgctgatcggcaccgc	Protospacer
********.*********** **

226. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NC_022061 (Mycobacterium phage KayaCho, complete genome) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
cgtcgcggtgctgatcggcaacgg	Protospacer
*. *** *****************

227. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP019938 (Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
cacccccgtgctgatcggcaacgc	Protospacer
** * ******************

228. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgaggtgatcggcaacga	Protospacer
******** * ************.

229. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgcggtgctgatcgccaacgc	Protospacer
****** ********** *****

230. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccgaggtgatcggcaacga	Protospacer
******** * ************.

231. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
caacgccctgctgatcgccaacgt	Protospacer
******* ********* *****

232. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
cggcgccgtgctgatcggcagcgg	Protospacer
*..*****************.***

233. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP054618 (Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
aaacgccgtgctgctcggcaaagg	Protospacer
 ************ ******* **

234. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to MK415401 (Phage apr34_1789, complete genome) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
aaacgccgtgctgctgggcaacgg	Protospacer
 ************ * ********

235. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to MK415401 (Phage apr34_1789, complete genome) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
aaacgccgtgctgctgggcaacgg	Protospacer
 ************ * ********

236. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to MK415401 (Phage apr34_1789, complete genome) position: , mismatch: 3, identity: 0.875

caacgccgtgctgatcggcaacgg	CRISPR spacer
aaacgccgtgctgctgggcaacgg	Protospacer
 ************ * ********

237. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_LR134451 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence) position: , mismatch: 3, identity: 0.885

gcggagtcgtcgccggccccgccggt	CRISPR spacer
accgagtcgccgccggccccgccggt	Protospacer
.* ******.****************

238. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
atcgccaccggcgccggtgccgc	Protospacer
.*.*******************.

239. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to CP049262 (Cronobacter sakazakii strain CS-09 plasmid pCsaCS09b, complete sequence) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
cttgccaccggctccggtgccgg	Protospacer
 *********** *********

240. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
cgtgccgccggcgccggtgccgt	Protospacer
  ****.****************

241. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP016024 (Ralstonia insidiosa strain ATCC 49129 plasmid pRI-1, complete sequence) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
attgccaccggtgccggtgccga	Protospacer
.**********.**********

242. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
atcgccaccggcgccggtgccgc	Protospacer
.*.*******************.

243. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to AP014203 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C76-MedDCM-OCT-S35-C25, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
cttgccaccggcgacggtgccgc	Protospacer
 ************ ********.

244. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
gttgcaaccggcgccggtgccag	Protospacer
***** ***************.

245. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to KJ680225 (Uncultured bacterium plasmid PLAsvaD clone PLAsvaD-1, complete sequence) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
attgccaccggtgccggtgccga	Protospacer
.**********.**********

246. spacer 13.7|4173855|23|NZ_CP022577|CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.87

gttgccaccggcgccggtgccgt	CRISPR spacer
cgtgccgccggcgccggtgccgt	Protospacer
  ****.****************

247. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggcgaac	Protospacer
*********************  .

248. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggcgaag	Protospacer
*********************

249. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggcgaag	Protospacer
*********************

250. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggcgaag	Protospacer
*********************

251. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP044989 (Deinococcus sp. AJ005 plasmid p380k, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
cctgcgccgatcagcccggcgtcc	Protospacer
** *******************..

252. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgttg	Protospacer
 ************** *******

253. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgttg	Protospacer
 ************** *******

254. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggccccgatcagcccggcgtag	Protospacer
***** ****************

255. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP020897 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

256. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013524 (Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

257. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013553 (Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggctttc	Protospacer
.******************* **.

258. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013586 (Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

259. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013559 (Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

260. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013576 (Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

261. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013548 (Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

262. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013528 (Rhizobium phaseoli strain R723 plasmid pRphaR723a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

263. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013533 (Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

264. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013538 (Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

265. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013543 (Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

266. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013564 (Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggctttc	Protospacer
.******************* **.

267. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021368 (Acidovorax carolinensis strain P4 plasmid pACP4.2, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatctgcccggcgtcc	Protospacer
************ *********..

268. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013581 (Rhizobium phaseoli strain N261 plasmid pRphaN261a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

269. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013570 (Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccggccttc	Protospacer
.******************* **.

270. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021364 (Acidovorax carolinensis strain P3 plasmid pACP3.2, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatctgcccggcgtcc	Protospacer
************ *********..

271. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggccttc	Protospacer
************** ***** **.

272. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

273. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

274. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

275. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcaccgatcagcccggcgagt	Protospacer
*****.***************  *

276. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccgccgatg	Protospacer
****************** ** *

277. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccgccgatg	Protospacer
****************** ** *

278. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

279. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggccttc	Protospacer
************** ***** **.

280. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

281. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

282. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to CP052389 (Klebsiella pneumoniae strain C17KP0052 plasmid pC17KP0052-1) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgaccagcccggcgatg	Protospacer
**********.********** *

283. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

284. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP016453 (Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ctggcgcggatcagcccggcgttg	Protospacer
*.***** ***************

285. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggccttc	Protospacer
************** ***** **.

286. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

287. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

288. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

289. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

290. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to CU468217 (Azospirillum brasilense bacteriophage Cd, complete genome) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

291. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_010355 (Azospirillum phage Cd, complete genome) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

292. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgcctatcaggccggcgttt	Protospacer
.******* ***** *********

293. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

294. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

295. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgcctatcaggccggcgttt	Protospacer
.******* ***** *********

296. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_007764 (Rhizobium etli CFN 42 plasmid p42c, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

297. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

298. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021026 (Rhizobium sp. TAL182 plasmid pRetTAL182b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

299. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP020908 (Rhizobium etli strain NXC12 plasmid pRetNXC12b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

300. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

301. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

302. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

303. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013597 (Rhizobium sp. N741 plasmid pRspN741b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

304. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

305. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

306. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_021907 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

307. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013501 (Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

308. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013507 (Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

309. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013518 (Rhizobium sp. N113 plasmid pRspN113a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

310. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

311. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013491 (Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

312. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013513 (Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

313. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013496 (Rhizobium sp. N621 plasmid pRspN621a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

314. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013591 (Rhizobium sp. N871 plasmid pRspN871a, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

315. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

316. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

317. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

318. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

319. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

320. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

321. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

322. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

323. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

324. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

325. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

326. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

327. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggtgccgatcagcccggcgatt	Protospacer
.***.**************** **

328. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013603 (Rhizobium sp. N731 plasmid pRspN731b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggagccgatcagcccggccttc	Protospacer
**** *************** **.

329. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgatg	Protospacer
******** ************ *

330. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 3, identity: 0.875

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggccttc	Protospacer
************** ***** **.

331. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_LN831788 (Streptomyces leeuwenhoekii strain type strain (C34 = DSM 42122 = NRRL B-24963) plasmid pSLE1, complete sequence) position: , mismatch: 3, identity: 0.889

ccggcgccgccatcgccgaccaggtac-	CRISPR spacer
cccgcgccgccatggccgacca-gtacg	Protospacer
** ********** ******** ****

332. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctcggcggcctcgtggccgacgccggc	Protospacer
 ******* ****.************.

333. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctcggcggcctcgtggccgacgccggc	Protospacer
 ******* ****.************.

334. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
gccggcggtctcggggccgacgccggg	Protospacer
*.****** **** ************

335. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
gccggcggtctcggggccgacgccggg	Protospacer
*.****** **** ************

336. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to NZ_CP050100 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b3, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ttcggcggcgtcgcggccgacgccgat	Protospacer
 *******  ***************.*

337. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to NZ_CP009439 (Streptomyces glaucescens strain GLA.O plasmid pSglau1, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctcggcgggctcgcggccggcgccgat	Protospacer
 *******.**********.*****.*

338. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ttcggcggcgtcgcggccgacgccgat	Protospacer
 *******  ***************.*

339. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 4, identity: 0.852

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ggcggcggactccccgccgacgccgct	Protospacer
* ********** * ********** *

340. spacer 4.2|2765733|24|NZ_CP022577|CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 4, identity: 0.833

gccgccgaggtcggttcggccgga	CRISPR spacer
agcgccgaggtcagttcggccggc	Protospacer
. **********.**********

341. spacer 4.2|2765733|24|NZ_CP022577|CRT matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 4, identity: 0.833

gccgccgaggtcggttcggccgga	CRISPR spacer
accgccgacgtcggttcggccgtt	Protospacer
.******* *************

342. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP054625 (Cupriavidus gilardii strain FDAARGOS_639 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

gccgc-cggagccgaacagcaggccggcgtc	CRISPR spacer
-cagcgcggagccgcacagcaggccggcggc	Protospacer
 * ** ******** ************** *

343. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 4, identity: 0.867

gcgccgccgctgccgaacagcagccctgcg-	CRISPR spacer
ccgccgccgctgccgaacagca-cgttgcgg	Protospacer
 ********************* * .****

344. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP018732 (Xanthomonas gardneri strain ICMP 7383 plasmid pICMP7383.1, complete sequence) position: , mismatch: 4, identity: 0.867

-gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gtcgccg-cgctgcccaacagcagccatgcg	Protospacer
  ***** ******* ********** ****

345. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP023976 (Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence) position: , mismatch: 4, identity: 0.879

ggcgcgc-ccgagcccgccgcgccggacccgccg	CRISPR spacer
-ccgcgcaccgagcccgccgcgcaggccccgccg	Protospacer
  ***** *************** ** *******

346. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NC_003903 (Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence) position: , mismatch: 4, identity: 0.852

ccacggcgccgctggcggtgtcccggc--	CRISPR spacer
gcacggcgccgctggtggtgt--cggcca	Protospacer
 **************.*****  ****

347. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 4, identity: 0.852

ccacggcgccgctggcggtgtc--ccggc	CRISPR spacer
tcacgtcgccgctggcggtgtcgaccg--	Protospacer
.**** ****************  ***

348. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NZ_CP049701 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence) position: , mismatch: 4, identity: 0.852

ccacggcgccgctggcggtgtcccggc--	CRISPR spacer
gcacggcgccgctggcgctgt--cggcca	Protospacer
 **************** ***  ****

349. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NZ_CP049701 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence) position: , mismatch: 4, identity: 0.852

ccacggcgccgctggcggtgtcccggc--	CRISPR spacer
gcacggcgccgctggcgctgt--cggcca	Protospacer
 **************** ***  ****

350. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NZ_CP049701 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence) position: , mismatch: 4, identity: 0.852

ccacggcgccgctggcggtgtcccggc--	CRISPR spacer
gcacggcgccgctggcgctgt--cggcca	Protospacer
 **************** ***  ****

351. spacer 10.13|3359374|27|NZ_CP022577|CRT matches to NZ_CP050441 (Tolypothrix sp. PCC 7910 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

gaacggcgccttactcttcggcttcgg	CRISPR spacer
gcacagcgccttacttttcggcttcag	Protospacer
* **.**********.*********.*

352. spacer 10.15|3359479|27|NZ_CP022577|CRT matches to NZ_CP018075 (Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence) position: , mismatch: 4, identity: 0.852

gaacggcggcttgctcttcggctccgc	CRISPR spacer
gctcggcggcgtgatcttcggctccgc	Protospacer
*  ******* ** *************

353. spacer 10.17|3359572|24|NZ_CP022577|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 4, identity: 0.833

tgacggtggccacgccggggtgtt	CRISPR spacer
ccgcggcggccacgccggggtgtt	Protospacer
. .***.*****************

354. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP033583 (Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence) position: , mismatch: 4, identity: 0.833

caacgccgtgctgatcggcaacgg	CRISPR spacer
ggacgccgtgctgatcggcaccgc	Protospacer
 .****************** **

355. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 4, identity: 0.833

caacgccgtgctgatcggcaacgg	CRISPR spacer
tggcgccgtgctgttcggcaacgg	Protospacer
...********** **********

356. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 4, identity: 0.833

caacgccgtgctgatcggcaacgg	CRISPR spacer
tggcgccgtgctgttcggcaacgg	Protospacer
...********** **********

357. spacer 10.19|3359666|24|NZ_CP022577|CRT matches to NZ_CP041162 (Leisingera aquaemixtae strain R2C4 plasmid unnamed6) position: , mismatch: 4, identity: 0.833

caacgccgtgctgatcggcaacgg	CRISPR spacer
gcccgccgtgctgttcggcaacgg	Protospacer
   ********** **********

358. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_DQ996271 (Burkholderia glumae BGR1 plasmid pBGF3, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgccggcgctgttggtgccgccgaa	Protospacer
******* **.*************.

359. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
cggccggtgcccttggtgccgccggt	Protospacer
  ***** *** **************

360. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
ttggcggagccggtggtgccgccggt	Protospacer
 .* ******** *************

361. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP026546 (Cupriavidus metallidurans strain Ni-2 plasmid unnamed2) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
ccgccggagcctttggtgtcgccggc	Protospacer
 ********** ******.******.

362. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgccggagccgttggtgccatcgcg	Protospacer
********************..**

363. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgccggagccgttggtgccatcgcg	Protospacer
********************..**

364. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
ttggcggagccggtggtgccgccggt	Protospacer
 .* ******** *************

365. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
atgccggtgccgctggtgccgccggt	Protospacer
..***** ****.*************

366. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
cggccggtgcccttggtgccgccggt	Protospacer
  ***** *** **************

367. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to KT281796 (Mycobacterium phage Zakhe101, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

368. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to AY129335 (Mycobacterium virus Corndog, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

369. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to MK493325 (Synechococcus phage S-RIM8 isolate RW_62_0316, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

370. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to MK493322 (Synechococcus phage S-RIM8 isolate RW_01_0115_WH8101, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

371. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to KX349288 (Synechococcus phage S-RIM8 isolate RW_08_0711, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

372. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to MN428058 (Mycobacterium phage Krili, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

373. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to KX349286 (Synechococcus phage S-RIM8 isolate RW_03_0807_WH8101, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

374. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NC_004685 (Mycobacterium phage Corndog, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

375. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to JN698993 (Mycobacterium phage Firecracker, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

376. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to MK493324 (Synechococcus phage S-RIM8 isolate RW_22_0214, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

377. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to KX349290 (Synechococcus phage S-RIM8 isolate RW_25_1112, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

378. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to KX349287 (Synechococcus phage S-RIM8 isolate RW_06_0613, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgctggagccgtttgtgccgccgcc	Protospacer
****.********* ********* .

379. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to MN585964 (Mycobacterium phage Blessica, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

380. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NC_022057 (Mycobacterium phage Catdawg, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

381. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to MT818425 (Mycobacterium phage NiebruSaylor, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

382. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NC_022325 (Mycobacterium phage Dylan, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

383. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to MN428052 (Mycobacterium phage Smooch, complete genome) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
aagccggagccgctggtcccgccggt	Protospacer
. **********.**** ********

384. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
tcgccggagccggtggtgctgccgct	Protospacer
 *********** ******.**** *

385. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
tcgccggagccggtggtgctgccgct	Protospacer
 *********** ******.**** *

386. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_AP022578 (Mycolicibacterium aubagnense strain JCM 15296 plasmid pJCM15296, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgcccgagccgttggcgccgccagc	Protospacer
***** **********.******.*.

387. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NC_017590 (Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence) position: , mismatch: 4, identity: 0.846

gcgccggagccgttggtgccgccggt	CRISPR spacer
gagccggagccgctggtgccgcccga	Protospacer
* **********.********** *

388. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

389. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aaggtgtcgtcgccggcaccgccggt	Protospacer
. ** ************ ********

390. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

391. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aaggtgtcgttgccggccccgccggt	Protospacer
. ** *****.***************

392. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aaggtgtcgtcgccggccccgccgga	Protospacer
. ** ********************

393. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

394. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aaggtgtcgtcgccggcaccgccggt	Protospacer
. ** ************ ********

395. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aaggtgtcgtcgccggcaccgccggt	Protospacer
. ** ************ ********

396. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

397. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

398. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

399. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccggt	Protospacer
.  * *********************

400. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP015441 (Erythrobacter atlanticus strain s21-N3 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
gcggagacggcgccggccccgccgca	Protospacer
****** ** **************

401. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_LR134447 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
gcggagtcctcgccggcgccgccgcc	Protospacer
******** ******** ****** .

402. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tcggcgtcgtcgccggcctcgccgat	Protospacer
 *** *************.*****.*

403. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 4, identity: 0.846

gcggagtcgtcgccggccccgccggt	CRISPR spacer
gcgaagtcgtcgccggccccgatggc	Protospacer
***.***************** .**.

404. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 4, identity: 0.875

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atcaccgccggtgccgtcgtcgccgccggcct	Protospacer
.** ************.**************.

405. spacer 14.6|4175176|28|NZ_CP022577|CRT matches to NC_008712 (Paenarthrobacter aurescens TC1 plasmid pTC1, complete sequence) position: , mismatch: 4, identity: 0.857

ggcacggtgatggtggtgccctgtgcgc-	CRISPR spacer
ggcacggtgatcgtggagccctg-gctcg	Protospacer
*********** **** ****** ** *

406. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP035418 (Leisingera sp. NJS204 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcccggcggca	Protospacer
 ******************** .

407. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP038237 (Leisingera sp. NJS201 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcccggcggca	Protospacer
 ******************** .

408. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgtcg	Protospacer
 ************** ******.

409. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gaggcgccgatctgcccggcgttg	Protospacer
  ********** **********

410. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgtcg	Protospacer
 ************** ******.

411. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgataagcccggcgtca	Protospacer
 ********** **********.

412. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to LR134132 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 12) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgacg	Protospacer
******** ************ .

413. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgtcg	Protospacer
 ************** ******.

414. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgtcg	Protospacer
 ************** ******.

415. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgaccagcccggcgaag	Protospacer
**********.**********

416. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcgcggcgtcg	Protospacer
 ************** ******.

417. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgaacagcccggcgagg	Protospacer
********** **********

418. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcacggcgggc	Protospacer
*************** *****  .

419. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgaag	Protospacer
******** ************

420. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcaggccggcgagg	Protospacer
************** ******

421. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gaggcgccgatctgcccggcgttg	Protospacer
  ********** **********

422. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP054618 (Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccgacgagg	Protospacer
******************.**

423. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgaga	Protospacer
**************** ****

424. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP041043 (Paracoccus sp. AK26 plasmid pAK3, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgacgatcagcccggcgacc	Protospacer
****** ************** ..

425. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gaggcgccgatctgcccggcgttg	Protospacer
  ********** **********

426. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP024583 (Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccgccgaag	Protospacer
****************** **

427. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgagg	Protospacer
**************** ****

428. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgaga	Protospacer
**************** ****

429. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
gaggcgccgatctgcccggcgttg	Protospacer
  ********** **********

430. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP022191 (Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
tcggcgccgatcagcccgtcgtca	Protospacer
.***************** ***.

431. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgagg	Protospacer
**************** ****

432. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgagg	Protospacer
**************** ****

433. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgagg	Protospacer
**************** ****

434. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgcccatcagcccggcgaag	Protospacer
******** ************

435. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgagg	Protospacer
**************** ****

436. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagccaggcgagg	Protospacer
**************** ****

437. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcacggcgggc	Protospacer
*************** *****  .

438. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to MK494131 (Mycobacterium phage GodPhather, complete genome) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcgcggcgcca	Protospacer
*************** *****..

439. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to MH001450 (Mycobacterium phage Jeon, complete genome) position: , mismatch: 4, identity: 0.833

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcgcggcgcca	Protospacer
*************** *****..

440. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgccgccgccatcgccgcccaggtcg	Protospacer
*** ************** ******

441. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccatcgccgacgaggaag	Protospacer
.******************* *** *

442. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccctcgccgacgaggtgg	Protospacer
*********** ******** ****.

443. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to MN586047 (Gordonia phage EMoore, complete genome) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgtcatcgccgagcaggtcg	Protospacer
*********.********* *****

444. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccaccatcgccgacctggcgc	Protospacer
********.************ **..*

445. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgtcgccatcggcgaccaggtgc	Protospacer
 *****.******** *********.*

446. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgacgccgccatagccgaccaggccc	Protospacer
***.********* **********. *

447. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgacgccgccatagccgaccaggccc	Protospacer
***.********* **********. *

448. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP024940 (Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence) position: , mismatch: 4, identity: 0.852

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgtccccatcgccgaccaggaag	Protospacer
******.* *************** *

449. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to MN657133 (Cryobacterium sp. strain ANT_H10B plasmid pA10BH1, complete sequence) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
gcgtgcggtctcgcggccgacgccggc	Protospacer
*.  **** *****************.

450. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ggcggcggactcgcggccgtcgccatc	Protospacer
* ***************** ****. .

451. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to NZ_CP029834 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
tgcggcggactggcggtcgacgccggc	Protospacer
  ********* ****.*********.

452. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to MK937603 (Gordonia phage Bakery, complete genome) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
gacggcggactcgcggtcgccgccgcg	Protospacer
* **************.** *****

453. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to KM389402 (UNVERIFIED: Pseudomonas phage F_HA1961sp/Pa1641 clone contig00002 genomic sequence) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctggccgtactcgcggccgacgccggc	Protospacer
 * * ** ******************.

454. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to NC_003278 (Pseudomonas phage phiCTX, complete genome) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctggccgtactcgcggccgacgccggc	Protospacer
 * * ** ******************.

455. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to Y13918 (Pseudomonas aeruginosa phage phi CTX DNA, complete genome) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctggccgtactcgcggccgacgccggc	Protospacer
 * * ** ******************.

456. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to AB008550 (Pseudomonas phage phiCTX DNA, complete genome) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctggccgtactcgcggccgacgccggc	Protospacer
 * * ** ******************.

457. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to MK034952 (Pseudomonas phage Dobby, complete genome) position: , mismatch: 5, identity: 0.815

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctggccgtactcgcggccgacgccggc	Protospacer
 * * ** ******************.

458. spacer 3.7|1644407|30|NZ_CP022577|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 5, identity: 0.833

gacggcgggttgttcttcggcgtgggcggt	CRISPR spacer
gccggcgggttgttctgcggcgttggcgca	Protospacer
* ************** ****** ****

459. spacer 3.7|1644407|30|NZ_CP022577|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

gacggcgggttgttcttcggcgtgggcggt	CRISPR spacer
gccggcgggttgttctgcggcgttggcgca	Protospacer
* ************** ****** ****

460. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 5, identity: 0.833

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
ttcgacgaagccgaacagcaggccggcgac	Protospacer
 .** **.******************** *

461. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.833

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
ttcgacgaagccgaacagcaggccggcgac	Protospacer
 .** **.******************** *

462. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP013631 (Rhizobium sp. N324 plasmid pRspN324a, complete sequence) position: , mismatch: 5, identity: 0.833

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gccgccggtgccgagcagcaggccgatggc	Protospacer
******** *****.**********..* *

463. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP024582 (Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

gccgccggagccgaacagcaggccg-gcgtc	CRISPR spacer
ggcgccggcgccgaacaggaggccgcgcat-	Protospacer
* ****** ********* ****** **.*

464. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP025188 (Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence) position: , mismatch: 5, identity: 0.833

gccgccggagccgaacagcaggccg-gcgtc	CRISPR spacer
ggcgccggcgccgaacaggaggccgcgcat-	Protospacer
* ****** ********* ****** **.*

465. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.833

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
acgccgccgatgccgaacagcagccccagg	Protospacer
.******** ****************.. *

466. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 5, identity: 0.833

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
ccgccggggctgccgaacagcagcccgtcg	Protospacer
 *****  ******************  **

467. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

gcgccgccgctgccgaacagcagccctgcg-	CRISPR spacer
gcgccgccgcagccgaacagcaatac-gcgc	Protospacer
********** ***********.. * ***

468. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 5, identity: 0.833

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcatcgccgcagccgaacagcagcccgtcg	Protospacer
**..****** ***************  **

469. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

gcgccgccgctgccgaacagcagccctgcg-	CRISPR spacer
gcgccgccgcagccgaacagcaatac-gcgc	Protospacer
********** ***********.. * ***

470. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.833

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcatcgccgcagccgaacagcagcccgtcg	Protospacer
**..****** ***************  **

471. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 5, identity: 0.833

gcgccgccgctgccgaacagcagccctgcg-	CRISPR spacer
gcgccgccgctgccgatcagc-gtcacgcgg	Protospacer
**************** **** *.* .***

472. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.833

gcgccgccgctgccgaacagcagccctgcg-	CRISPR spacer
gcgccgccgctgccgatcagc-gtcacgcgg	Protospacer
**************** **** *.* .***

473. spacer 5.6|2855127|27|NZ_CP022577|CRT matches to MF415411 (Klebsiella phage KPN U2874, complete genome) position: , mismatch: 5, identity: 0.815

tccccaccggtgtccaggttttcgccg	CRISPR spacer
acggcaccggcgtccaggttttcgcgg	Protospacer
 *  ******.************** *

474. spacer 5.6|2855127|27|NZ_CP022577|CRT matches to MF476924 (Klebsiella phage YMC15/11/N53_KPN_BP, complete genome) position: , mismatch: 5, identity: 0.815

tccccaccggtgtccaggttttcgccg	CRISPR spacer
acggcaccggcgtccaggttttcgcgg	Protospacer
 *  ******.************** *

475. spacer 5.6|2855127|27|NZ_CP022577|CRT matches to MF415413 (Klebsiella phage KPN N54, complete genome) position: , mismatch: 5, identity: 0.815

tccccaccggtgtccaggttttcgccg	CRISPR spacer
acggcaccggcgtccaggttttcgcgg	Protospacer
 *  ******.************** *

476. spacer 5.6|2855127|27|NZ_CP022577|CRT matches to MF415410 (Klebsiella phage KPN N137, complete genome) position: , mismatch: 5, identity: 0.815

tccccaccggtgtccaggttttcgccg	CRISPR spacer
acggcaccggcgtccaggttttcgcgg	Protospacer
 *  ******.************** *

477. spacer 5.6|2855127|27|NZ_CP022577|CRT matches to MG835858 (Klebsiella phage KPN N98, complete genome) position: , mismatch: 5, identity: 0.815

tccccaccggtgtccaggttttcgccg	CRISPR spacer
acggcaccggcgtccaggttttcgcgg	Protospacer
 *  ******.************** *

478. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 5, identity: 0.833

gcgccgc-ccggcccggcgagcattccggca	CRISPR spacer
-cgatgcaccggcccgtcgatcattccggca	Protospacer
 ** .** ******** *** **********

479. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.833

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
ccaccgccgccccccgccgagctgccacca	Protospacer
 * ******** ************** **.

480. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 5, identity: 0.833

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
gccccgccgccgcccgccgtgctgacgctg	Protospacer
***********.******* **** * *.*

481. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 5, identity: 0.833

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
gccccgccgccgcccgccgtgctgacgctg	Protospacer
***********.******* **** * *.*

482. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.833

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
gccccgccgccgcccgccgtgctgacgctg	Protospacer
***********.******* **** * *.*

483. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.833

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
gccccgccgccgcccgccgtgctgacgctg	Protospacer
***********.******* **** * *.*

484. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 5, identity: 0.833

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
gccccgccgcccgccgccgagctgaccctg	Protospacer
***********  *********** *.*.*

485. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 5, identity: 0.833

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
gccccgccgccgcccgccgtgctgacgctg	Protospacer
***********.******* **** * *.*

486. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.848

ggcgcgc-ccgagcccgccgcgccggacccgccg	CRISPR spacer
-gcgcccgccgcgcccgccgcgccggacacgcca	Protospacer
 **** * *** **************** ****.

487. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NZ_AP022611 (Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574) position: , mismatch: 5, identity: 0.815

ccacggcgccgctggcggtgtcccggc	CRISPR spacer
tggcggcgccgctggcggtgaccgggc	Protospacer
. .***************** ** ***

488. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to KM389325 (UNVERIFIED: Pseudomonas phage F_ET2439sp/ET602 clone ctg7180000000169 genomic sequence) position: , mismatch: 5, identity: 0.815

ccacggcgccgctggcggtgtcccggc	CRISPR spacer
cctcggcgccgctggcggtgtctggat	Protospacer
** *******************. *..

489. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 5, identity: 0.815

ccacggcgccgctggcggtgtcccggc	CRISPR spacer
tcctggccccgctggcggtgacccggc	Protospacer
.* .*** ************ ******

490. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NZ_CP006368 (Aureimonas sp. AU20 plasmid pAU20a, complete sequence) position: , mismatch: 5, identity: 0.815

ccacggcgccgctggcggtgtcccggc	CRISPR spacer
tcacggcgccgctggcggggtcgatgc	Protospacer
.***************** ***   **

491. spacer 10.13|3359374|27|NZ_CP022577|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 5, identity: 0.815

gaacggcgccttactcttcggcttcgg	CRISPR spacer
cttcggcgccttgctcgtcggcttcgg	Protospacer
   *********.*** **********

492. spacer 10.13|3359374|27|NZ_CP022577|CRT matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 5, identity: 0.815

gaacggcgccttactcttcggcttcgg	CRISPR spacer
catcggcggctttctcttcggcttcgt	Protospacer
 * ***** *** *************

493. spacer 10.15|3359479|27|NZ_CP022577|CRT matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 5, identity: 0.815

gaacggcggcttgctcttcggctccgc	CRISPR spacer
catcggcggctttctcttcggcttcgt	Protospacer
 * ********* **********.**.

494. spacer 10.18|3359617|28|NZ_CP022577|CRT matches to NZ_CP011276 (Planctomyces sp. SH-PL62 plasmid pPL62-3, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
gcgccggcgggttcggcgccggtaacgc	Protospacer
 .***********.********** **

495. spacer 10.18|3359617|28|NZ_CP022577|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
ttgccggcgggtttggggccgggcgggg	Protospacer
**************** *****    **

496. spacer 10.18|3359617|28|NZ_CP022577|CRT matches to CP048434 (Collinsella aerofaciens ATCC 25986 strain JCM 10188 plasmid putative_pCaero1, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
tgtgcggcggatttcgcgccggtaccgg	Protospacer
*   ******.*** *************

497. spacer 10.18|3359617|28|NZ_CP022577|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
ttgccggcgggtttggggccgggcgggg	Protospacer
**************** *****    **

498. spacer 10.18|3359617|28|NZ_CP022577|CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
ttgccggccgggttggcgccggtgacgt	Protospacer
******** ** ***********. **

499. spacer 10.18|3359617|28|NZ_CP022577|CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
ttgccggccgggttggcgccggtgacgt	Protospacer
******** ** ***********. **

500. spacer 10.18|3359617|28|NZ_CP022577|CRT matches to NZ_CP043499 (Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
ttgccggccgggttggcgccggtgacgt	Protospacer
******** ** ***********. **

501. spacer 10.18|3359617|28|NZ_CP022577|CRT matches to JN698994 (Mycobacterium phage DS6A, complete genome) position: , mismatch: 5, identity: 0.821

ttgccggcgggtttggcgccggtaccgg	CRISPR spacer
ctgccggcgggttaggcgccggcgcagg	Protospacer
.************ ********..* **

502. spacer 12.1|4153631|29|NZ_CP022577|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.828

ccggtggctgcccctccgtcggcgccatc	CRISPR spacer
ccggtgggtgctcctccgtcggcgcacac	Protospacer
******* ***.*************   *

503. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 5, identity: 0.828

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gtgccgccgatgttgccgttgctgccggt	Protospacer
********* **.***********  * *

504. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.828

----gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
atcggtg----cggtgctgccgttgctgaagct	Protospacer
    ***    ** *******************

505. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.828

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gtgccgccgttgccgccgttgccgccgtt	Protospacer
*************.********.*  *.*

506. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP022195 (Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.828

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gcggcgccgttgctggcgatgctgaagcc	Protospacer
*.* *********** ** *********.

507. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.828

gtgc-cgccgttgctgccgttgctgaagct	CRISPR spacer
-tacgcgcggttgctgccgtcgctgaagtt	Protospacer
 *.* *** ***********.*******.*

508. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 5, identity: 0.828

gtgc-cgccgttgctgccgttgctgaagct	CRISPR spacer
-tacgcgcggttgctgccgtcgctgaagtt	Protospacer
 *.* *** ***********.*******.*

509. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
atgccggagccgttgatgccgccgcc	Protospacer
..*************.******** .

510. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
atgccggagccgttgatgccgccgcc	Protospacer
..*************.******** .

511. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
ccgccggagccgttgttgccgcgtat	Protospacer
 ************** ******  .*

512. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
ccgccggagccgttgttgccgcgtat	Protospacer
 ************** ******  .*

513. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgccgcagccggtggtgccgcctcc	Protospacer
****** ***** **********  .

514. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
gcgccgcagccggtggtgccgcctcc	Protospacer
****** ***** **********  .

515. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to NZ_CP045120 (Rubrobacter sp. SCSIO 52909 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
ccgccggagccgttcttgccgccgcc	Protospacer
 *************  ******** .

516. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to MT855965 (Microcystis phage vB_MaeS-yong1, complete genome) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
ccgcccgagccgttgctgccgccgcg	Protospacer
 **** ********* ********

517. spacer 12.7|4154120|26|NZ_CP022577|CRT matches to MN585977 (Mycobacterium phage Atcoo, complete genome) position: , mismatch: 5, identity: 0.808

gcgccggagccgttggtgccgccggt	CRISPR spacer
ccgccggtgccgctggtgccgccgcg	Protospacer
 ****** ****.***********

518. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agacggtcgtcgccggccccgccggt	Protospacer
. . .*********************

519. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgga	Protospacer
.  * ********************

520. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtt	Protospacer
.  * ******************* *

521. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggcaccgccggt	Protospacer
.  * ************ ********

522. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aagatgtcgttgccggccccgccggt	Protospacer
. *. *****.***************

523. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgga	Protospacer
.  * ********************

524. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aagacgtcgttgccggccccgccggt	Protospacer
. *. *****.***************

525. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtt	Protospacer
.  * ******************* *

526. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aggctgtcgtcgccggccccgccggc	Protospacer
. *  ********************.

527. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tagctgtcgtcgccggccccgccgat	Protospacer
  *  *******************.*

528. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agacggtcgtcgccggccccgccggt	Protospacer
. . .*********************

529. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agacggtcgtcgccggccccgccggt	Protospacer
. . .*********************

530. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgga	Protospacer
.  * ********************

531. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggcaccgccggt	Protospacer
.  * ************ ********

532. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtt	Protospacer
.  * ******************* *

533. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aagatgtcgttgccggccccgccggt	Protospacer
. *. *****.***************

534. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggcaccgccggt	Protospacer
.  * ************ ********

535. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtt	Protospacer
.  * ******************* *

536. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgga	Protospacer
.  * ********************

537. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcaccggccccgccggt	Protospacer
.  * ******.**************

538. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtt	Protospacer
.  * ******************* *

539. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tcggagtcgtcaccggcgccgccgcg	Protospacer
 **********.***** ******

540. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
ccggagtcgtcgccgccctcgccgcg	Protospacer
 ************** **.*****

541. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032676 (Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
gcactctcgtcgccggccccgccggg	Protospacer
**.   *******************

542. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tcggagtcgtcaccggcgccgccgcg	Protospacer
 **********.***** ******

543. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tcggagtcgtcaccggcgccgccgcg	Protospacer
 **********.***** ******

544. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tcggagtcgtcaccggcgccgccgcg	Protospacer
 **********.***** ******

545. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP014802 (Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agggagtcgtcgccgtcctcgccgga	Protospacer
. ************* **.******

546. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP039640 (Azospirillum sp. TSH100 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
atcgtgtcgtcgccgcccccgccggt	Protospacer
.. * ********** **********

547. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP041042 (Paracoccus sp. AK26 plasmid pAK4, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agggtgtcgtcgcctgccccgccgga	Protospacer
. ** ********* **********

548. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NC_019959 (Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
caggtgtcgccgccggccccgccggg	Protospacer
  ** ****.***************

549. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_MN366361 (Bacterium plasmid pALTS33, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
acggagccgtcgccggcctcgccgcc	Protospacer
.*****.***********.***** .

550. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032350 (Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence) position: , mismatch: 5, identity: 0.808

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgttgccggccccgccggt	Protospacer
.  * *****.***************

551. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP022569 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence) position: , mismatch: 5, identity: 0.844

ttgccggggtcgccggcgccggtgcctgcgtt-	CRISPR spacer
cggccggggtcgccgtcgccggtgctt-cgttc	Protospacer
. ************* *********.* ****

552. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.844

ttgccggggtcgccggcgccggt--gcctgcgtt	CRISPR spacer
ttgccggggtcgccggctgcggtgggcttgcg--	Protospacer
*****************  ****  **.****

553. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 5, identity: 0.844

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gcctccgccggtgccgccgtcgccgccgcagc	Protospacer
*.*.************************   *

554. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 5, identity: 0.844

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtccccgcccgtgccgccgccgccgccgatcg	Protospacer
********* *********.********..*

555. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 5, identity: 0.844

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccgccgccggtgccgccgtggccgccggtgc	Protospacer
*.* **************** ********. *

556. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.844

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtatccgccggtcccgccggcgccgccggcac	Protospacer
** .******** ****** ********** *

557. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 5, identity: 0.844

gtccccgccggtgccgccgtcgccg--ccggccc	CRISPR spacer
gtcccggccggtgccgccgtccccgtttcggc--	Protospacer
***** *************** ***  .****

558. spacer 14.6|4175176|28|NZ_CP022577|CRT matches to NC_034248 (Rhizobium phage RHEph10, complete genome) position: , mismatch: 5, identity: 0.821

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
ggaacggtaatggtggtgccctggacga	Protospacer
** *****.************** .**

559. spacer 15.1|4303660|27|NZ_CP022577|CRT matches to MN583270 (Pseudomonas aeruginosa strain NK546 plasmid pNK546b, complete sequence) position: , mismatch: 5, identity: 0.815

cttagcaagccgccattcccgccgttg	CRISPR spacer
ccatgcaggccgccattcccgccggtg	Protospacer
*.  ***.**************** **

560. spacer 15.1|4303660|27|NZ_CP022577|CRT matches to NZ_MN433457 (Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence) position: , mismatch: 5, identity: 0.815

cttagcaagccgccattcccgccgttg	CRISPR spacer
ccatgcaggccgccattcccgccggtg	Protospacer
*.  ***.**************** **

561. spacer 15.1|4303660|27|NZ_CP022577|CRT matches to MF344569 (Pseudomonas aeruginosa plasmid p12939-PER, complete sequence) position: , mismatch: 5, identity: 0.815

cttagcaagccgccattcccgccgttg	CRISPR spacer
ccatgcaggccgccattcccgccggtg	Protospacer
*.  ***.**************** **

562. spacer 15.6|4303954|27|NZ_CP022577|CRT matches to NZ_CP030128 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

acgccaccggtttggtttccgccggcg	CRISPR spacer
catccaccgatttggcttccgccggcg	Protospacer
   ******.*****.***********

563. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP041156 (Leisingera aquaemixtae strain R2C4 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.792

ccggcgccgatcagcccggcgttt	CRISPR spacer
gcggcgccgatcagcccggctgcg	Protospacer
 *******************  .

564. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP016620 (Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.792

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggatggc	Protospacer
*******************    .

565. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.792

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggatggc	Protospacer
*******************    .

566. spacer 15.7|4304002|24|NZ_CP022577|CRT matches to NZ_CP016619 (Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.792

ccggcgccgatcagcccggcgttt	CRISPR spacer
ccggcgccgatcagcccggatggc	Protospacer
*******************    .

567. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to NC_005241 (Cupriavidus necator H16 megaplasmid pHG1, complete sequence) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgccgccgtacagccacccggcctgt	Protospacer
****.****** ************  .

568. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to NZ_CP039289 (Cupriavidus necator H16 plasmid pHG1, complete sequence) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgccgccgtacagccacccggcctgt	Protospacer
****.****** ************  .

569. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MK359320 (Mycobacterium phage Cookies, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

570. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to KX611831 (Mycobacterium phage Pharsalus, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

571. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to NC_041844 (Mycobacterium phage Optimus, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

572. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MK967379 (Mycobacterium phage HokkenD, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

573. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MH230878 (Mycobacterium phage Oogway, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

574. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MN585999 (Mycobacterium phage Briton15, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

575. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MG962370 (Mycobacterium phage Kykar, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

576. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MH576975 (Mycobacterium phage Target, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

577. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MK359331 (Mycobacterium phage Rajelicia, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

578. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MH744414 (Mycobacterium phage Arcanine, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

579. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to KF493880 (Mycobacterium phage HanShotFirst, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

580. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to JF937103 (Mycobacterium virus Museum, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

581. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MH576971 (Mycobacterium phage Arlo, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

582. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MH697575 (Mycobacterium phage Adahisdi, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

583. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to KJ409696 (Mycobacterium phage Lamina13, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

584. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to NC_028784 (Mycobacterium phage Tasp14, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

585. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to KT259047 (Mycobacterium phage Rufus, complete genome) position: , mismatch: 5, identity: 0.815

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatcgag	Protospacer
****************** **..**

586. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgccgccgccatcgccgaccagaccg	Protospacer
*** *******************..

587. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgtcgccgccaccgccgaccaggccg	Protospacer
*** ********.***********.

588. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP024424 (Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cccgcgccgccatcgccgcccaggccg	Protospacer
** *************** *****.

589. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP020440 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cccgcgccgccatcgccgcccaggccg	Protospacer
** *************** *****.

590. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgttatcgccgaccaggccg	Protospacer
*********..*************.

591. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccattgccgtccaggtcg	Protospacer
.************.**** ******

592. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccgtcgccgaccaccagc	Protospacer
***********.**********   .*

593. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccgtcgccgaccaccagc	Protospacer
***********.**********   .*

594. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP044082 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cccgcgccgccatcgccgcccaggccg	Protospacer
** *************** *****.

595. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP031080 (Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cccgcgccgccatcgccgcccaggccg	Protospacer
** *************** *****.

596. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccaccgccgatcaggcga	Protospacer
************.******.****..

597. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cgggcgccgccatcgccgtccagctcg	Protospacer
* **************** **** *

598. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP042276 (Agrobacterium tumefaciens strain 186 plasmid pAt, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cgatcgccgccatcgtcgaccagggac	Protospacer
* . ***********.******** **

599. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_LR134461 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccctcgccgacaaggatc	Protospacer
.********** ******** ***  *

600. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_007491 (Rhodococcus erythropolis PR4 plasmid pREL1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

601. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP029339 (Streptomyces sp. SM17 plasmid pSM17A, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcctcgccgccatcgccgagcagctac	Protospacer
.*  *************** *** ***

602. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggtgccggcatcgccgaccagggtc	Protospacer
.***.**** **************  *

603. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggtgccggcatcgccgaccagggtc	Protospacer
.***.**** **************  *

604. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP011297 (Rhodococcus erythropolis strain BG43 plasmid pRLLBG43, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

605. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgacc-aggtac	CRISPR spacer
ccggcgccgccatcgacgaccttagca-	Protospacer
*************** *****  .*.*

606. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP017304 (Rhodococcus sp. YL-1 plasmid pYLL2 sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

607. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_005073 (Rhodococcus erythropolis linear plasmid pBD2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

608. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP016820 (Rhodococcus sp. p52 plasmid pDF02, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgacgacatcgccgaccagatca	Protospacer
****** ** *************.*

609. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP042915 (Rhodococcus qingshengii strain RL1 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

610. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP042915 (Rhodococcus qingshengii strain RL1 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

611. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP042915 (Rhodococcus qingshengii strain RL1 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

612. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_010311 (Streptomyces sp. HK1 plasmid pSHK1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcctcgccgccatcgccgagcagctac	Protospacer
.*  *************** *** ***

613. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP015203 (Rhodococcus sp. 008 plasmid pR8L1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

614. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccggcattgccgaccagcagc	Protospacer
********* ***.*********  .*

615. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to CP000385 (Mycobacterium sp. MCS Plasmid1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccattggcgaccagcccc	Protospacer
*************.* ******* . *

616. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

617. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

618. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccgccgccgaccaggccc	Protospacer
.**********..***********. *

619. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac---	CRISPR spacer
acggcgccgccatcgccgac---gtcctca	Protospacer
 *******************   ** *

620. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP046100 (Rhodococcus sp. AQ5-07 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

621. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccgccgccgaccaggccc	Protospacer
.**********..***********. *

622. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccgccgccgaccaggccc	Protospacer
.**********..***********. *

623. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP014942 (Rhodococcus sp. BH4 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

624. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP014942 (Rhodococcus sp. BH4 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

625. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP017300 (Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

626. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP017303 (Rhodococcus sp. YL-1 plasmid pYLL1 sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

627. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccggcgccgaccagcagc	Protospacer
***********. **********  .*

628. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cccgcgccgccatcgccgacgagctga	Protospacer
** ***************** ** *.

629. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP050125 (Rhodococcus erythropolis strain KB1 plasmid plas1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

630. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_008704 (Mycobacterium sp. KMS plasmid pMKMS02, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccattggcgaccagcccc	Protospacer
*************.* ******* . *

631. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP026489 (Streptomyces sp. 604F plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcctcgccgccatcgccgagcagctac	Protospacer
.*  *************** *** ***

632. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP022566 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccagcgcctaccaggccc	Protospacer
.*********** **** ******. *

633. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP045549 (Streptomyces sp. SYP-A7193 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
agggcgccgccctcgccgaccacgtgc	Protospacer
  ********* ********** **.*

634. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP034156 (Rhodococcus sp. NJ-530 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

635. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP034156 (Rhodococcus sp. NJ-530 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgtcgacaagatca	Protospacer
***************.**** **.*

636. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP032357 (Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
acgtcgccgccatcgccgcccaggcgc	Protospacer
 ** ************** *****..*

637. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to MN234199 (Mycobacterium phage Ekdilam, complete genome) position: , mismatch: 6, identity: 0.778

gtcggcggactcgcggccgacgccggt	CRISPR spacer
ctcggcggcctggcggccgacgccccg	Protospacer
 ******* ** ************

638. spacer 3.6|1644362|27|NZ_CP022577|CRT matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 6, identity: 0.778

gtcggcggactcgcggccgacgccggt	CRISPR spacer
cgcggcgaactcgcggccggcgccgtc	Protospacer
  *****.***********.***** .

639. spacer 3.7|1644407|30|NZ_CP022577|CRT matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 6, identity: 0.8

gacggcgggttgttcttcggcgtgggcggt	CRISPR spacer
gtgagcgggttgttcctcggcgtggggggc	Protospacer
*  .***********.********** **.

640. spacer 3.7|1644407|30|NZ_CP022577|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gacggcgggttgttcttcggcgtgggcggt	CRISPR spacer
gccggcgggttgttctgcggcgttggtgca	Protospacer
* ************** ****** **.*

641. spacer 3.7|1644407|30|NZ_CP022577|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gacggcgggttgttcttcggcgtgggcggt	CRISPR spacer
gccggcgggttgttctgcggcgttggtgca	Protospacer
* ************** ****** **.*

642. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
ctcgacgaagccgaacagcaggccggcgat	Protospacer
 .** **.******************** .

643. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
ttcgacgaagccgaacagcaggccggcgat	Protospacer
 .** **.******************** .

644. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gccgccggtgccgagcagcaggccgatcgc	Protospacer
******** *****.**********..  *

645. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
caggccgaaggcgaacagcaggccggcgcc	Protospacer
   ****.** *****************.*

646. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gccgccggtgccgagcagcaggccgatcgc	Protospacer
******** *****.**********..  *

647. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
caggccgaaggcgaacagcaggccggcgcc	Protospacer
   ****.** *****************.*

648. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
cgggtcgaggccgaacagcaggccggcgtc	Protospacer
   *.**..*********************

649. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
caggccgaaggcgaacagcaggccggcgcc	Protospacer
   ****.** *****************.*

650. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
caggccgaaggcgaacagcaggccggcgcc	Protospacer
   ****.** *****************.*

651. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
caggccgaaggcgaacagcaggccggcgcc	Protospacer
   ****.** *****************.*

652. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gccgccggtgccgagcagcaggccgatcgc	Protospacer
******** *****.**********..  *

653. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gccgccggagtcgaacatcaggcccacgga	Protospacer
**********.****** ****** .**

654. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP034473 (Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_4, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
ttcaccgaagccggacagcaggccggcggc	Protospacer
 .*.***.*****.************** *

655. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP034478 (Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_4, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
ttcaccgaagccggacagcaggccggcggc	Protospacer
 .*.***.*****.************** *

656. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP017592 (Pantoea stewartii subsp. stewartii DC283 plasmid ppDSJ01, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcag--gccggcgtc	CRISPR spacer
gccgccgcagccgaacagcagaagctggaa--	Protospacer
******* *************  **.** .

657. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP015989 (Sphingobium sp. EP60837 plasmid pEP2, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gaggcccgcgccgaacagcaggccggaggc	Protospacer
*  *** * ***************** * *

658. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.8

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgacgctgccgaacaccagccggccc	Protospacer
****** ************ *****   *

659. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 6, identity: 0.8

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgacgctgccgaacaccagccggccc	Protospacer
****** ************ *****   *

660. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 6, identity: 0.8

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
acgccggcgctgccgatcagcagcacgacg	Protospacer
.***** ********* ******* * .**

661. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 6, identity: 0.8

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
acgccgccggcgccgaacagcagccccagg	Protospacer
.******** .***************.. *

662. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 6, identity: 0.8

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgacgctgccgaacaccagccggccc	Protospacer
****** ************ *****   *

663. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to MH424444 (Salmonella virus VSiP, complete genome) position: , mismatch: 6, identity: 0.8

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgccgccgaacagcagggtgccg	Protospacer
**********.************  .  **

664. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP016082 (Streptomyces sp. SAT1 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgccgccgaccagcagcacctgg	Protospacer
**********.***** ******* *.  *

665. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to MT012729 (Salmonella phage vB_SenTO17, complete genome) position: , mismatch: 6, identity: 0.8

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgccgcagaacagcagggcgccg	Protospacer
**********.** *********  *  **

666. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to AP017924 (Ralstonia phage RP12 DNA, complete genome) position: , mismatch: 6, identity: 0.8

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccaccgctgtcgaacagcagttcggcc	Protospacer
*****.******.**********..* **

667. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 6, identity: 0.8

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
aggacgcccggcccggcgcgctttccggcg	Protospacer
. * ************** ** *******.

668. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_011887 (Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence) position: , mismatch: 6, identity: 0.8

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgccgcccgtcccggcgagcagcagggcg	Protospacer
********** *********** .  ***.

669. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

gcgccgcccggcccggcgagcattccggca--	CRISPR spacer
ccgccgcccgggccggcgagca--gcagcatc	Protospacer
 ********** **********   *.***

670. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 6, identity: 0.8

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
tctctgcccggcccggcaggcattccggaa	Protospacer
 * *.************..********* *

671. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 6, identity: 0.8

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgccggccggcccggcgagccgcacgcca	Protospacer
****** **************  . ** **

672. spacer 5.12|2855412|30|NZ_CP022577|CRT matches to MN862068 (Brevundimonas phage vB_BsubS-Delta, complete genome) position: , mismatch: 6, identity: 0.8

gtgccgccgagtacggtgctggct-ccgccg	CRISPR spacer
gtgccgccgaggacggtgctgatcagcgcc-	Protospacer
*********** *********...  ****

673. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NZ_CP047175 (Rathayibacter sp. VKM Ac-2760 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
ccgccgccgccccccgccgagcagccggcg	Protospacer
 * ******** ********** ***  **

674. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP014769 (Hymenobacter sp. PAMC 26554 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.818

ggcgcgcccgagcccgccgcgccggacccgccg--	CRISPR spacer
ggcgcgcccggccccgccgcgccg--cctgctgct	Protospacer
**********. ************  **.**.*

675. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to GQ141189 (Bifidobacterium phage Bbif-1, complete sequence) position: , mismatch: 6, identity: 0.806

gggtcca----acggttcggcttgccgttcgcgct	CRISPR spacer
----ccagcgcatggttcggctggccgttcgcgct	Protospacer
    ***    *.********* ************

676. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaaaatgccgtcgatgccggcaacgccgag	Protospacer
**.* .*****.************.****

677. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaaaatgccgtcgatgccggcaacgccgag	Protospacer
**.* .*****.************.****

678. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 6, identity: 0.778

ccacggcgccgctggcggtgtcccggc	CRISPR spacer
ggacggcgccgcgggcggtgtccaccc	Protospacer
  ********** **********   *

679. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NZ_AP022334 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence) position: , mismatch: 6, identity: 0.778

ccacggcgccgctggcggtgtcccggc	CRISPR spacer
gcctcacgccgctggcggtgttccggc	Protospacer
 * . .***************.*****

680. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NC_021279 (Mycobacteroides abscessus subsp. bolletii 50594 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.778

ccacggcgccgctggcggtgtcccggc	CRISPR spacer
tgccggtgccgctggcggtgtgccgga	Protospacer
.  ***.************** ****

681. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NZ_CP024582 (Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

ccacggcgccgctggcggtgtcccggc	CRISPR spacer
gcacggcgccgctggcggagtcatagg	Protospacer
 ***************** *** ..*

682. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NC_019847 (Sinorhizobium meliloti GR4 plasmid pRmeGR4b, complete sequence) position: , mismatch: 6, identity: 0.778

ccacggcgccgctggcggtgtcccggc	CRISPR spacer
gtccggcgccgcaggcggtgtccaggg	Protospacer
 . ********* ********** **

683. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NZ_AP022622 (Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1) position: , mismatch: 6, identity: 0.778

ccacggcgccgctggcggtgtcccggc	CRISPR spacer
tgccggtgccgctggcggtgtgccgga	Protospacer
.  ***.************** ****

684. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NZ_AP022622 (Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1) position: , mismatch: 6, identity: 0.778

ccacggcgccgctggcggtgtcccggc	CRISPR spacer
tgccggtgccgctggcggtgtgccgga	Protospacer
.  ***.************** ****

685. spacer 10.6|3358999|27|NZ_CP022577|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 6, identity: 0.778

ccacggcgccgctggcggtgtcccggc	CRISPR spacer
ggacggcgccgcgggcggtgtccaccc	Protospacer
  ********** **********   *

686. spacer 12.1|4153631|29|NZ_CP022577|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 6, identity: 0.793

ccggtggctgcccctccgtcggcgccatc	CRISPR spacer
ccggtggtcgcccctccgtcggcgacgat	Protospacer
*******..*************** *. .

687. spacer 12.1|4153631|29|NZ_CP022577|CRT matches to MK305891 (Streptomyces phage Gibson, complete genome) position: , mismatch: 6, identity: 0.793

ccggtggctgcccctccgtcggcgccatc	CRISPR spacer
gcggcggctgccactccgtcggcgtagtc	Protospacer
 ***.******* ***********. .**

688. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
tcgccgccgttgatgccgttgttgaagac	Protospacer
 .********** ********.***** .

689. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct---	CRISPR spacer
gtgccgccgatgctgccgt---tggcgctcag	Protospacer
********* *********   **. ***

690. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP014799 (Salipiger profundus strain JLT2016 plasmid pTPRO3, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
tcgccgccgttgcggccgttgctgaggaa	Protospacer
 .*********** ***********.*

691. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgttgctgccgttgctgaaagc	Protospacer
*  ****.******************. .

692. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to KC736071 (Mycobacterium phage WIVsmall, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggactc	Protospacer
 ************.**********.* ..

693. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgccgccgtt	Protospacer
 ************.********.*  *.*

694. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_012852 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132504, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gatccgctgctgctgccgttgctgaaggc	Protospacer
*  ****.*.***************** .

695. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP048283 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gatccgctgctgctgccgttgctgaaggc	Protospacer
*  ****.*.***************** .

696. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP014600 (Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgtttctgccgtcgctgatccg	Protospacer
 ********** *******.*****  *

697. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_031109 (Gordonia phage Jumbo, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gtgccgccggtgctgccggtgctgcgggc	Protospacer
********* ******** ***** .* .

698. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK814754 (Mycobacterium phage Sumter, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

699. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK814754 (Mycobacterium phage Sumter, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

700. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MN369739 (Mycobacterium phage Kenuha5, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

701. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK494110 (Mycobacterium phage SwagPigglett, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

702. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH479919 (Mycobacterium phage Moose, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

703. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to KY012363 (Mycobacterium phage Empress, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

704. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK967397 (Mycobacterium phage Mahavrat, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

705. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH669010 (Mycobacterium phage PHappiness, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

706. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH669003 (Mycobacterium phage Girr, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

707. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MG925342 (Mycobacterium phage Forsytheast, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

708. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK359354 (Mycobacterium phage PinkPlastic, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

709. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH632118 (Mycobacterium phage Zeeculate, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

710. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MG872836 (Mycobacterium phage Fajezeel, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

711. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MN585999 (Mycobacterium phage Briton15, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

712. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MG872841 (Mycobacterium phage Priscilla, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

713. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH155865 (Mycobacterium phage BobaPhett, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

714. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MN585985 (Mycobacterium phage Watermelon, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

715. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to KY348865 (Mycobacterium phage Bubbles123, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

716. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MN428047 (Mycobacterium phage Doomphist, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

717. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH651169 (Mycobacterium phage Burwell21, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

718. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MG925344 (Mycobacterium phage Ichabod, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

719. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK359315 (Mycobacterium phage MisterCuddles, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

720. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH697581 (Mycobacterium phage Crispicous1, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

721. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK359299 (Mycobacterium phage Petp2012, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

722. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH371120 (Mycobacterium phage OlympiaSaint, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

723. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MF190168 (Mycobacterium phage Spoonbill, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

724. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MG925340 (Mycobacterium phage Corvo, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

725. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MT771340 (Mycobacterium phage Jorgensen, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

726. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MN735433 (Mycobacterium phage Scottish, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

727. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MG920060 (Mycobacterium phage Bob3, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

728. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH338239 (Mycobacterium phage Mryolo, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

729. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH651183 (Mycobacterium phage Nivrat, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

730. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_021297 (Mycobacterium phage PattyP, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

731. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to KY224001 (Mycobacterium phage Blue, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

732. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MF919508 (Mycobacterium phage ILeeKay, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

733. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to AY500152 (Mycobacteriophage U2, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

734. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MG770213 (Mycobacterium phage OldBen, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

735. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK967387 (Mycobacterium phage Big3, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

736. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH651188 (Mycobacterium phage Ruby, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

737. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_041989 (Mycobacterium phage Shauna1, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

738. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to JN020140 (Mycobacterium virus MrGordo, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

739. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH834617 (Mycobacterium phage Lizziana, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

740. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to EU744251 (Mycobacterium phage Jasper, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

741. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK524499 (Mycobacterium phage Tripl3t, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

742. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK820638 (Mycobacterium phage HermioneGrange, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

743. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_041988 (Mycobacterium phage ShiLan, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

744. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to KX522649 (Mycobacterium phage Bircsak, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

745. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK524517 (Mycobacterium phage James, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

746. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK305886 (Mycobacterium phage Poenanya, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

747. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to JN859129 (Mycobacterium virus DotProduct, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

748. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MG962372 (Mycobacterium phage McGuire, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

749. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK305893 (Mycobacterium phage Beatrix, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

750. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK016494 (Mycobacterium phage Filuzino, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

751. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to KM066034 (Mycobacterium phage Inventum, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

752. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MN586011 (Mycobacterium phage LilMoolah, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

753. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to KT438500 (Mycobacterium phage Pari, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

754. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH338238 (Mycobacterium phage Michley, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

755. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH399784 (Mycobacterium phage NormanBulbieJr, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

756. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MT310893 (Mycobacterium phage DRBy19, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

757. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH399771 (Mycobacterium phage ByChance, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

758. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to KX522943 (Mycobacterium phage Gompeii16, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

759. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to KY702574 (Mycobacterium phage Kingsley, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

760. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH450133 (Mycobacterium phage SwissCheese, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

761. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_009877 (Mycobacterium phage U2, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

762. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to KJ025956 (Mycobacterium phage Saal, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

763. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MN813700 (Mycobacterium phage Atkinbua, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

764. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_024136 (Mycobacterium phage Seabiscuit, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

765. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MN369751 (Mycobacterium phage TDanisky, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

766. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MT639644 (Mycobacterium phage MaryBeth, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

767. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MT639654 (Mycobacterium phage Jerm2, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

768. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH590602 (Mycobacterium phage Gorge, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

769. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to JF937108 (Mycobacterium phage Switzer, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

770. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to JN660814 (Mycobacterium phage Dreamboat, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

771. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_011054 (Mycobacterium phage Boomer, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggt	Protospacer
 ************.********.*  * *

772. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH669011 (Mycobacterium phage PherrisBueller, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

773. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_023687 (Mycobacterium phage Bruns, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

774. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK310141 (Mycobacterium phage Fenn, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

775. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to JF937103 (Mycobacterium virus Museum, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

776. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH669005 (Mycobacterium phage JoeyJr, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

777. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_028654 (Mycobacterium phage Sparkdehlily, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

778. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK524523 (Mycobacterium phage Naira, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

779. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH450113 (Mycobacterium phage BigMau, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

780. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MN444869 (Mycobacterium phage DreamCatcher, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

781. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_023695 (Mycobacterium phage Violet, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

782. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MG812495 (Mycobacterium phage Pippin, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

783. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_023726 (Mycobacterium phage Euphoria, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

784. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MG812489 (Mycobacterium phage Greg, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

785. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MT310897 (Mycobacterium phage Manatee, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

786. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH155871 (Mycobacterium phage Mattes, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

787. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MN204502 (Mycobacterium phage KingMidas, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

788. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_022068 (Mycobacteriophage Daenerys, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

789. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK310142 (Mycobacterium phage MetalQZJ, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

790. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to KT895281 (Mycobacterium phage Cabrinians, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

791. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_031041 (Mycobacterium phage Papez, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

792. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH513971 (Mycobacterium phage Hope4ever, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgccgctgaagct	Protospacer
 ** . ************..*********

793. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH450130 (Mycobacterium phage Rohr, complete genome) position: , mismatch: 6, identity: 0.793

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctggttccgttgctgccgctgctgatgct	Protospacer
 ** . ************.****** ***

794. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgta	Protospacer
.  * *******************

795. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtc	Protospacer
.  * ******************* .

796. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtc	Protospacer
.  * ******************* .

797. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtc	Protospacer
.  * ******************* .

798. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgta	Protospacer
.  * *******************

799. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgta	Protospacer
.  * *******************

800. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgta	Protospacer
.  * *******************

801. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agacgatcgtcgccggccccgccggt	Protospacer
. . ..********************

802. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcgtgtcgtcgccggccccgccgtc	Protospacer
.  * ******************* .

803. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aggatgtcgtcgccggccccgccgaa	Protospacer
. *. *******************.

804. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP045303 (Azotobacter salinestris strain KACC 13899 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agatagtcgtcgccagccccgccggc	Protospacer
. . **********.**********.

805. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
cgatcgtcgtcgccggccgcgccggt	Protospacer
  .  ************* *******

806. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tgatcgtcggcgccggccccgccggt	Protospacer
  .  **** ****************

807. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP021127 (Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tggcgatcgtcgccggccccgccggc	Protospacer
  * ..*******************.

808. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
tggcgatcgtcgccggccccgccggc	Protospacer
  * ..*******************.

809. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP014598 (Yangia sp. CCB-MM3 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.769

gcggagtcgtcgccggccccgccggt	CRISPR spacer
atggagtcgtcgcccgccccgccatc	Protospacer
..************ ********. .

810. spacer 12.12|4154507|29|NZ_CP022577|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 6, identity: 0.793

ttgaagttggccccgccgctaccgccggc	CRISPR spacer
agccagttgggcccgccgataccgccggc	Protospacer
    ****** ******* **********

811. spacer 12.12|4154507|29|NZ_CP022577|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.793

ttgaagttggccccgccgctaccgccggc	CRISPR spacer
agccagttgggcccgccgataccgccggc	Protospacer
    ****** ******* **********

812. spacer 12.12|4154507|29|NZ_CP022577|CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 6, identity: 0.793

ttgaagttggccccgccgctaccgccggc	CRISPR spacer
ctgttgtcggccccgccgctgccgccggg	Protospacer
.**  **.************.*******

813. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to AP017627 (Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome) position: , mismatch: 6, identity: 0.812

ttgccgg--ggtcgccggcgccggtgcctgcgtt	CRISPR spacer
--gccggctggtcgccgccgccggcgcctgcgcc	Protospacer
  *****  ******** ******.*******..

814. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gatgccgcccgcattgccgttgccggcgacag	Protospacer
. ******* *******************

815. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
atggccgccggcattgccgttgccgtcgtcaa	Protospacer
** ********************** **

816. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccgccattgccgttgccgccgccat	Protospacer
********** ************** **   .

817. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP018466 (Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.3, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccatcggcattgccgttgccggcggctc	Protospacer
.*****..********************. .*

818. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccggcattgccgtttccgttggcac	Protospacer
********************* *** .*.  *

819. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP020976 (Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pA) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccatcggcattgccgttgccggcggctc	Protospacer
.*****..********************. .*

820. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP020965 (Xanthomonas phaseoli pv. phaseoli strain CFBP412 plasmid pA, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccatcggcattgccgttgccggcggctc	Protospacer
.*****..********************. .*

821. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP018727 (Xanthomonas vesicatoria ATCC 35937 strain LMG911 plasmid pLMG911.2, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccatcggcattgccgttgccggcggctc	Protospacer
.*****..********************. .*

822. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NC_012853 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence) position: , mismatch: 6, identity: 0.812

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccggaattgctgttgccgttgcccc	Protospacer
*********** *****.******* .*  **

823. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
ctccccaccggtgccgccct---cgccggcccaga	Protospacer
 *****.*********** *   *********

824. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
ctccccaccggtgccgccct---cgccggcccaga	Protospacer
 *****.*********** *   *********

825. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
ctccccaccggtgccgccct---cgccggcccaga	Protospacer
 *****.*********** *   *********

826. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

827. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

828. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

829. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

830. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

831. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

832. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

833. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtcccgcccgtgccgccggcgccgccggtgc	Protospacer
* .****** ********* *********. *

834. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

835. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

836. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

837. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

838. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

839. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

840. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtcccgccggtgccgccgccgccgccgactg	Protospacer
* .****************.********.*.

841. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcaccgccggtgccgccggtgccgccgccgc	Protospacer
* * *************** .******* * *

842. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

843. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

844. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

845. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

846. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

847. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

848. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

849. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

850. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

851. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

852. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

853. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

854. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

855. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

856. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

857. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

858. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

859. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

860. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

861. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

862. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

863. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

864. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

865. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

866. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

867. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

868. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

869. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

870. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

871. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtaccgcccgtgccaccgtcgccgccggcac	Protospacer
* . ***** *****.************** *

872. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022571 (Mycolicibacterium poriferae strain JCM 12603 plasmid pJCM12603, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tcccgggccggtgccgcccgcgccgccggccc	Protospacer
 .**  ************  ************

873. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

874. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

875. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

876. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

877. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

878. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

879. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

880. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

881. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

882. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

883. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

884. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

885. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

886. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

887. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

888. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

889. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

890. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

891. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

892. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

893. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

894. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
ttcgccgccggtgccgccctcgccgc--gctcgg	Protospacer
 ** ************** *******  **.*

895. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_031109 (Gordonia phage Jumbo, complete genome) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcgctgccggtgccgccgccgccgccggtct	Protospacer
* * *.*************.*********.*.

896. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtggccgccggtgcggtcgtcgccgccgccgc	Protospacer
**  ********** *.*********** * *

897. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 6, identity: 0.812

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccgccgccggagccgccgccgccgccgccgc	Protospacer
*.* ******* *******.******** * *

898. spacer 14.6|4175176|28|NZ_CP022577|CRT matches to LN997844 (Streptomyces reticuli genome assembly TUE45, plasmid : III) position: , mismatch: 6, identity: 0.786

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
tcgacggtgatggtcgttccctgtgcgt	Protospacer
   *********** ** *********.

899. spacer 14.6|4175176|28|NZ_CP022577|CRT matches to DQ115854 (Cyanobacteria phage AS-1 contig_47 genomic sequence) position: , mismatch: 6, identity: 0.786

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
gcctcggtgatggtggtgcccggtggca	Protospacer
* * ***************** ***

900. spacer 14.6|4175176|28|NZ_CP022577|CRT matches to NC_009717 (Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence) position: , mismatch: 6, identity: 0.786

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
ggcaacgtgatggtggtgccctggggct	Protospacer
****  ***************** *  .

901. spacer 14.6|4175176|28|NZ_CP022577|CRT matches to NZ_CP031752 (Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence) position: , mismatch: 6, identity: 0.786

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
tgcacggtgaaggtggtgcccttcgggt	Protospacer
 ********* *********** .* *.

902. spacer 15.1|4303660|27|NZ_CP022577|CRT matches to NC_048759 (Serratia phage MTx, partial genome) position: , mismatch: 6, identity: 0.778

cttagcaagccgccattcccgccgttg	CRISPR spacer
gacagcaagccgccattctcggcgttt	Protospacer
  .***************.** ****

903. spacer 15.6|4303954|27|NZ_CP022577|CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.778

acgccaccggtttggtttccgccggcg	CRISPR spacer
ccgccagcggttcggtttccgccgcga	Protospacer
 ***** *****.***********  .

904. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MG872843 (Mycobacterium phage Sotrice96, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

905. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MT723943 (Mycobacterium phage Cactus, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

906. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MT114165 (Mycobacterium phage BadStone, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

907. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to KF493883 (Mycobacterium phage Mosby, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

908. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MF919529 (Mycobacterium phage Sassay, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

909. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MK359343 (Mycobacterium phage Pollywog, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

910. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to KU865303 (Mycobacterium phage TeardropMSU, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

911. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to KR080204 (Mycobacterium phage Mindy, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

912. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to NC_029079 (Mycobacterium phage Dusk, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

913. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to NC_022065 (Mycobacterium phage Contagion, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

914. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to KX817173 (Mycobacterium phage Tuco, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

915. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MT684595 (Mycobacterium phage Mova, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

916. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to KF188414 (Mycobacterium phage ABCat, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

917. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MF919540 (Mycobacterium phage Willez, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

918. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MN234212 (Mycobacterium phage Paphu, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

919. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MK061415 (Mycobacterium phage Rhynn, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

920. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MK524531 (Mycobacterium phage Rutherferd, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

921. spacer 15.11|4304224|27|NZ_CP022577|CRT matches to MN617845 (Mycobacterium phage BaconJack, complete genome) position: , mismatch: 6, identity: 0.778

ccgctgccgtagagccacccggccgcc	CRISPR spacer
ccgctgccgtagagccacgcgatggag	Protospacer
****************** **.. *

922. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagacgg	Protospacer
 ******** *************...

923. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_002699 (Frankia sp. CpI1 plasmid pFQ12, complete plasmid sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgccgactggaacg	Protospacer
********************..*.

924. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagccgg	Protospacer
 ******** ************* ..

925. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP015585 (Roseomonas gilardii strain U14-5 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
agcacgccgccctcgccgaccaggtag	Protospacer
   .******* **************

926. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagacgg	Protospacer
 ******** *************...

927. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcgtcgccgccatcgccgaccagacca	Protospacer
 ** *******************..

928. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagccgg	Protospacer
 ******** ************* ..

929. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagacgg	Protospacer
 ******** *************...

930. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagacga	Protospacer
 ******** *************...

931. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgacatcgccgaccagacgg	Protospacer
 ******** *************...

932. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcgtcgccgccatcgccgaccagacca	Protospacer
 ** *******************..

933. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcgtcgccgccatcgccgaccagacca	Protospacer
 ** *******************..

934. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgtcgccggcatcgccgaccagcccg	Protospacer
*** ***** ************* .

935. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgtcaccgccgaccaggcca	Protospacer
 ********.**.***********.

936. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgccggccccattt	Protospacer
******************.**  .* .

937. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP013069 (Pannonibacter phragmitetus strain 31801 plasmid p.p-1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccatcggcggccaggccg	Protospacer
.************** **.*****.

938. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_016115 (Streptomyces pratensis ATCC 33331 plasmid pSFLA02, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
acggcatcgccatcgccgaccagggcg	Protospacer
 ****..*****************

939. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccatcgccggcctggagg	Protospacer
.*****************.** ** .

940. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
aggccgccgccatcggcgaccaggtga	Protospacer
  * *********** *********.

941. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP015040 (Rhodovulum sp. P5 plasmid pRGUI01, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcatcgccgccatcgccgaccgggtcg	Protospacer
 *. *****************.***

942. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccatcgccggcctggacg	Protospacer
.*****************.** **

943. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP042268 (Pseudomonas aeruginosa strain HOU1 plasmid pHOU1-1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcatcgccgccatcgccgacgaggtct	Protospacer
 *. **************** **** .

944. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP045074 (Paracoccus kondratievae strain BJQ0001 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
atttcgccgccatcgccgatcaggcac	Protospacer
 .  ***************.****.**

945. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_022995 (Burkholderia sp. M701 plasmid pM7012 DNA, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
cccgcgccgccatcgcctaccagcagg	Protospacer
** ************** *****  .

946. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP009975 (Pseudomonas putida S12 plasmid pTTS12, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
atggcgccgccatcgtcaaccaggtgg	Protospacer
 .*************.*.*******.

947. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccacagccgaccagcagg	Protospacer
************. *********  .

948. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccatcgccggcgaggagg	Protospacer
.*****************.* *** .

949. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcggcgccgccatcgccgagcatgagg	Protospacer
.****************** ** * .

950. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgccatcgccgcccttgcct	Protospacer
****************** **  *. .

951. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
gcggcgccgccttcgccgacgaggaca	Protospacer
 ********** ******** ***

952. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP016080 (Mesorhizobium loti NZP2037 plasmid pML2037, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccggcgccgctctcgccgaccagcgcg	Protospacer
**********. ***********

953. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_022739 (Pseudomonas sp. VLB120 plasmid pSTY, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
atggcgccgccatcgtcaaccaggtgg	Protospacer
 .*************.*.*******.

954. spacer 15.18|4304716|36|NZ_CP022577|CRT matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 6, identity: 0.833

tacagc-cacccgccgttgccgccgaggccgccggcg	CRISPR spacer
-acaccgcacccgccgttgccgccgctgccgccctcg	Protospacer
 *** * ******************  ******  **

955. spacer 4.1|2765679|36|NZ_CP022577|CRT matches to KY087993 (Mycobacterium phage Hammy, complete genome) position: , mismatch: 7, identity: 0.806

cccgccgttaccgccgttgccgatcagcccggcctt	CRISPR spacer
gccgccgttaccgccggtgccgatctgccccgtgat	Protospacer
 *************** ******** **** *.  *

956. spacer 4.1|2765679|36|NZ_CP022577|CRT matches to MF140398 (Mycobacterium phage Amohnition, complete genome) position: , mismatch: 7, identity: 0.806

cccgccgttaccgccgttgccgatcagcccggcctt	CRISPR spacer
gccgccgttaccgccggtgccgatctgccccgtgat	Protospacer
 *************** ******** **** *.  *

957. spacer 4.1|2765679|36|NZ_CP022577|CRT matches to MF140406 (Mycobacterium phage DarthP, complete genome) position: , mismatch: 7, identity: 0.806

cccgccgttaccgccgttgccgatcagcccggcctt	CRISPR spacer
gccgccgttaccgccggtgccgatctgccccgtgat	Protospacer
 *************** ******** **** *.  *

958. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gccgccggcgccgaacagcagccccaggca	Protospacer
******** ************ ** . *.

959. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gccgccggagccgatcagcacgcgctcgga	Protospacer
************** ***** **   **

960. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_LT960615 (Hartmannibacter diazotrophicus strain E19T plasmid HDIAp1, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gatgccggagccgatcagcagggcggtgaa	Protospacer
* .*********** ******* ***.*

961. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
ggtgccgaagccgaacagcacgccggtctg	Protospacer
* .****.************ *****. *

962. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
atccggccgctgccgaacagcggcccggcc	Protospacer
.. * ****************.**** **

963. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to MF158037 (Salmonella phage St162, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgccgccgaacagcagggggctg	Protospacer
**********.************     .*

964. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gtgccgccgctgccgaagagcagcgtgtag	Protospacer
*.*************** ****** .   *

965. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gtgccgccgctgccgaagagcagcgtgtag	Protospacer
*.*************** ****** .   *

966. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP041164 (Leisingera aquaemixtae strain R2C4 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgccgccgagcagcagcagaacc	Protospacer
**********.*****.*******   .*

967. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP017759 (Cupriavidus necator strain NH9 plasmid pENH92, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
ccaaggcggctgccgaacagcacccctgca	Protospacer
 *.  ** ************** ******.

968. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to MF158036 (Salmonella phage St161, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgccgccgaacagcaaggcgctg	Protospacer
**********.***********.  *  .*

969. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NC_009339 (Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
tccaggtcgctgccgaccagcagcactgcg	Protospacer
 *   *.********* ******* *****

970. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP039425 (Citricoccus sp. SGAir0253 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgtcggtgccgaacagcagggcgatg	Protospacer
******.** *************  * ..*

971. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP039430 (Citricoccus sp. SGAir0453 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgtcggtgccgaacagcagggcgatg	Protospacer
******.** *************  * ..*

972. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to KC139518 (Salmonella phage FSL SP-031, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gctccgccgccgccgaacagcagggggtcg	Protospacer
** *******.************     **

973. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to KC139662 (Salmonella phage FSL SP-038 phage structural protein gene, partial cds; and head morphogenesis protein, hypothetical proteins, and coat protein genes, complete cds) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gctccgccgccgccgaacagcagggggtcg	Protospacer
** *******.************     **

974. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to KC139557 (Salmonella phage FSL SP-049 hypothetical proteins, coat protein, hypothetical protein, putative tail protein, and hypothetical proteins genes, complete cds) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gctccgccgccgccgaacagcagggggtcg	Protospacer
** *******.************     **

975. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to MN070121 (Salmonella phage Shemara, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgccgcagaacagcagggtgccg	Protospacer
**********.** *********  .  **

976. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP019603 (Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
agccaggcgctgccgaccagcagcccggcg	Protospacer
.  * * ********* ********* ***

977. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NC_023136 (Leisingera methylohalidivorans DSM 14336 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgccgccgagcagcagaagtacc	Protospacer
**********.*****.******   *.*

978. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NC_008703 (Mycobacterium sp. KMS plasmid pMKMS01, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
tccaggtcgctgccgaccagcagcactgcg	Protospacer
 *   *.********* ******* *****

979. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
ccgccgccgcggccgaccagcagctgtggt	Protospacer
 ********* ***** *******. **

980. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to MH697592 (Mycobacterium phage Rando14, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgccgccgaacagcttgcccagg	Protospacer
**********.**********   **.. *

981. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP032827 (Sphingomonas sp. YZ-8 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
tcattgtccgggccggcgagcattccagca	Protospacer
 *...*.**** **************.***

982. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
acccgccccggcccggcgagcgtaccggcc	Protospacer
.* *  ***************.* *****

983. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279887 (Mycobacterium phage Timmi, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

984. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH651175 (Mycobacterium phage Gophee, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

985. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to GQ303264 (Mycobacterium phage Puhltonio, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

986. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MG925339 (Mycobacterium phage Chunky, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

987. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to GU247134 (Mycobacterium phage Scoot17C, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

988. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KX683293 (Mycobacterium phage Daffy, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

989. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279888 (Mycobacterium phage TomBombadil, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

990. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JF957056 (Mycobacterium phage Thora, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

991. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MT316463 (Mycobacterium phage Slatt, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

992. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH651184 (Mycobacterium phage Phareon, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

993. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JN006063 (Mycobacterium phage Serendipity, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

994. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH779500 (Mycobacterium phage Crownjwl, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

995. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH230875 (Mycobacterium phage CheetO, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

996. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MG962365 (Mycobacterium phage DoesntMatter, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

997. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279882 (Mycobacterium phage Sophia, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

998. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KX670813 (Mycobacterium phage MitKao, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

999. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH576970 (Mycobacterium phage DonSanchon, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1000. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279866 (Mycobacterium phage MRabcd, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1001. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK524512 (Mycobacterium phage Carthage, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1002. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MN945899 (Mycobacterium phage Skippy, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1003. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279908 (Mycobacterium phage Roliet, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1004. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_023727 (Mycobacterium phage Vista, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1005. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MT897909 (Mycobacterium phage Maru, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1006. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KM347890 (Mycobacterium phage Vivaldi, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1007. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH727555 (Mycobacterium phage Mulan, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1008. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KY006474 (Mycobacterium phage Prann, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1009. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_027985 (Mycobacterium phage UncleHowie, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1010. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JN698990 (Mycobacterium phage IsaacEli, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1011. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KY965066 (Mycobacterium phage BlackStallion, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1012. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MN703415 (Mycobacterium phage Mcshane, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1013. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KX592589 (Mycobacterium phage Iridoclysis, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1014. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279871 (Mycobacterium phage Plmatters, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1015. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MN096366 (Mycobacterium phage AbsoluteMadLad, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1016. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_028942 (Mycobacterium phage Phipps, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1017. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KJ567044 (Mycobacterium phage EmpTee, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1018. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279881 (Mycobacterium phage Solosis, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1019. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MT897902 (Mycobacterium phage Boehler, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1020. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279855 (Mycobacterium phage Haleema, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1021. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JX649096 (Mycobacterium phage Serpentine, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1022. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK494104 (Mycobacterium phage HenryJackson, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1023. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MG944225 (Mycobacterium phage Xavier, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1024. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JX649099 (Mycobacterium phage Gyarad, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1025. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH450116 (Mycobacterium phage Buckeye, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1026. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JN638753 (Mycobacterium phage Morgushi, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1027. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MG757158 (Mycobacterium phage HighStump, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1028. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK112539 (Mycobacterium phage Dione, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1029. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279873 (Mycobacterium phage QueenBeane, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1030. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MF668276 (Mycobacterium phage Lulumae, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1031. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MT897903 (Mycobacterium phage DirtJuice, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1032. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH513980 (Mycobacterium phage Roy17, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1033. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279879 (Mycobacterium phage SassyCat97, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1034. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MN586058 (Mycobacterium phage Vaishali24, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1035. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MT316460 (Mycobacterium phage Kimbrough, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1036. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JF937097 (Mycobacterium phage Hertubise, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1037. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH230874 (Mycobacterium phage Banjo, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1038. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH651186 (Mycobacterium phage Podrick, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1039. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MG962362 (Mycobacterium phage AltPhacts, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1040. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JF704103 (Mycobacterium phage Vortex, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1041. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to FJ174694 (Mycobacterium phage Chah, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1042. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK112536 (Mycobacterium phage Cannibal, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1043. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KX578071 (Mycobacterium phage Mana, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1044. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MF919539 (Mycobacterium phage Virapocalypse, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1045. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KC661274 (Mycobacterium phage SDcharge11, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1046. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KJ194579 (Mycobacterium phage Swish, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1047. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH371114 (Mycobacterium phage Childish, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1048. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279910 (Mycobacterium phage Antonia, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1049. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279852 (Mycobacterium phage Fringe, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1050. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KX576643 (Mycobacterium phage FriarPreacher, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1051. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JN699010 (Mycobacterium phage TallGrassMM, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1052. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MG757159 (Mycobacterium phage JangoPhett, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1053. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MF919503 (Mycobacterium phage Dingo, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1054. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KY676783 (Mycobacterium phage Chorkpop, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1055. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK112527 (Mycobacterium phage Altwerkus, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1056. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JX649100 (Mycobacterium phage Alex, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1057. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_028691 (Mycobacterium phage Apizium, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1058. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH371125 (Mycobacterium phage Morty, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1059. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JF937109 (Mycobacterium phage Yoshand, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1060. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279878 (Mycobacterium phage Samaymay, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1061. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH399786 (Mycobacterium phage PhrodoBaggins, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1062. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK112551 (Mycobacterium phage Riggan, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1063. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KR816508 (Mycobacterium phage Phamished, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1064. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JF937095 (Mycobacterium phage Harvey, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1065. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KF713485 (Mycobacterium phage Suffolk, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1066. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MG770212 (Mycobacterium phage Haimas, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1067. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279861 (Mycobacterium phage Legolas, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1068. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279843 (Mycobacterium phage CamL, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1069. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279846 (Mycobacterium phage Cosmolli16, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1070. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KM408320 (Mycobacterium phage Lasso, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1071. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH825705 (Mycobacterium phage Mesh1, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1072. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MT952849 (Mycobacterium phage Windsor, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1073. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH576954 (Mycobacterium phage HSavage, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1074. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK112555 (Mycobacterium phage Zelda, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1075. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_028803 (Mycobacterium phage OSmaximus, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1076. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279904 (Mycobacterium phage RedMaple, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1077. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JN699009 (Mycobacterium phage ThreeOh3D2, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1078. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_005259 (Mycobacterium phage PG1, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1079. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK112552 (Mycobacterium phage Spartan300, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1080. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MF919523 (Mycobacterium phage Mikota, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1081. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KU867907 (Mycobacterium phage Potter, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1082. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH590588 (Mycobacterium phage Vaticameos, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1083. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279885 (Mycobacterium phage Surely, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1084. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279870 (Mycobacterium phage Omniscient, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1085. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JN638752 (Mycobacterium phage Murdoc, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1086. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KT599441 (Mycobacterium phage Squid, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1087. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MG925346 (Mycobacterium phage LeeLot, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1088. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MG962375 (Mycobacterium phage ProfessorX, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1089. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MG925348 (Mycobacterium phage Megatron, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1090. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH077582 (Mycobacterium phage Olive, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1091. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MF155947 (Mycobacterium phage LemonSlice, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1092. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KP027209 (Mycobacterium phage Sigman, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1093. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH450122 (Mycobacterium phage KingTut, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1094. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279859 (Mycobacterium phage Kwadwo, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1095. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK112546 (Mycobacterium phage LuckyMarjie, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1096. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KX620786 (Mycobacterium phage Lego3393, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1097. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK112544 (Mycobacterium phage Keitherie, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1098. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KP027197 (Mycobacterium phage FluffyNinja, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1099. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH651177 (Mycobacterium phage KlimbOn, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1100. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279877 (Mycobacterium phage Roscoe, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1101. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JN698989 (Mycobacterium phage JacAttac, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1102. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK112553 (Mycobacterium Phage Squiggle, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1103. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_028907 (Mycobacterium phage Kikipoo, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1104. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK524526 (Mycobacterium phage Robyn, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1105. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279897 (Mycobacterium phage Bishoperium, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1106. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MT310868 (Mycobacterium phage Telesworld, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1107. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279865 (Mycobacterium phage Mecca, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1108. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KC576784 (Mycobacterium phage ShiVal, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1109. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KJ595576 (Mycobacterium phage Manad, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1110. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MN444868 (Mycobacterium phage Prickles, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1111. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH371117 (Mycobacterium phage Kahve, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1112. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH399773 (Mycobacterium phage Craff, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1113. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to GU247133 (Mycobacterium phage Fang, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1114. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KX683292 (Mycobacterium phage Held, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1115. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_008197 (Mycobacterium phage Orion, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1116. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH479921 (Mycobacterium phage Placalicious, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1117. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MT897901 (Mycobacterium phage Adriana, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1118. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KT364588 (Mycobacterium phage Hetaeria, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1119. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MF919530 (Mycobacterium phage Sheila, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1120. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MG925356 (Mycobacterium phage OliverWalter, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1121. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JX649098 (Mycobacterium phage Nacho, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1122. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH926060 (Mycobacterium phage Schadenfreude, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1123. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KP027208 (Mycobacterium phage Pipsqueak, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1124. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JF704109 (Mycobacterium phage Oosterbaan, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1125. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KX369585 (Mycobacterium phage PhatCats2014, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1126. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK310139 (Mycobacterium phage Emiris, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1127. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH576967 (Mycobacterium phage UAch1, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1128. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KJ194580 (Mycobacterium phage Badfish, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1129. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279889 (Mycobacterium phage Valjean, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1130. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH399775 (Mycobacterium phage Gareth, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1131. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279894 (Mycobacterium phage YouGoGlencoco, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1132. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK279895 (Mycobacterium phage Zaider, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1133. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MN585967 (Mycobacterium phage Kloppinator, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1134. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to GQ303259 (Mycobacterium phage Colbert, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1135. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_028681 (Mycobacterium phage Pops, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1136. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH744417 (Mycobacterium phage Grand2040, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1137. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JX649097 (Mycobacterium phage Piglet, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1138. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MG925350 (Mycobacterium phage Mosaic, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1139. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH479914 (Mycobacterium phage FugateOSU, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1140. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH825702 (Mycobacterium phage Hamish, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1141. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JF704091 (Mycobacterium phage ABU, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1142. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MF919528 (Mycobacterium phage Phunky, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1143. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_028690 (Mycobacterium phage Eremos, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1144. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KJ538723 (Mycobacterium phage KingVeVeVe, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1145. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_021310 (Mycobacterium phage Newman, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1146. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MK112542 (Mycobacterium phage Jillium, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1147. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MT310867 (Mycobacterium phage Chaelin, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1148. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KJ194583 (Mycobacterium phage Numberten, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1149. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to KJ174157 (Mycobacterium phage Soto, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1150. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH399780 (Mycobacterium phage Mutante, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1151. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to JF704099 (Mycobacterium phage KLucky39, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1152. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MH779516 (Mycobacterium phage Waterdiva, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1153. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to MF919507 (Mycobacterium phage Horchata, complete genome) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgctgcccggcccggcgggcatcgagacc	Protospacer
****.*************.****.  *.*

1154. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP013069 (Pannonibacter phragmitetus strain 31801 plasmid p.p-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
ccgccgcccggcccggcgggcagatccgcc	Protospacer
 *****************.***  .* **

1155. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
acgccgcccggcccggcgtgcagatcgccg	Protospacer
.***************** ***  .** *.

1156. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP014600 (Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.767

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
ccttcgcccagccccgcgagcattccgacg	Protospacer
 * .*****.**** ************.*.

1157. spacer 5.12|2855412|30|NZ_CP022577|CRT matches to NC_021289 (Burkholderia insecticola plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

gtgccgccgagtacggtgctggctccgccg	CRISPR spacer
gtgccgccgagcacggtgcaggcttgacga	Protospacer
***********.******* ****. .* .

1158. spacer 5.12|2855412|30|NZ_CP022577|CRT matches to NZ_CP014519 (Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence) position: , mismatch: 7, identity: 0.767

gtgccgccgagtacggtgctggctccgccg	CRISPR spacer
gtgccgccgaggacggcgctggcgagggtg	Protospacer
*********** ****.******   * .*

1159. spacer 5.12|2855412|30|NZ_CP022577|CRT matches to MN892485 (Gordonia phage Kuwabara, complete genome) position: , mismatch: 7, identity: 0.767

gtgccgccgagtacggtgctggctccgccg	CRISPR spacer
ctgccgccgagtacgggtctggctgaatcg	Protospacer
 ***************  ******  ..**

1160. spacer 5.12|2855412|30|NZ_CP022577|CRT matches to NC_048018 (Gordonia phage Apricot, complete genome) position: , mismatch: 7, identity: 0.767

gtgccgccgagtacggtgctggctccgccg	CRISPR spacer
ctgccgccgagtacgggtctggctgaatcg	Protospacer
 ***************  ******  ..**

1161. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NZ_CP044073 (Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
cccgcatggccacccgccgagctgcatccc	Protospacer
 ** *.. ***************** ***

1162. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NC_003903 (Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence) position: , mismatch: 7, identity: 0.767

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
ggcccgccgccagccggcgagctgcttggc	Protospacer
* ********** *** ********.*

1163. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NC_003903 (Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence) position: , mismatch: 7, identity: 0.767

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
ggcccgccgccagccggcgagctgcttggc	Protospacer
* ********** *** ********.*

1164. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

ggcgcgcccgagcccgccgcgccggacccgccg	CRISPR spacer
gcggcacaggagcccgtcgcgccggacacgccg	Protospacer
*  **.*  *******.********** *****

1165. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to MK977708 (Mycobacterium phage Fulbright, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1166. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to MG099948 (Mycobacterium phage Philonius, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1167. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to MH926055 (Mycobacterium phage Chewbacca, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1168. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to MT723932 (Mycobacterium phage Schnauzer, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1169. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to KU935726 (Mycobacterium phage Xerxes, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1170. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to KU935730 (Mycobacterium phage Pipsqueaks, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1171. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to MH316570 (Mycobacterium phage Silvafighter, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1172. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to MK524518 (Mycobacterium phage Smurph, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1173. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to MK524515 (Mycobacterium phage Parmesanjohn, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1174. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to MH697585 (Mycobacterium phage Gex, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1175. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to KM588359 (Mycobacterium phage Carcharodon, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1176. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to MH697576 (Mycobacterium phage Aggie, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1177. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to MH697593 (Mycobacterium phage Tapioca, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1178. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to MG099936 (Mycobacterium phage Andies, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1179. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to NC_031243 (Mycobacterium phage Xeno, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1180. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to JN256079 (Mycobacterium phage Charlie, complete genome) position: , mismatch: 7, identity: 0.774

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
ccggtcaacggttcgggatgccgttcgcgcg	Protospacer
  * .***********  ************

1181. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to MF417927 (Uncultured Caudovirales phage clone 9F_2, partial genome) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
aaaggcgccttcgatgccggcaacaccgac	Protospacer
.*.. **** *.*****************.

1182. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NZ_CP022605 (Ochrobactrum quorumnocens strain A44 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gccattgccgtcgatgccggcaataccgag	Protospacer
*  *..*****.***********.*****

1183. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaagatgccgtcgatgccggcaacgccgag	Protospacer
**.. .*****.************.****

1184. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to JX469830 (Uncultured bacterium plasmid pG527, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gatcgcgccgatgatgccggccacaccggc	Protospacer
**   ***** ********** ******..

1185. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to JX469833 (Uncultured bacterium plasmid pWEC911, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gatcgcgccgatgatgccggccacaccggc	Protospacer
**   ***** ********** ******..

1186. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NC_008357 (Pseudomonas aeruginosa plasmid pBS228, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gatcgcgccgatgatgccggccacaccggc	Protospacer
**   ***** ********** ******..

1187. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to CP002151 (Uncultured bacterium plasmid PB5, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gatcgcgccgatgatgccggccacaccggc	Protospacer
**   ***** ********** ******..

1188. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to CP002152 (Uncultured bacterium plasmid PB11, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gatcgcgccgatgatgccggccacaccggc	Protospacer
**   ***** ********** ******..

1189. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to CP002153 (Uncultured bacterium plasmid PSP21, complete sequence) position: , mismatch: 7, identity: 0.767

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gatcgcgccgatgatgccggccacaccggc	Protospacer
**   ***** ********** ******..

1190. spacer 10.15|3359479|27|NZ_CP022577|CRT matches to NZ_AP018520 (Sphingobium sp. YG1 plasmid pYGP1, complete sequence) position: , mismatch: 7, identity: 0.741

gaacggcggcttgctcttcggctccgc	CRISPR spacer
tctcggcggcttgctcttcggcctgga	Protospacer
   *******************.. *

1191. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MN585973 (Mycobacterium phage StAnnes, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

1192. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MG944221 (Mycobacterium phage Scowl, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

1193. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to KT309034 (Mycobacterium phage Dante, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

1194. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_048850 (Mycobacterium phage Cornie, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

1195. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_021538 (Mycobacterium phage Job42, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

1196. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_026584 (Mycobacterium phage Minerva, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

1197. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to KJ409696 (Mycobacterium phage Lamina13, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

1198. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_028784 (Mycobacterium phage Tasp14, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgctggcctc	Protospacer
 ************.**********.  ..

1199. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct-----	CRISPR spacer
ttgccgccgttgccgccgttgc-----ctcccgc	Protospacer
 ************.********     **

1200. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgccgccggg	Protospacer
 ************.********.*  *

1201. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttgccgccgttgccgcccgt	Protospacer
 ************.********.*    *

1202. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgttgctgccgctgctgaaagc	Protospacer
*  ****.**********.*******. .

1203. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_014819 (Asticcacaulis excentricus CB 48 plasmid pASTEX02, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gggccgccgtcgctgcccttgctgacaac	Protospacer
* ********.****** ******* . .

1204. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_LR134463 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 21, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
aagtgtccgttgctgccgcggctgaagct	Protospacer
. *.  ************. *********

1205. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_LT703506 (Mycobacterium chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera plasmid 2) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
tggttgccgatgccgccgttgctgaagcg	Protospacer
  *..**** ***.**************

1206. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP025615 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gtgccgccgttgctgccaatgctcagcgc	Protospacer
*****************. **** *.  .

1207. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgttgctgccgctgctgaaagc	Protospacer
*  ****.**********.*******. .

1208. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgttgctgccgctgctgaaagc	Protospacer
*  ****.**********.*******. .

1209. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgctgccgttgctgccgttgccgtattc	Protospacer
 ***.*****************.* * ..

1210. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgttgctgccgctgctgaaagc	Protospacer
*  ****.**********.*******. .

1211. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP040096 (Pantoea sp. SO10 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
atgccgccgttgctgacgttggtgtcgta	Protospacer
.************** ***** **  *.

1212. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgttgctgccgctgctgaaagc	Protospacer
*  ****.**********.*******. .

1213. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_011887 (Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
gacccgctgatgctgccgttgctgaaagc	Protospacer
*  ****.* ****************. .

1214. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MT522000 (Mycobacterium phage Soul22, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

1215. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MF919502 (Mycobacterium phage Demsculpinboyz, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

1216. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to AY129336 (Mycobacteriophage Che9d, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

1217. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK359343 (Mycobacterium phage Pollywog, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

1218. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_042030 (Mycobacterium phage Yoshi, complete sequence) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

1219. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_048729 (Mycobacterium phage Renaud18, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

1220. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MT889380 (Mycobacterium phage Coco12, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggc	Protospacer
 ************.********.*  * .

1221. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_026585 (Mycobacteriophage Estave1, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

1222. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MG925354 (Mycobacterium phage Ogopogo, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

1223. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_023698 (Mycobacterium phage Avani, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

1224. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MT114167 (Mycobacterium phage Phanphagia, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccggc	Protospacer
 ************.********.*  * .

1225. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH077585 (Mycobacterium phage TChen, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

1226. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NC_048788 (Mycobacterium phage ThetaBob, complete genome) position: , mismatch: 7, identity: 0.759

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccgccgga	Protospacer
 ************.********.*  *

1227. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 7, identity: 0.731

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcacgtcgtcgccggccccgccgtc	Protospacer
.  . ******************* .

1228. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 7, identity: 0.731

gcggagtcgtcgccggccccgccggt	CRISPR spacer
atccggtcgtcgccggccccgccgcg	Protospacer
..  .*******************

1229. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 7, identity: 0.731

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcacgtcgtcgccggccccgccgtc	Protospacer
.  . ******************* .

1230. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 7, identity: 0.731

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcacgtcgtcgccggccccgccgtc	Protospacer
.  . ******************* .

1231. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 7, identity: 0.731

gcggagtcgtcgccggccccgccggt	CRISPR spacer
agcacgtcgtcgccggccccgccgtc	Protospacer
.  . ******************* .

1232. spacer 12.10|4154357|26|NZ_CP022577|CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.731

gcggagtcgtcgccggccccgccggt	CRISPR spacer
aacagatcgtcgccggccccgccgga	Protospacer
.  ...*******************

1233. spacer 12.12|4154507|29|NZ_CP022577|CRT matches to NZ_CP047220 (Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.759

ttgaagttggccccgccgctaccgccggc	CRISPR spacer
cccatttttgccacgccgctaccgccggc	Protospacer
.. *  ** *** ****************

1234. spacer 12.12|4154507|29|NZ_CP022577|CRT matches to MK510999 (Pseudomonas phage BR58, partial genome) position: , mismatch: 7, identity: 0.759

ttgaagttggccccgccgctaccgccggc	CRISPR spacer
ccggccttggaaccgccgctaccgccggc	Protospacer
..*.  ****  *****************

1235. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP050094 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgccggtgcatccctc	Protospacer
. ************* ********* * * *.

1236. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cagccggggtcgtcggcgccggtgcggccgct	Protospacer
. **********.************   **.*

1237. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP054025 (Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgccggtgcatccctc	Protospacer
. ************* ********* * * *.

1238. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP051543 (Paracoccus sanguinis strain OM2164 plasmid pPspOM122, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccggctcgggtgcctcccct	Protospacer
. *************** * ******* * .*

1239. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP054034 (Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgccggtgcatccctc	Protospacer
. ************* ********* * * *.

1240. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt-	CRISPR spacer
cggccggggttgccgtcgccggtgctt-cgctg	Protospacer
. ********.**** *********.* **.*

1241. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt-	CRISPR spacer
cggccggggttgccgtcgccggtgctt-cgctg	Protospacer
. ********.**** *********.* **.*

1242. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt-	CRISPR spacer
cggccggggttgccgtcgccggtgctt-cgctg	Protospacer
. ********.**** *********.* **.*

1243. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt-	CRISPR spacer
cggccggggttgccgtcgccggtgctt-cgctg	Protospacer
. ********.**** *********.* **.*

1244. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 7, identity: 0.781

ttgccggggtcgccggcgccggtgcctgcgtt-	CRISPR spacer
cggccggggttgccgtcgccggtgctt-cgctg	Protospacer
. ********.**** *********.* **.*

1245. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccggcattgccgtcgccgcgtggct	Protospacer
********************.****   ..*.

1246. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc---	CRISPR spacer
attgccgctggcattgccgttaccgtt---cccag	Protospacer
********.************.*** .   **

1247. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc---	CRISPR spacer
attgccgctggcattgccgttaccgtt---cccag	Protospacer
********.************.*** .   **

1248. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccg---gcgaacc	CRISPR spacer
attgccgctggcattgccgttaccgtttccgg---	Protospacer
********.************.***    **.

1249. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc---	CRISPR spacer
attgccgctggcattgccgttaccgtt---cccag	Protospacer
********.************.*** .   **

1250. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccg---gcgaacc	CRISPR spacer
attgccgctggcattgccgttaccgtttccgg---	Protospacer
********.************.***    **.

1251. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc---	CRISPR spacer
attgccgctggcattgccgttaccgtt---cccag	Protospacer
********.************.*** .   **

1252. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc---	CRISPR spacer
attgccgctggcattgccgtttccgtt---cccag	Protospacer
********.************ *** .   **

1253. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attcccgccggcattgccgttgccgttcccgc	Protospacer
*** ********************* .    *

1254. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gatgccgaccgcattgccgttgccggcgacag	Protospacer
. ***** * *******************

1255. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gatgccgaccgcattgccgttgccggcgacag	Protospacer
. ***** * *******************

1256. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NC_012853 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccggaattgccgttgcccccgctat	Protospacer
*********** ************  **   .

1257. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccggcatcgccgtggccgcctggct	Protospacer
**************.***** **** * ..*.

1258. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gtcgacgccggcatagccgttgcgggcgatct	Protospacer
.*.* ********* ******** ***** *.

1259. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP019063 (Rahnella sp. ERMR1:05 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccggcggcattgcctttgccaacccgcc	Protospacer
******* ********** *****..*  .**

1260. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gtcgacgccggcatagccgttgcgggcgatct	Protospacer
.*.* ********* ******** ***** *.

1261. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 7, identity: 0.781

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gtcgacgccggcatagccgttgcgggcgatct	Protospacer
.*.* ********* ******** ***** *.

1262. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1263. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1264. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1265. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1266. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1267. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1268. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1269. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gttgccgccgttgccgccgttgccgccgttgc	Protospacer
**. ****** *********.******* . *

1270. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gttgccgccgttgccgccgttgccgcccgttc	Protospacer
**. ****** *********.****** *..*

1271. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1272. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1273. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1274. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1275. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1276. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1277. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1278. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1279. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1280. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1281. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agcaccgccggtgccgccatcaccgccgccgc	Protospacer
. * **************.**.****** * *

1282. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1283. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1284. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1285. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1286. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1287. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1288. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtacctgccggtgccgccgtcgccgcccagga	Protospacer
** **.********************* .

1289. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1290. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1291. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1292. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1293. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1294. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1295. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1296. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1297. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1298. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1299. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1300. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1301. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1302. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1303. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1304. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1305. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1306. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1307. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccggcca	Protospacer
    ***** *********.***********

1308. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaggtcgtcggtgccgccgtcgccgccggtca	Protospacer
*   .**.*********************.*

1309. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_009339 (Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tcctgggccggtgccgcccgcgccgccggccc	Protospacer
 .*.  ************  ************

1310. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_LR134451 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtcctcgccggtgcggccgtcgccgcgcgtgg	Protospacer
****.********* ***********  *.

1311. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtgccaccggtaccgccgtcgccgccgggtc	Protospacer
* . **.*****.**************** .*

1312. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP045381 (Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaccccgccggtgccgccgccaccgccgattg	Protospacer
* *****************.*.******...

1313. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP045381 (Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gttgccgccgttgccgccatcgccgccgtcgt	Protospacer
**. ****** *******.********* * .

1314. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP045381 (Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcacggccgggaccgccgtcgccgccggcag	Protospacer
* * * ***** .*****************

1315. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tccggcgccggtgtcgtcgtcgccgccggcct	Protospacer
 .*  ********.**.**************.

1316. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tccggcgccggtgccgccgtcgcagccggtct	Protospacer
 .*  ****************** *****.*.

1317. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tccggcgccggtgtcgccgtcgcagccggcct	Protospacer
 .*  ********.********* *******.

1318. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaggtcgccggtgccgccgccgcggccggccg	Protospacer
*   .**************.*** *******

1319. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_011879 (Pseudarthrobacter chlorophenolicus A6 plasmid pACHL01, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gagttcgacggtgccgccgacgccgccggcct	Protospacer
*  ..** *********** ***********.

1320. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_008703 (Mycobacterium sp. KMS plasmid pMKMS01, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tcctgggccggtgccgcccgcgccgccggccc	Protospacer
 .*.  ************  ************

1321. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gatcccgccggtgccgccggccccgccaccgc	Protospacer
* .**************** * *****. * *

1322. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ccctgcgccggtgccgcagtcgccgcccgccg	Protospacer
 .*. ************ ********* ***

1323. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MT889380 (Mycobacterium phage Coco12, complete genome) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggcat	Protospacer
*.. ****** *********.********* .

1324. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MT114167 (Mycobacterium phage Phanphagia, complete genome) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggcat	Protospacer
*.. ****** *********.********* .

1325. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
acccaggccgctgccgccgtcgccaccggcct	Protospacer
..**  **** *************.******.

1326. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggatcggccggggccgccgtcgccgcccgcct	Protospacer
*  .* ***** *************** ***.

1327. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cccgccgccgctgccgccgtagccgccgccac	Protospacer
 .* ****** ********* ******* * *

1328. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
acccaggccgctgccgccgtcgccaccggcct	Protospacer
..**  **** *************.******.

1329. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP014276 (Martelella sp. AD-3 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcgccgccgctgccgccgccgccgccgatcg	Protospacer
* * ****** ********.********..*

1330. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP040820 (Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaccccgcccgtgccaccgtcgccgcccgggt	Protospacer
* ******* *****.*********** *  .

1331. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agcggcgccggtgccgacgacgccgccggcgc	Protospacer
. *  *********** ** ********** *

1332. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggccccgcaggtgccgccgtcgccgaccctgc	Protospacer
* ****** **************** *  . *

1333. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
acccaggccgctgccgccgtcgccaccggcct	Protospacer
..**  **** *************.******.

1334. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
acccaggccgctgccgccgtcgccaccggcct	Protospacer
..**  **** *************.******.

1335. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggccccgcaggtgccgccgtcgccgaccctgc	Protospacer
* ****** **************** *  . *

1336. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tccgccgccggcgccgccggcgccgccggatc	Protospacer
 .* *******.******* ********* .*

1337. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MK494095 (Mycobacterium phage Daegal, complete genome) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtgccgccggtgccgccggtgccgccggtgc	Protospacer
* . *************** .********. *

1338. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MK494105 (Mycobacterium phage Pinnie, complete genome) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccctcgccggtgccgccggcgccgcccggtg	Protospacer
*.**.************** ******* * .

1339. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MK494105 (Mycobacterium phage Pinnie, complete genome) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cacgccgccgttgccgccggcgccgccgccac	Protospacer
  * ****** ******** ******** * *

1340. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_028791 (Mycobacterium phage MOOREtheMARYer, complete genome) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccctcgccggtgccgccggcgccgcctggtg	Protospacer
*.**.************** ******* * .

1341. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP023779 (Nocardia terpenica strain NC_YFY_NT001 plasmid p_NC_YFY_NT001, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgcc--gccggccc	CRISPR spacer
gtccccggcggtcccgccgtcgcccgggtggt--	Protospacer
******* **** ***********  * .**.

1342. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cttgccgccggcgccgccctcgccgccgaacc	Protospacer
 *. *******.****** *********. **

1343. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcggcgccgatgccgccggcgccgccggtca	Protospacer
* *  *****.******** *********.*

1344. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ctcggcgcgggggccgccgtcgccgccgtcgc	Protospacer
 **  *** ** **************** * *

1345. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP019631 (Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gttgccgccgttgccgccatcgccgccgtcgt	Protospacer
**. ****** *******.********* * .

1346. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 7, identity: 0.781

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccgttgccggtgccgccgtcggctccggcgc	Protospacer
*.* ..**************** * ***** *

1347. spacer 13.6|4173801|32|NZ_CP022577|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

atcgccaccagccgcgccaaccgagccgaccc	CRISPR spacer
atcgccaccagccgcgccagcggaatccgcgc	Protospacer
*******************.* **..* .* *

1348. spacer 14.6|4175176|28|NZ_CP022577|CRT matches to NC_022050 (Paracoccus aminophilus JCM 7686 plasmid pAMI8, complete sequence) position: , mismatch: 7, identity: 0.75

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
atcacggtgatgcgggtgccctgtggca	Protospacer
. **********  ***********

1349. spacer 15.4|4303843|33|NZ_CP022577|CRT matches to NZ_CP021355 (Rhodococcus sp. S2-17 plasmid pRB98, complete sequence) position: , mismatch: 7, identity: 0.788

ccggcgatgttggccccgccggccccgccgttg-	CRISPR spacer
tcggcgatggtggccccgcc-gtcccgtagctgg	Protospacer
.******** ********** *.****. *.**

1350. spacer 15.9|4304119|27|NZ_CP022577|CRT matches to AP021851 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome) position: , mismatch: 7, identity: 0.741

tacagccacgctccagagccgccggct	CRISPR spacer
agccgccacgctccagagccgcctcgc	Protospacer
 .* *******************   .

1351. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.741

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ccgccgccgccatcgccgaccgcaccg	Protospacer
*** *****************. ..

1352. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 7, identity: 0.741

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
ttggcgccggcatcgccgaccagccgg	Protospacer
..******* ************* ..

1353. spacer 15.13|4304335|27|NZ_CP022577|CRT matches to NZ_CP006368 (Aureimonas sp. AU20 plasmid pAU20a, complete sequence) position: , mismatch: 7, identity: 0.741

ccggcgccgccatcgccgaccaggtac	CRISPR spacer
tcgacgccgccatcgccgaccatcgcg	Protospacer
.**.******************

1354. spacer 4.1|2765679|36|NZ_CP022577|CRT matches to NC_022087 (Mycobacterium phage AnnaL29, complete genome) position: , mismatch: 8, identity: 0.778

cccgccgttaccgccgttgccgatcagcccggcctt	CRISPR spacer
cccgccgtttccgccgttgccgatcacgccactgat	Protospacer
********* ****************  **. .  *

1355. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gccgccggagccgcacagcagcgtcacctt	Protospacer
************* *******  . .* *.

1356. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
ctgcccggagacgaacagcaggccgcccgc	Protospacer
 .  ****** ************** *  *

1357. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
ctgggcggagcggaacagcaggccggaatt	Protospacer
 . * ****** ************** .*.

1358. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gggatcggcgccgaacatcaggccggcgca	Protospacer
*  ..*** ******** **********.

1359. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gggatcggcgccgaacatcaggccggcgca	Protospacer
*  ..*** ******** **********.

1360. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
ctcgccgaagccgagcagcaggccgagccc	Protospacer
 .*****.******.**********.  .*

1361. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
cccgccggcgccgaacatcaggccaaggca	Protospacer
 ******* ******** ******.. *.

1362. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to GQ919031 (Streptomyces phage ZL12, complete genome) position: , mismatch: 8, identity: 0.733

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
gactggtccgccgaacagcaggccgtcgtc	Protospacer
* *      **************** ****

1363. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP046258 (Gordonia sp. 135 plasmid pG135, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
acgccgccgccgccgaacagcagatgtcgc	Protospacer
.*********.************ . *

1364. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NC_018583 (Gordonia sp. KTR9 plasmid pGKT3, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
acgccgccgccgccgaacagcagatgtcgc	Protospacer
.*********.************ . *

1365. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP017592 (Pantoea stewartii subsp. stewartii DC283 plasmid ppDSJ01, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
tcgccgccgcagccgaacagcagaagctgg	Protospacer
 ********* ************   .  *

1366. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
ttgtcggcgctgccgaacagcaggcctttc	Protospacer
 .*.** **************** *** .

1367. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
ttgtcggcgctgccgaacagcaggcctttc	Protospacer
 .*.** **************** *** .

1368. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP029096 (Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
tggccgctgctgccgaacagcagagcctgg	Protospacer
  *****.***************  *.  *

1369. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP022192 (Yangia pacifica strain YSBP01 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgctgccgatcagcgcaaccgtc	Protospacer
**************** ****.   *.*.

1370. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP010727 (Phaeobacter inhibens strain P88 plasmid pP88_b, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
agggcaatgctgccgaatagcagccctgcc	Protospacer
. * *. .*********.***********

1371. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to MN393079 (Salmonella virus VSiA, complete genome) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgcggctgaacagcagggtgcag	Protospacer
********** **.*********  .   *

1372. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to MN855773 (Siphoviridae sp. isolate 219, complete genome) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccaccgccgaacagcagggagcca	Protospacer
********.*.************     *.

1373. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
ctgacgccgccgccgaacagcagccggtgg	Protospacer
 .* ******.**************    *

1374. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
ctgacgccgccgccgaacagcagccggtgg	Protospacer
 .* ******.**************    *

1375. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP010602 (Phaeobacter inhibens strain P83 plasmid pP83_c, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
agggcaatgctgccgaatagcagccctgcc	Protospacer
. * *. .*********.***********

1376. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
ctgacgccgccgccgaacagcagccggtgg	Protospacer
 .* ******.**************    *

1377. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP010865 (Marinovum algicola DG 898 plasmid pMaD10, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
ctgccgccgctgccgaacttcagccgctcc	Protospacer
 .****************  ***** . *

1378. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP010708 (Phaeobacter inhibens strain P66 plasmid pP66_c, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
agggcaatgctgccgaatagcagccctgcc	Protospacer
. * *. .*********.***********

1379. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NC_019337 (Acetobacter pasteurianus plasmid pAC258-29, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
cccttgcctctgccgaacagcagccccttg	Protospacer
 * ..*** *****************. .*

1380. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP010737 (Phaeobacter inhibens strain P72 plasmid pP72_b, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
agggcaatgctgccgaatagcagccctgcc	Protospacer
. * *. .*********.***********

1381. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgccgcccggcccggcgtgaatcttcccc	Protospacer
****************** * **...  *

1382. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to CP000662 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
tgatagaccggcgcggcgagcactccggca	Protospacer
  .. * ***** *********.*******

1383. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
gcgccacccggcccggcgagcgcgcggaag	Protospacer
*****.***************.. * *. .

1384. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP032313 (Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
ccgccgcccggcccggcgggcagatccgtc	Protospacer
 *****************.***  .* *.

1385. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
ccgccgcccggcgcggcgagcagccggctg	Protospacer
 *********** ********* .* * ..

1386. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 8, identity: 0.733

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
attccggcgccgcccgccgagctgccgcaa	Protospacer
...*** ****.************** * .

1387. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NZ_CP047261 (Pseudomonas syringae pv. maculicola str. ES4326 plasmid pPma4326F, complete sequence) position: , mismatch: 8, identity: 0.733

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
ccactatggccacccgccgagctgcatccc	Protospacer
 * *... ***************** ***

1388. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to NZ_CP029777 (Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
gacctgccgccgcccgccgagctgcgcgac	Protospacer
* **.******.************* .

1389. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.758

ggcgcgcccgagcccgccgcgccggacccgccg	CRISPR spacer
ggcgcgcccgagcccgccgcggcgcttcaggtc	Protospacer
********************* **  .* * .

1390. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.758

ggcgcgcccgagcccgccgcgccggacccgccg	CRISPR spacer
ggcgcgcccgagcccgccgcggcgcttcaggtc	Protospacer
********************* **  .* * .

1391. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 8, identity: 0.758

ggcgcgcccgagcccgccgcgccggacccgccg	CRISPR spacer
ggcgtgcccgtgcccgccgcgccgatgctgatg	Protospacer
****.***** *************.  *.* .*

1392. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gccggcgccgatgatgccggcaacgccgcc	Protospacer
*  . ***** *************.*** .

1393. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gccggcgccgatgatgccggcaacgccgcc	Protospacer
*  . ***** *************.*** .

1394. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NZ_CP048283 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaagggaacgttgatgccggcaacgccgag	Protospacer
**..  . ****************.****

1395. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NZ_CP021796 (Sinorhizobium meliloti strain USDA1157 plasmid accessoryA, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gctcacgccgttgatgccgacaacatcgcg	Protospacer
*    **************.*****.**

1396. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NZ_CP050101 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaagggaacgttgatgccggcaacgccgag	Protospacer
**..  . ****************.****

1397. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NZ_CP025016 (Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaagggaacgttgatgccggcaacgccgag	Protospacer
**..  . ****************.****

1398. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
ggcggcgccgttgatgccgaccacaccgga	Protospacer
*. . **************.* ******.

1399. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NZ_CP053442 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaagggaacgttgatgccggcaacgccgag	Protospacer
**..  . ****************.****

1400. spacer 9.2|3331197|30|NZ_CP022577|CRISPRCasFinder matches to NZ_CP022569 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence) position: , mismatch: 8, identity: 0.733

gagaccgccgttgatgccggcaacaccgat	CRISPR spacer
gaagggaacgttgatgccggcaacgccgag	Protospacer
**..  . ****************.****

1401. spacer 10.5|3358942|36|NZ_CP022577|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.778

ggccggcgggcgcggcggcgacgccggtttgctctt	CRISPR spacer
ctccggcggccgccgcggcgacgccggtttccgccg	Protospacer
  ******* *** **************** * *.

1402. spacer 10.11|3359281|33|NZ_CP022577|CRT matches to NZ_CP020040 (Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence) position: , mismatch: 8, identity: 0.758

caacgccggcctactctccctcggcgcctccgg	CRISPR spacer
cggcgttctcctgctctcgctcggcgcctccgg	Protospacer
*..**..  ***.***** **************

1403. spacer 12.1|4153631|29|NZ_CP022577|CRT matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.724

ccggtggctgcccctccgtcggcgccatc	CRISPR spacer
gcggtggctgccccgccgtcggtctcgct	Protospacer
 ************* *******. .*...

1404. spacer 12.1|4153631|29|NZ_CP022577|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.724

ccggtggctgcccctccgtcggcgccatc	CRISPR spacer
gcggtggctgccccgccgtcggtctcgct	Protospacer
 ************* *******. .*...

1405. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to NZ_CP048923 (Lactobacillus plantarum strain X7022 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.724

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ttgccgccgttactgccgatgctgctttg	Protospacer
 **********.****** *****   .

1406. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MK937593 (Mycobacterium phage Flypotenuse, complete genome) position: , mismatch: 8, identity: 0.724

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccaccgga	Protospacer
 ************.********..  *

1407. spacer 12.6|4154048|29|NZ_CP022577|CRT matches to MH536820 (Mycobacterium phage Glexan, complete genome) position: , mismatch: 8, identity: 0.724

gtgccgccgttgctgccgttgctgaagct	CRISPR spacer
ctgccgccgttgccgccgttgccaccgga	Protospacer
 ************.********..  *

1408. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP050101 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cagccggggtcgccgtcgccggtgcttcgctc	Protospacer
. ************* *********.*   *.

1409. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NC_008379 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgccggtgcatctctc	Protospacer
. ************* ********* * . *.

1410. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP053442 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cagccggggtcgccgtcgccggtgcttcgctc	Protospacer
. ************* *********.*   *.

1411. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gtgtcggggtagccggcgccggtgaggtagtt	Protospacer
 **.****** *************     ***

1412. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
tcaccgcggtcggcggcgccggtgccgggttg	Protospacer
*..*** ***** ************* *  *

1413. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP046571 (Xanthomonas albilineans strain Xa-FJ1 plasmid pXaFJ1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gtcgctcgctcgccggcgccggcgccggcgtt	Protospacer
 *  *  * *************.*** *****

1414. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
tcaccgcggtcggcggcgccggtgccgggttg	Protospacer
*..*** ***** ************* *  *

1415. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
cttgccgccggcagtgccgtggccgcggacat	Protospacer
 ************ ****** ****  **  .

1416. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attcccgccggcattgccgttgccattcccgc	Protospacer
*** ********************. .    *

1417. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccgttgccgttcccgc	Protospacer
.** ********************* .    *

1418. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccgttgccgttcccgc	Protospacer
.** ********************* .    *

1419. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attcccgccggcgttgccgttgccgttcccac	Protospacer
*** ********.************ .    *

1420. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attcccgccggcgttgccgttgccgttcccgc	Protospacer
*** ********.************ .    *

1421. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attcccgccggcattgccattgccgttcccgc	Protospacer
*** **************.****** .    *

1422. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to CP054927 (Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gctgccgccggcattcccgctgccggcggggg	Protospacer
..************* ***.********..

1423. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013525 (Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1424. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013554 (Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1425. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013560 (Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1426. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013577 (Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1427. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013549 (Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1428. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013534 (Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1429. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013545 (Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1430. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013565 (Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1431. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013571 (Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1432. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NC_010998 (Rhizobium etli CIAT 652 plasmid pA, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
tcaaaggccggcattgccgatgccggcgagcc	Protospacer
 . .  ************* *********.**

1433. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to JN699011 (Mycobacterium phage Stinger, complete genome) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgacattgccgctgccggtgttgt	Protospacer
.*********.********.******.*   .

1434. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_KM406416 (Bifidobacterium breve strain JCM 7017 plasmid megaplasmid pMP7017, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccggtgttgccgttgccgtggtagt	Protospacer
.**********..************  * * .

1435. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NC_019018 (Mycobacterium marinum DL240490 plasmid pMUM003, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ttgcccgccggcgttgccgtggccggcgcaat	Protospacer
 *  ********.******* ******* * .

1436. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NC_011355 (Mycobacterium liflandii 128FXT plasmid pMUM002, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ttgcccgccggcgttgccgtggccggcgcaat	Protospacer
 *  ********.******* ******* * .

1437. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gtagtcgtcgacattgccgttgccggcgcgcg	Protospacer
.* *.**.**.***************** .*

1438. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ttggccgccggcattgctgatgccggccacga	Protospacer
 * **************.* ******* *

1439. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ttgcccgccggcgttgccgtggccggcgcaat	Protospacer
 *  ********.******* ******* * .

1440. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP027853 (Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
attgccgccggcattactgttgctgcagcgcg	Protospacer
***************.*.*****.*  * .*

1441. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 8, identity: 0.75

attgccgccggcattgccgttgccggcgaacc-----	CRISPR spacer
gttgccgccgccattgccattgcc-----acctttgg	Protospacer
.********* *******.*****     ***

1442. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgcgcctccggtgccgccgccgccgccgatcg	Protospacer
  * ** ************.********..*

1443. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgagccgccggtgccgccgtctccgccgttgc	Protospacer
    ***************** ****** . *

1444. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
attgccgccgttgccgccgttgccgccggggt	Protospacer
.*. ****** *********.********  .

1445. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ccctccgccggcgccgccgtcgccgcccttgc	Protospacer
 .*.*******.***************  . *

1446. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtgccgcccgcgccgccgtcgccgccgcggc	Protospacer
* . ***** *.****************   *

1447. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtaccgccgttgccgccgtcgcctccgtcac	Protospacer
  . ****** ************* *** * *

1448. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgcaccgccgttgccgccggcgccgccgatcg	Protospacer
  * ****** ******** ********..*

1449. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggctgcgccggtgccgcccgcgccgccgatac	Protospacer
* *. *************  ********.. *

1450. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtagacgccggtaccgccgtcggcgccgcgca	Protospacer
**   *******.********* *****  *

1451. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaagccgccgacgccgccgtcgccgcccgttc	Protospacer
*   ******..*************** *..*

1452. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gcgtccgccggcgccgccggcgccgcccgttc	Protospacer
*. .*******.******* ******* *..*

1453. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtgccgccggtgccgccattgccgccgccgc	Protospacer
  . **************.*.******* * *

1454. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tgcttccccggtgccgccgtcgcggcccgcgc	Protospacer
  *..* **************** *** ** *

1455. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtaccgccggtgccgcccccgccgccgaagc	Protospacer
* . ************** .********.  *

1456. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgacccgccggtgccgccgacgccacccgtgc	Protospacer
   **************** ****.** *. *

1457. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_LR134461 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gacgccggcgatgccgccgtcgccgcctccgg	Protospacer
* * *** **.****************  *

1458. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ctcgccgccgctgccgccgtcgccctggcgcc	Protospacer
 ** ****** ************* . *  **

1459. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cccgccgccgctgccgccgtccccgccgctgc	Protospacer
 .* ****** ********** ****** . *

1460. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaagccgccgttgccgccgccgccgcctaccg	Protospacer
*   ****** ********.******* .**

1461. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MF141540 (Mycobacterium phage Avocado, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ccgcccgccggtgccgccggcgccgcgggtga	Protospacer
 . **************** ****** **.

1462. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to KR080198 (Mycobacterium phage Cambiare, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ccgcccgccggtgccgccggcgccgcgggtga	Protospacer
 . **************** ****** **.

1463. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcgcggccgatgccgccgccgccgccggtga	Protospacer
* * * ****.********.*********.

1464. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgccacgccggtgccgccggcgccgcctccag	Protospacer
  ** ************** *******  *

1465. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tccggcgccggtgtcgccgtcgcggccggact	Protospacer
 .*  ********.********* ***** *.

1466. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggccccccaggtgccgccgtcgccgaccctgc	Protospacer
* **** * **************** *  . *

1467. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP026974 (Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ctgcaccgcggcgccgccgacgccgccggccg	Protospacer
 * * *  ***.******* ***********

1468. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_020275 (Mycobacterium intracellulare subsp. yongonense 05-1390 plasmid pMyong1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gcccgcgccggtgccgacgtcgccgcgctgct	Protospacer
*.** *********** *********    *.

1469. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgc	Protospacer
    ***** *********.******** * *

1470. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP047145 (Streptomyces sp. HF10 plasmid plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ttccccgccggtgcggccgccgccggccacgg	Protospacer
 ************* ****.***** * .*

1471. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgc	Protospacer
    ***** *********.******** * *

1472. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cggtgcgccggtgccgccgccgccgccgcgcc	Protospacer
   . **************.********  **

1473. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cttgccgccgtcgccgccgtcgccgcccgtgc	Protospacer
 *. ****** .*************** *. *

1474. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccgatgccggtgtcggcgtcgccgccgggcg	Protospacer
*.*  .*******.** ************ *

1475. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggacacgccggtggtgccgtcgccgccgaagc	Protospacer
*  * ******** .*************.  *

1476. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MK814754 (Mycobacterium phage Sumter, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1477. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MK814754 (Mycobacterium phage Sumter, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1478. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MN369739 (Mycobacterium phage Kenuha5, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1479. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MK967397 (Mycobacterium phage Mahavrat, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1480. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MH001451 (Mycobacterium phage Nairb, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atagccgccgttgccgccgttgccgccggtga	Protospacer
.*  ****** *********.********.

1481. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MK524490 (Mycobacterium phage Donny, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggagccgccgttgccgccgttgccgccggagg	Protospacer
*   ****** *********.********

1482. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MT522000 (Mycobacterium phage Soul22, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1483. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to KY348865 (Mycobacterium phage Bubbles123, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1484. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MN428047 (Mycobacterium phage Doomphist, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1485. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MF919502 (Mycobacterium phage Demsculpinboyz, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1486. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to AY129336 (Mycobacteriophage Che9d, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1487. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MT771340 (Mycobacterium phage Jorgensen, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1488. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MK359343 (Mycobacterium phage Pollywog, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1489. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MF155936 (Mycobacterium phage ZenTime222, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atagccgccgttgccgccgttgccgccggtga	Protospacer
.*  ****** *********.********.

1490. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_042030 (Mycobacterium phage Yoshi, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaga	Protospacer
*.. ****** *********.********

1491. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MH338241 (Mycobacterium phage Tarynearal, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
aacgtcgccgttgccgccgtcgccgccgcgac	Protospacer
. * .***** *****************   *

1492. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_048729 (Mycobacterium phage Renaud18, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaga	Protospacer
*.. ****** *********.********

1493. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_026585 (Mycobacteriophage Estave1, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1494. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MK305886 (Mycobacterium phage Poenanya, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1495. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to JN859129 (Mycobacterium virus DotProduct, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1496. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MK494089 (Mycobacterium phage Ibrahim, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atagccgccgttgccgccgttgccgccggtga	Protospacer
.*  ****** *********.********.

1497. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MG925354 (Mycobacterium phage Ogopogo, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1498. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_023698 (Mycobacterium phage Avani, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaaa	Protospacer
*.. ****** *********.********

1499. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to JN699007 (Mycobacterium phage Acadian, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggagccgccgttgccgccgttgccgccggagg	Protospacer
*   ****** *********.********

1500. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_024135 (Mycobacterium phage Bernal13, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atagccgccgttgccgccgttgccgccggtga	Protospacer
.*  ****** *********.********.

1501. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_011054 (Mycobacterium phage Boomer, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggtat	Protospacer
*.. ****** *********.********. .

1502. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MT889381 (Mycobacterium phage Suigeneris, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggagccgccgttgccgccgttgccgccggagg	Protospacer
*   ****** *********.********

1503. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to KM591905 (Mycobacterium phage RonRayGun, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atagccgccgttgccgccgttgccgccggtga	Protospacer
.*  ****** *********.********.

1504. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MH077585 (Mycobacterium phage TChen, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaga	Protospacer
*.. ****** *********.********

1505. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MN735432 (Mycobacteriophage Whitty, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atagccgccgttgccgccgttgccgccggtga	Protospacer
.*  ****** *********.********.

1506. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_048788 (Mycobacterium phage ThetaBob, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgttgccgccggaga	Protospacer
*.. ****** *********.********

1507. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP018471 (Xanthomonas vesicatoria strain LM159 plasmid pLM159.2, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtgccgccggtgccggcgtcgccaccgccac	Protospacer
  . ************ *******.*** * *

1508. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_008712 (Paenarthrobacter aurescens TC1 plasmid pTC1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgcgaggccggtgacgccggcgccgccggcac	Protospacer
  *   ******* ***** ********** *

1509. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaagccgccgatgccgccgccgccgccgttca	Protospacer
*   ******.********.******** .*

1510. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcggcgccggtgccgctgtcggcgccgctca	Protospacer
* *  ************.**** ***** .*

1511. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_LR134446 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 4, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaagccgccgttgccgccgttgccgccgctcg	Protospacer
*   ****** *********.******* .*

1512. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_LR134454 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccaacgccggtggcgccttcgccgccgacgt	Protospacer
*.*  ******** **** *********.* .

1513. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggcgcggccgatgccgctgtcgccgccggtga	Protospacer
* * * ****.******.***********.

1514. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gactgtgctggtgccgccgtcgcagccggcga	Protospacer
* *. .**.************** ******

1515. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_008539 (Arthrobacter sp. FB24 plasmid 3, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ctggcggccgcggccgccgtcgccgccggctt	Protospacer
 *  * ****  ******************..

1516. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ctggccgccggttccgccttcgccgccgccat	Protospacer
 *  ******** ***** ********* * .

1517. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccgggtgcgatgccgccgttgccgccggccc	Protospacer
*.*     **.*********.***********

1518. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP046330 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tgacgcaccggtgccggcgccgccgccggcca	Protospacer
   * *.********* **.***********

1519. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_019789 (Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gttgtcggcggtgccgccgttgccgccggtgg	Protospacer
**. .** ************.********.

1520. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc--	CRISPR spacer
caccccgccggtgccgccggtgccgc--gcttga	Protospacer
  ***************** .*****  **..

1521. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022566 (Mycolicibacterium alvei strain JCM 12272 plasmid pJCM12272, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
acccgcgccggcgccgccgtcgccgctcgacg	Protospacer
..** ******.**************. * *

1522. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
attggcgccggcgacgccgtcgccgccggttc	Protospacer
.*.  ******.* ***************..*

1523. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gtggtggccggtgccgccgcggccgccggaca	Protospacer
**  . *************. ******** *

1524. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_008766 (Acidovorax sp. JS42 plasmid pAOVO02, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtgccgccggtgccggcgtcgccaccgccac	Protospacer
  . ************ *******.*** * *

1525. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gacgacgccggtgccgccgacgccgacgatca	Protospacer
* *  ************** ***** **..*

1526. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP023550 (Rhodobacter sp. CZR27 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
atcgccgccgttgccgccgtcgccgtcaccgt	Protospacer
.** ****** **************.*. * .

1527. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP049701 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgccggagccgccgccgccgccgccgc	Protospacer
    ******* *******.******** * *

1528. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_006525 (Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tgacgcaccggtgccggcgccgccgccggcca	Protospacer
   * *.********* **.***********

1529. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgctccgccggtgccgctgttgccgccgtcat	Protospacer
  *.*************.**.******* * .

1530. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MN096355 (Mycobacterium phage Purky, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
accgccgccggtgccgccggtgccgccgcgct	Protospacer
..* *************** .*******  *.

1531. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MH669003 (Mycobacterium phage Girr, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagc	Protospacer
 *.  **.****************** **  *

1532. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MK016504 (Mycobacterium phage Whouxphf, complete genome) position: , mismatch: 8, identity: 0.75

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagc	Protospacer
 *.  **.****************** **  *

1533. spacer 13.5|4173747|32|NZ_CP022577|CRT matches to NZ_CP021406 (Celeribacter manganoxidans strain DY25 plasmid pDY25-B, complete sequence) position: , mismatch: 8, identity: 0.75

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
aaaccaggtggttccgccgaaaccggcgacgc	Protospacer
*   *  *.*** **************** **

1534. spacer 13.5|4173747|32|NZ_CP022577|CRT matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 8, identity: 0.75

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
gtggatcgcggtgccgccgaagacggcgaacc	Protospacer
.* * ..**************. ******* *

1535. spacer 13.5|4173747|32|NZ_CP022577|CRT matches to NZ_CP010872 (Confluentimicrobium sp. EMB200-NS6 strain EMBL200_NS6 plasmid pNS6003, complete sequence) position: , mismatch: 8, identity: 0.75

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
aaaccaggtggttccgccgaaaccggcgacgc	Protospacer
*   *  *.*** **************** **

1536. spacer 13.5|4173747|32|NZ_CP022577|CRT matches to NZ_CP040823 (Paraoceanicella profunda strain D4M1 plasmid pD4M1E, complete sequence) position: , mismatch: 8, identity: 0.75

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
aaaccaggtggttccgccgaaaccggcgacgc	Protospacer
*   *  *.*** **************** **

1537. spacer 13.5|4173747|32|NZ_CP022577|CRT matches to NZ_CP040823 (Paraoceanicella profunda strain D4M1 plasmid pD4M1E, complete sequence) position: , mismatch: 8, identity: 0.75

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
aaaccaggtggttccgccgaaaccggcgacgc	Protospacer
*   *  *.*** **************** **

1538. spacer 13.6|4173801|32|NZ_CP022577|CRT matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 8, identity: 0.75

atcgccaccagccgcgccaaccgagccgaccc	CRISPR spacer
atggccacccgccgcgccaaccggatcgtcgg	Protospacer
** ****** *************...** *

1539. spacer 14.6|4175176|28|NZ_CP022577|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 8, identity: 0.714

ggcacggtgatggtggtgccctgtgcgc	CRISPR spacer
tctccggtgatgggggtgccctgtggaa	Protospacer
  . ********* *********** .

1540. spacer 15.4|4303843|33|NZ_CP022577|CRT matches to MN234213 (Gordonia phage Schiebs, complete genome) position: , mismatch: 8, identity: 0.758

ccggcgatgttggccccgccggccccgccgttg	CRISPR spacer
agggaccagtcggccccgccggccccgccggtg	Protospacer
  **    **.******************* **

1541. spacer 15.4|4303843|33|NZ_CP022577|CRT matches to NC_012520 (Rhodococcus opacus B4 plasmid pROB01, complete sequence) position: , mismatch: 8, identity: 0.758

ccggcgatgttggccccgccggccccgccgttg	CRISPR spacer
tcggcgatggtggcgccgccggcccggagttgg	Protospacer
.******** **** ********** *   * *

1542. spacer 15.5|4303897|36|NZ_CP022577|CRT matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 8, identity: 0.778

tacagctgaccaccggccccgccggcgcc--gccgttc	CRISPR spacer
gggagctgaccacgagccccgccggcgccaagcagt--	Protospacer
 . ********** .**************  ** **

1543. spacer 15.5|4303897|36|NZ_CP022577|CRT matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 8, identity: 0.778

tacagctgaccaccggccccgccggcgcc--gccgttc	CRISPR spacer
gggagctgaccaccagcccggccggcgccaagcagt--	Protospacer
 . ***********.**** *********  ** **

1544. spacer 15.18|4304716|36|NZ_CP022577|CRT matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 8, identity: 0.778

-tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
cggtagtcg-ccgccgtggccgccgtggccgccggcg	Protospacer
  ..**.*. ******* ******* ***********

1545. spacer 15.18|4304716|36|NZ_CP022577|CRT matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 8, identity: 0.778

-tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
ccgcacccg-tcgtcgtggccgccgaggccgccggcg	Protospacer
 ..** **. .**.*** *******************

1546. spacer 15.18|4304716|36|NZ_CP022577|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.778

tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
tgccgctcaccgccgaagccgccgaggccgccggca	Protospacer
*.* **.  ******  ******************.

1547. spacer 3.7|1644407|30|NZ_CP022577|CRT matches to NZ_CP022197 (Celeribacter ethanolicus strain TSPH2 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

gacggcgggttgttcttcggcgtgggcggt	CRISPR spacer
cggagcgggttgttcgtcggcgtggagcga	Protospacer
 . .*********** *********.  *

1548. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_KY126370 (Enterobacter cloacae subsp. cloacae strain MN201516 plasmid pOP-I, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
cgtcccggtgccgagcagcaggccggccat	Protospacer
  . **** *****.************  .

1549. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_KP873172 (Pseudomonas aeruginosa PAO1 plasmid pAMBL1, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
cgtcccggtgccgagcagcaggccggccat	Protospacer
  . **** *****.************  .

1550. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP045203 (Citrobacter sp. NMI7904_11 plasmid pCTEL-2, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
cgtcccggtgccgagcagcaggccggccat	Protospacer
  . **** *****.************  .

1551. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NC_021492 (Enterobacter sp. R4-368 plasmid pENT01, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
cgtcccggtgccgagcagcaggccggccat	Protospacer
  . **** *****.************  .

1552. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP022156 (Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
cgtcccggtgccgagcagcaggccggccat	Protospacer
  . **** *****.************  .

1553. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP024682 (Citrobacter freundii strain UMH14 plasmid pUMH14_2, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
cgtcccggtgccgagcagcaggccggccat	Protospacer
  . **** *****.************  .

1554. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP046347 (Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
cgtcccggtgccgagcagcaggccggccat	Protospacer
  . **** *****.************  .

1555. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to NZ_CP044100 (Citrobacter werkmanii strain FDAARGOS_616 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
cgtcccggtgccgagcagcaggccggccat	Protospacer
  . **** *****.************  .

1556. spacer 4.3|2765775|30|NZ_CP022577|CRT matches to MT316461 (Streptomyces phage Galactica, complete genome) position: , mismatch: 9, identity: 0.7

gccgccggagccgaacagcaggccggcgtc	CRISPR spacer
atacgcggagacgaacagcaggcaggcgag	Protospacer
..   ***** ************ ****

1557. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 9, identity: 0.7

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
ctgacgccgccgccgaacagcagccggtga	Protospacer
 .* ******.**************    .

1558. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP015739 (Shinella sp. HZN7 plasmid pShin-03, complete sequence) position: , mismatch: 9, identity: 0.7

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgcggccgaacggcagaaggatt	Protospacer
********** *******.****    ..

1559. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NC_005307 (Gordonia westfalica strain DSM44215T plasmid pKB1 complete genome) position: , mismatch: 9, identity: 0.7

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
acgccgccgccgccgaacagcaaatgtcgc	Protospacer
.*********.***********. . *

1560. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NC_017805 (Deinococcus gobiensis I-0 plasmid P1, complete sequence) position: , mismatch: 9, identity: 0.7

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
ccgccgccgctgcccagcagcagcagcagc	Protospacer
 ************* *.*******  ..

1561. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NZ_CP010408 (Streptomyces vietnamensis strain GIMV4.0001 plasmid pSVL1, complete sequence) position: , mismatch: 9, identity: 0.7

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
aaggagccgctgccgaacagcagaccgagt	Protospacer
. *  ****************** ** .

1562. spacer 5.5|2855079|30|NZ_CP022577|CRT matches to NC_047756 (Caulobacter phage Sansa, complete genome) position: , mismatch: 9, identity: 0.7

gcgccgccgctgccgaacagcagccctgcg	CRISPR spacer
gcgccgccgttgccgaacagcttcttgatc	Protospacer
*********.***********  *.. ..

1563. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 9, identity: 0.7

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
atgccgcccgccccggcgagcatggtatga	Protospacer
..******** ************  ..  *

1564. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP021827 (Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
atgccgcccgccccggcgagcatggtatga	Protospacer
..******** ************  ..  *

1565. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
atgccgcccgccccggcgagcatggtatga	Protospacer
..******** ************  ..  *

1566. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
atgccgcccgccccggcgagcatggtatga	Protospacer
..******** ************  ..  *

1567. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
cagccgcccggcccggcgcgcatggatacg	Protospacer
  **************** ****    .*.

1568. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 9, identity: 0.7

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
atgccgcccgccccggcgagcatggtatga	Protospacer
..******** ************  ..  *

1569. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP012664 (Defluviimonas alba strain cai42 plasmid pcai42C, complete sequence) position: , mismatch: 9, identity: 0.7

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
atctgacccggcccggcgatcatcccggcc	Protospacer
.. . .************* ***.*****

1570. spacer 5.7|2855172|30|NZ_CP022577|CRT matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

gcgccgcccggcccggcgagcattccggca	CRISPR spacer
atgccgcccgccccggcgagcatggtatga	Protospacer
..******** ************  ..  *

1571. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to MH338239 (Mycobacterium phage Mryolo, complete genome) position: , mismatch: 9, identity: 0.7

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
tccccgccgccatccgccgcgctggtcgac	Protospacer
 ***********.****** **** ..

1572. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to MK305893 (Mycobacterium phage Beatrix, complete genome) position: , mismatch: 9, identity: 0.7

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
tccccgccgccatccgccgcgctggtcgac	Protospacer
 ***********.****** **** ..

1573. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to MN617845 (Mycobacterium phage BaconJack, complete genome) position: , mismatch: 9, identity: 0.7

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
cccccgccgccatccgccgcgctggtcgac	Protospacer
 ***********.****** **** ..

1574. spacer 5.14|2855499|30|NZ_CP022577|CRT matches to MK359312 (Mycobacterium phage Fushigi, complete genome) position: , mismatch: 9, identity: 0.7

gccccgccgccacccgccgagctgcctccg	CRISPR spacer
tccccgccgccatccgccgcgctggtcgac	Protospacer
 ***********.****** **** ..

1575. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 9, identity: 0.727

ggcgcgcccgagcccgccgcgccggacccgccg	CRISPR spacer
ggcgcgcccgagcccgccgcggcgcttcaagtc	Protospacer
********************* **  .* . .

1576. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP039433 (Rhodococcus sp. SGAir0479 plasmid unnamed) position: , mismatch: 9, identity: 0.727

ggcgcgcccgagcccgccgcgccggacccgccg	CRISPR spacer
cgaacgccccagcccgccgcgccgggcccagaa	Protospacer
 * .***** ***************.***.  .

1577. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.727

ggcgcgcccgagcccgccgcgccggacccgccg	CRISPR spacer
ggcgcgccggagcccgccgcggcgcttcaggtc	Protospacer
******** ************ **  .* * .

1578. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.727

ggcgcgcccgagcccgccgcgccggacccgccg	CRISPR spacer
ggcgcgccggagcccgccgcggcgcttcaggtc	Protospacer
******** ************ **  .* * .

1579. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.727

ggcgcgcccgagcccgccgcgccggacccgccg	CRISPR spacer
ggcgcgccggagcccgccgcggcgcttcaggtc	Protospacer
******** ************ **  .* * .

1580. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.727

ggcgcgcccgagcccgccgcgccggacccgccg	CRISPR spacer
ggcgcgcccgagcctgccgcggcgcttcaggtc	Protospacer
**************.****** **  .* * .

1581. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 9, identity: 0.727

ggcgcgcccgagcccgccgcgccggacccgccg	CRISPR spacer
ggcgcgccggagcccgccgcggcgcttcaggtc	Protospacer
******** ************ **  .* * .

1582. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to NZ_CP014964 (Geobacter anodireducens strain SD-1 plasmid pSD, complete sequence) position: , mismatch: 9, identity: 0.71

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
tccaccaacatttcggcttgccgttcgttcc	Protospacer
    *****. ****************. *.

1583. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to NC_015974 (Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence) position: , mismatch: 9, identity: 0.71

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
cgcctcagcggttcggcttaccgttcgctta	Protospacer
 * ..**.***********.******** .

1584. spacer 6.1|3001221|31|NZ_CP022577|CRISPRCasFinder matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 9, identity: 0.71

gggtccaacggttcggcttgccgttcgcgct	CRISPR spacer
cgcctcagcggttcggcttaccgttcgctta	Protospacer
 * ..**.***********.******** .

1585. spacer 10.5|3358942|36|NZ_CP022577|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 9, identity: 0.75

ggccggcgggcgcggcggcgacgccggt----ttgctctt	CRISPR spacer
agccggcgggcggggcggcgacgccggcggcggggc----	Protospacer
.*********** **************.      **

1586. spacer 10.5|3358942|36|NZ_CP022577|CRT matches to NZ_CP018172 (Mesorhizobium oceanicum strain B7 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.75

ggccggcgggcgcggcggcgacgccggtttgctctt---	CRISPR spacer
aaccggcgaccgcggcggcgacgccggt---ccctgaag	Protospacer
..******. ******************   *.**

1587. spacer 10.5|3358942|36|NZ_CP022577|CRT matches to NZ_CP024313 (Rhizobium sp. NXC24 plasmid pRspNXC24b, complete sequence) position: , mismatch: 9, identity: 0.75

ggccggcgggcgcggcggcgacgccggt----ttgctctt	CRISPR spacer
agccggctggcgcggcagcgacgccggcaacactgc----	Protospacer
.****** ********.**********.    .***

1588. spacer 10.10|3359227|33|NZ_CP022577|CRT matches to NZ_LR134445 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.727

cgccgccggctcgggagggtccgggatcaccac	CRISPR spacer
cgccgccggctcgggagcgaccggctgcggcgt	Protospacer
***************** * ****   *. *..

1589. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NC_010509 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
acatggtcgtcgccggcgccagtgccagcgtt	Protospacer
 ... *  ************.***** *****

1590. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgctggtgcatcgctc	Protospacer
. ************* ***.***** *   *.

1591. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggttgccgtcgccggtgcttcgctc	Protospacer
. ********.**** *********.*   *.

1592. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgctggtgcatcgctc	Protospacer
. ************* ***.***** *   *.

1593. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
tgccccgggtcgccggcgccgatgccgatgac	Protospacer
*  ** ***************.**** ..* .

1594. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gcgccggggtcgtcggcgccgttgcgcgccac	Protospacer
 .**********.******** *** .**  .

1595. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NC_023286 (Streptomyces sp. F12 plasmid pFRL6, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gggccggggtcggcggcgccgatgcaggagag	Protospacer
  ********** ********.***  * *

1596. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NC_012852 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132504, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggagtcgccgtcgccggtgcatcgctc	Protospacer
. *****.******* ********* *   *.

1597. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP017300 (Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
ctgtcggggtcgccgccgccggtgatgtccgt	Protospacer
.**.*********** ******** .  *  *

1598. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
ttgccggtgacgccggcgccggtccggaggcg	Protospacer
******* * ************* *  . *.

1599. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgcgggtgcatcactg	Protospacer
. ************* *** ***** *   *

1600. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
cggccggggtcgccgtcgctggtgcatcgctc	Protospacer
. ************* ***.***** *   *.

1601. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to MH632120 (Mycobacterium phage Thonko, complete genome) position: , mismatch: 9, identity: 0.719

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gtgtgccactcggcggcgtcggtgcctgcgtt	Protospacer
 **.   . *** *****.*************

1602. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccgttgccattcccgc	Protospacer
.** ********************. .    *

1603. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccgccattgccgttgccgttcccgc	Protospacer
.** ****** ************** .    *

1604. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcgttgccgttgccgttcccgc	Protospacer
.** ********.************ .    *

1605. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcgttgccgttgccgttcccgc	Protospacer
.** ********.************ .    *

1606. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccattgccgttcccgc	Protospacer
.** **************.****** .    *

1607. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccattgccgttcccgc	Protospacer
.** **************.****** .    *

1608. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgggattgccgttgccattgccgt	Protospacer
.********** ************. .*   .

1609. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgggattgccgttgccattgccgt	Protospacer
.********** ************. .*   .

1610. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgggattgccgttgccattgccgt	Protospacer
.********** ************. .*   .

1611. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgggattgccgttgccattgccgt	Protospacer
.********** ************. .*   .

1612. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgggattgccgttgccattgccgt	Protospacer
.********** ************. .*   .

1613. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP032678 (Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ccagccggcgccattgccgttgccggcgtgat	Protospacer
 . **** ** ***************** . .

1614. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ttggccgccggaattgcctttgccggaccgca	Protospacer
 * ******** ****** *******   .*

1615. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
atttccgccgccattgccgttgccaccagctg	Protospacer
*** ****** *************. *.. .

1616. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagaccgcccgccttgccgttgccggcggcgc	Protospacer
.  .***** ** ***************.  *

1617. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagaccgcccgccttgccgttgccggcggcgc	Protospacer
.  .***** ** ***************.  *

1618. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagaccgcccgccttgccgttgccggcggcgc	Protospacer
.  .***** ** ***************.  *

1619. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagaccgcccgccttgccgttgccggcggcgc	Protospacer
.  .***** ** ***************.  *

1620. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgccgccattgccattgccgccaccat	Protospacer
.********* *******.****** *.   .

1621. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP053022 (Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
cttgccgccggcattggcgatgcccaacacca	Protospacer
 *************** ** **** .  * *

1622. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
accgaggccggcattggcgttgccgacgacag	Protospacer
*..*  ********** ********.***

1623. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to CP003952 (Rhodococcus opacus PD630 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.719

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gccggcttcggcatcgccggtgccggcgaact	Protospacer
...* * .******.**** ***********.

1624. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtgccgccgttgccgccgttgccgccgttgc	Protospacer
  . ****** *********.******* . *

1625. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgaaccgccgttaccgccgtcgccgccgcgtc	Protospacer
    ****** *.***************  .*

1626. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtcgcgccggtgccgccgtcgtggccggaga	Protospacer
  .* *****************. *****

1627. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cggttggccgctgcggccgtcgccgccggctc	Protospacer
   .. **** *** ***************.*

1628. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tgatccgccgttgccgccgtcgcctccgttgc	Protospacer
   .****** ************* *** . *

1629. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gggaccgtcgctgccgccgtcgccgccctcga	Protospacer
*   ***.** ****************  *

1630. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtgccacccgtgccgccgtcgccgcccgaac	Protospacer
  . **.** ***************** *  *

1631. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ccgtccgccagagccgccgtcgccgcccgtgc	Protospacer
 . .*****.* *************** *. *

1632. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtgccgccggtgccgccgccgcggccattgc	Protospacer
* . ***************.*** ***. . *

1633. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP045381 (Labrenzia sp. THAF35 plasmid pTHAF35_a, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgccgccgccgatgg	Protospacer
*.. ****** ********.********..

1634. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1635. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
attgccgccggcgccgccggcgccgccattgc	Protospacer
.*. *******.******* *******. . *

1636. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MT889380 (Mycobacterium phage Coco12, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1637. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MT114167 (Mycobacterium phage Phanphagia, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1638. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agcggcgccggtggcgccgtcgtcgccgcgcg	Protospacer
. *  ******** ********.*****  *

1639. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agcggcgccggtggcgccgtcgtcgccgcgcg	Protospacer
. *  ******** ********.*****  *

1640. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gccctcgctggtgccgccgtcgccgcacaggg	Protospacer
*.**.***.*****************  .

1641. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1642. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1643. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP006989 (Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1644. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP006989 (Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agcgcggccgatgccgccggcgccgccggtga	Protospacer
. * * ****.******** *********.

1645. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013525 (Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1646. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013554 (Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1647. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgcgcggccggtgcctccggcgccgccggaat	Protospacer
  * * ********* *** *********  .

1648. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013588 (Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1649. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013560 (Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1650. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013577 (Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1651. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013549 (Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1652. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1653. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013534 (Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1654. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1655. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013545 (Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1656. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013565 (Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1657. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tacatcgtcggtgccggcgtcgccgccgaggc	Protospacer
  * .**.******** ***********.  *

1658. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1659. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgcgcggccggtgcctccggcgccgccggaat	Protospacer
  * * ********* *** *********  .

1660. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1661. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gaggacgcccatgccgccgtcgccgccgccaa	Protospacer
*    **** .***************** *

1662. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1663. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1664. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013571 (Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1665. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP021126 (Rhizobium sp. Kim5 plasmid pRetKim5b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caacgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1666. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1667. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1668. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to CP007642 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caacgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1669. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to CP007642 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agcgcggccgatgccgccggcgccgccggtga	Protospacer
. * * ****.******** *********.

1670. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_010998 (Rhizobium etli CIAT 652 plasmid pA, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cagcgcaatggcgccgccgtcgccgccggtcc	Protospacer
   * *. .**.*****************.**

1671. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gggtccgccgttgccaccgtcgccgccacctg	Protospacer
*  .****** ****.***********. *.

1672. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
ggtgacgccggtgccgccgccgctgccggaga	Protospacer
* .  **************.***.*****

1673. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MN428047 (Mycobacterium phage Doomphist, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1674. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MK305886 (Mycobacterium phage Poenanya, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1675. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to JN859129 (Mycobacterium virus DotProduct, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1676. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgccccccaggtgccgccgtcgccgaccctgc	Protospacer
  **** * **************** *  . *

1677. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
agctgcgccggtttcgccgtcgccgccgccgt	Protospacer
. *. ******* .************** * .

1678. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_015184 (Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgcaaggccggtcccgccttcgccgccggctg	Protospacer
  *   ****** ***** ***********.

1679. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tctggcgccggtgtcgtcgtcgccgccggact	Protospacer
 ..  ********.**.************ *.

1680. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP019631 (Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgccgccgccgatgg	Protospacer
*.. ****** ********.********..

1681. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP019631 (Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
gctgccgccgttgccgccgccgccgccaacag	Protospacer
*.. ****** ********.*******..*

1682. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_AP022334 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
aatttcgccggggccgccgccgccgccggtct	Protospacer
. ...****** *******.*********.*.

1683. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_001759 (Streptomyces phaeochromogenes plasmid pJV1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tgggccgccggtaccgccgtggccgccgtcgg	Protospacer
    ********.******* ******* *

1684. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
aacaccgccgtcgccgccgtcgccgccgagat	Protospacer
. * ****** .****************.  .

1685. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tccattgccggtgccgcccgcgccgccggatc	Protospacer
 .* ..************  ********* .*

1686. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MH051248 (Mycobacterium phage BigPhil, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1687. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MF668281 (Mycobacterium phage RitaG, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1688. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MN369749 (Mycobacterium phage MinionDave, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1689. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MT684597 (Mycobacterium phage Mandlovu, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1690. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to KY012363 (Mycobacterium phage Empress, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1691. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MN585973 (Mycobacterium phage StAnnes, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1692. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MH077578 (Mycobacterium phage DillTech15, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1693. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MH020235 (Mycobacterium phage Batiatus, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1694. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to KY471267 (Mycobacterium phage SassyB, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1695. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MG872841 (Mycobacterium phage Priscilla, complete genome) position: , mismatch: 9, identity: 0.719

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tttgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 *.  **.****************** **  .

1696. spacer 13.5|4173747|32|NZ_CP022577|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 9, identity: 0.719

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
ctcggtgccggtgccgccgaggccggcgaaga	Protospacer
 *.* .  ************..*********

1697. spacer 13.5|4173747|32|NZ_CP022577|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.719

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
ctcggtgccggtgccgccgaggccggcgaaga	Protospacer
 *.* .  ************..*********

1698. spacer 13.5|4173747|32|NZ_CP022577|CRT matches to NZ_CP040820 (Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence) position: , mismatch: 9, identity: 0.719

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
cagggctgcggtggcgccgagaccggcgcaaa	Protospacer
   * ******** ******.******* *.

1699. spacer 13.5|4173747|32|NZ_CP022577|CRT matches to NZ_CP015221 (Rhodococcus sp. PBTS 2 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

attgcctgcggtgccgccgaaaccggcgaagc	CRISPR spacer
tccgcctgcggtgccggcgataccggtggtga	Protospacer
 ..************* *** *****.*. *

1700. spacer 13.6|4173801|32|NZ_CP022577|CRT matches to NZ_CP013071 (Sphingobium indicum B90A plasmid pSRL1, complete sequence) position: , mismatch: 9, identity: 0.719

atcgccaccagccgcgccaaccgagccgaccc	CRISPR spacer
tccgccagcagccgcgccaacccagcgccttc	Protospacer
 .***** ************** ***   ..*

1701. spacer 13.6|4173801|32|NZ_CP022577|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 9, identity: 0.719

atcgccaccagccgcgccaaccgagccgaccc	CRISPR spacer
tgggaaaccagccgcggcaaccgcgccgatct	Protospacer
   *  ********** ****** *****.*.

1702. spacer 13.6|4173801|32|NZ_CP022577|CRT matches to NZ_CP021819 (Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.719

atcgccaccagccgcgccaaccgagccgaccc	CRISPR spacer
gcaggcaacaggcgcgccaaccgagccgcagc	Protospacer
.. * ** *** ****************   *

1703. spacer 15.4|4303843|33|NZ_CP022577|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

ccggcgatgttggccccgccggccccgccgttg	CRISPR spacer
gcgatgatgatcgccccgccggccccgcccgcc	Protospacer
 **..**** * *****************  .

1704. spacer 15.18|4304716|36|NZ_CP022577|CRT matches to NC_031262 (Mycobacterium phage Brocalys, complete genome) position: , mismatch: 9, identity: 0.75

tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
ccaggaaacccgccgttgccgccggtgccgccggtg	Protospacer
.  .*  *****************. ********.*

1705. spacer 15.18|4304716|36|NZ_CP022577|CRT matches to NC_004683 (Mycobacterium phage Che9c, complete genome) position: , mismatch: 9, identity: 0.75

tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
ccaggaaacccgccgttgccgccggtgccgccggtg	Protospacer
.  .*  *****************. ********.*

1706. spacer 15.18|4304716|36|NZ_CP022577|CRT matches to AY129333 (Mycobacterium virus Che9c, complete genome) position: , mismatch: 9, identity: 0.75

tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
ccaggaaacccgccgttgccgccggtgccgccggtg	Protospacer
.  .*  *****************. ********.*

1707. spacer 15.18|4304716|36|NZ_CP022577|CRT matches to MN234184 (Mycobacterium phage IdentityCrisis, complete genome) position: , mismatch: 9, identity: 0.75

tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
ccagggaacccgccgttgccgccggtgccgccggtg	Protospacer
.  .*  *****************. ********.*

1708. spacer 15.18|4304716|36|NZ_CP022577|CRT matches to KM083128 (Mycobacterium phage Sparky, complete genome) position: , mismatch: 9, identity: 0.75

tacagccacccgccgttgccgccgaggccgccggcg	CRISPR spacer
ccaggaaacccgccgttgccgccggtgccgccggtg	Protospacer
.  .*  *****************. ********.*

1709. spacer 15.18|4304716|36|NZ_CP022577|CRT matches to MT889380 (Mycobacterium phage Coco12, complete genome) position: , mismatch: 9, identity: 0.75

tacagccac--ccgccgttgccgccgaggccgccggcg	CRISPR spacer
--gggctgctgccgccgttgccgccgttgccgccggca	Protospacer
   .**..*  ***************  *********.

1710. spacer 15.18|4304716|36|NZ_CP022577|CRT matches to MT114167 (Mycobacterium phage Phanphagia, complete genome) position: , mismatch: 9, identity: 0.75

tacagccac--ccgccgttgccgccgaggccgccggcg	CRISPR spacer
--gggctgctgccgccgttgccgccgttgccgccggca	Protospacer
   .**..*  ***************  *********.

1711. spacer 1.7|576139|35|NZ_CP022577|CRT,PILER-CR,CRISPRCasFinder matches to NZ_AP022607 (Mycobacterium branderi strain JCM 12687 plasmid pJCM12687) position: , mismatch: 10, identity: 0.714

gccccgtggatggcggatgcgttgtgcgcgcaagt	CRISPR spacer
accgtgtggatggcgaatgtgttgtgcgcggtgac	Protospacer
.** .**********.***.**********  ...

1712. spacer 5.16|2855583|33|NZ_CP022577|CRT matches to NZ_CP017756 (Cupriavidus malaysiensis strain USMAA1020 isolate pure plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.697

ggcgcgcccgagcccgccgcgccggacccgccg	CRISPR spacer
cataagttagaccccgccgcgctggacccgccg	Protospacer
 ... *.. ** **********.**********

1713. spacer 10.5|3358942|36|NZ_CP022577|CRT matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.722

ggccggcgggcgcggcggcgacgccggtttgctctt	CRISPR spacer
ggccggcgagcgcggcggggacgccgatgccatgaa	Protospacer
********.********* *******.* .  *

1714. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_KU140623 (Sinorhizobium sp. M14 plasmid pSinB, complete sequence) position: , mismatch: 10, identity: 0.688

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gacgcaaggtcgccggcctcggtgcctgcgag	Protospacer
    *..********** .***********

1715. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 10, identity: 0.688

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gggccgcggtcgccggtgccggtgcgggttcc	Protospacer
  **** *********.********  *. ..

1716. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP048631 (Ancylobacter pratisalsi strain DSM 102029 plasmid pLGM, complete sequence) position: , mismatch: 10, identity: 0.688

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
ccgccgggggcgccggcgccggcgcgtcaagc	Protospacer
..******* ************.** *  . .

1717. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccgttaccattcccgc	Protospacer
.** *****************.**. .    *

1718. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttcccgccggcattgccattgccattcccgc	Protospacer
.** **************.*****. .    *

1719. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gatctcgccggcattgccgttggcgccgcgat	Protospacer
. * .***************** ** ** . .

1720. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gatctcgccggcattgccgttggcgccgcgat	Protospacer
. * .***************** ** ** . .

1721. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013525 (Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1722. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013554 (Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1723. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013560 (Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1724. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013577 (Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1725. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013549 (Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1726. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013534 (Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1727. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013545 (Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1728. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013565 (Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1729. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013571 (Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1730. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NC_010998 (Rhizobium etli CIAT 652 plasmid pA, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1731. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013588 (Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1732. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1733. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1734. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP024200 (Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
cttgccgccgccattgcctttgccaacagggt	Protospacer
 ********* ******* *****..*... .

1735. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1736. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013523 (Rhizobium phaseoli strain R744 plasmid pRphaR744a, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgctgggattgccgttgccattgccgt	Protospacer
.*******.** ************. .*   .

1737. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1738. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
cggtccgccggcattgtcgtcgccggccaggg	Protospacer
    ************.***.****** *.

1739. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgctgggattgccgttgccattgccgt	Protospacer
.*******.** ************. .*   .

1740. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggagaagccgagattgccgttgccggcgacga	Protospacer
.  *  ****. *****************

1741. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgctgggattgccgttgccattgccgt	Protospacer
.*******.** ************. .*   .

1742. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gttgccgctgggattgccgttgccattgccgt	Protospacer
.*******.** ************. .*   .

1743. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to KU935731 (Mycobacterium phage Phrann, complete genome) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagcgcgccggtattgccgttgccgccgcgac	Protospacer
.    ******.************* ** . *

1744. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to MK224497 (Mycobacterium phage Henu3, complete genome) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagcgcgccggtattgccgttgccgccgcgac	Protospacer
.    ******.************* ** . *

1745. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to MT498061 (Mycobacterium phage Jung, complete genome) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagcacgccggtattgccgttgccgccgcgac	Protospacer
.    ******.************* ** . *

1746. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to MH230879 (Mycobacterium phage Xavia, complete genome) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagcgcgccggtattgccgttgccgccgcgac	Protospacer
.    ******.************* ** . *

1747. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to MN585977 (Mycobacterium phage Atcoo, complete genome) position: , mismatch: 10, identity: 0.688

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
gagcgcgccggtattgccgttgccgccgcgac	Protospacer
.    ******.************* ** . *

1748. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgagccgccggagccgccgccgccgccgatgg	Protospacer
    ******* *******.********..

1749. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtaccgccggtgccgccgctgccgccatagc	Protospacer
  . ***************..******.   *

1750. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP034352 (Streptomyces sp. W1SF4 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgtcggtggcgccgtcgccgccctggc	Protospacer
    ***.***** *************    *

1751. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cctgccgcccgcgccgccgtcgccgccaggaa	Protospacer
 .. ***** *.***************.*

1752. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
catcccgccggcgccgccatcgccgcctatgg	Protospacer
  .********.******.******** ..

1753. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP009112 (Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgtgacgccggtgccgacgtcgccgtcgccgg	Protospacer
  .  *********** ********.** *

1754. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to MG812488 (Mycobacterium phage Frankie, complete genome) position: , mismatch: 10, identity: 0.688

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
tctgacgtcggtgccgccgtcgccgcaggagt	Protospacer
 ..  **.****************** **  .

1755. spacer 15.5|4303897|36|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.722

tacagctgaccaccggccccgccggcgccgccgttc	CRISPR spacer
aagcctcggccaccggcgccgcctgcgccgccgttg	Protospacer
 *   ..*.******** ***** ***********

1756. spacer 15.5|4303897|36|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.722

tacagctgaccaccggccccgccggcgccgccgttc	CRISPR spacer
gcccctcggccgccggccccgccggccccgccgttg	Protospacer
  *  ..*.**.************** ********

1757. spacer 10.8|3359092|42|NZ_CP022577|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 11, identity: 0.738

gttcaacgcagccggcgggaacggcgggaacggcgg-actgtt	CRISPR spacer
caccggcgcagccggaggcaacggcgggaacggcggcagcgc-	Protospacer
  .*..********* ** ***************** * .*.

1758. spacer 12.13|4154579|32|NZ_CP022577|CRT matches to NZ_CP015743 (Shinella sp. HZN7 plasmid pShin-07, complete sequence) position: , mismatch: 11, identity: 0.656

ttgccggggtcgccggcgccggtgcctgcgtt	CRISPR spacer
gcgccgtggtcgccggcgccgatgcggaaacc	Protospacer
 .**** **************.***  . ...

1759. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 11, identity: 0.656

attgccgccggcattgccgttgccggcgaacc	CRISPR spacer
ggaaaagccgagattgccgttgccggcgacga	Protospacer
.  .  ****. *****************

1760. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 11, identity: 0.656

gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
aaagccgccgttgccgccgccgccgcccagtg	Protospacer
.   ****** ********.******* . .

1761. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1762. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1763. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1764. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1765. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1766. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1767. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1768. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1769. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1770. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1771. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1772. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1773. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1774. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1775. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1776. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1777. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.656

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
caggccgcccgtgccgccgccgccgccgccgg---	Protospacer
   *.* **  .* .*******.*********

1778. spacer 13.2|4173567|32|NZ_CP022577|CRT matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 12, identity: 0.625

attgccgccggcattgccgttgccggcgaacc-	CRISPR spacer
accagcg-cggcatcggcattgccggcggcaat	Protospacer
*... ** ******.* *.*********.

1779. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.594

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
---ctagccgccgctgccgccgtggccgccctcga	Protospacer
   *. **** .**.****.**. **** **.

1780. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 13, identity: 0.594

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
---ctggccgccgctgccgccgtggccgccctcga	Protospacer
   *. **** .**.****.**. **** **.

1781. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.594

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
---ctagccgccgctgccgccgtggccgccctcga	Protospacer
   *. **** .**.****.**. **** **.

1782. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.594

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
---ctggccgccgctgccgccgtggccgccctcga	Protospacer
   *. **** .**.****.**. **** **.

1783. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to CP000662 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence) position: , mismatch: 13, identity: 0.594

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cgagccgccgttgccgccgtcgcccccgtcgg---	Protospacer
   *.* ***..* .****.**.* ***.***

1784. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.594

gtccccgccggtgccgccgtcgccgccggccc---	CRISPR spacer
---ctagccgccgctgccgccgtggccgccctcga	Protospacer
   *. **** .**.****.**. **** **.

1785. spacer 13.4|4173693|32|NZ_CP022577|CRT matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 13, identity: 0.594

---gtccccgccggtgccgccgtcgccgccggccc	CRISPR spacer
cggggcgccgtcgccgccgtcgccgccgggga---	Protospacer
   * * ***.** .****.**.*****  *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

574360 : 614722

Burkholderia_virus(40.0%)

tRNA,transposase,integrase

attL 574319:574378|attR 614706:616060

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
574319:574378	attL	NA	NA	NA	NA
WP_087902221.1\|574360_575622_-\|transposase	IS3-like element IS987 family transposase	Q8W6R2	Burkholderia_virus	9.6e-83	59.1
WP_003899491.1\|576949_577762_-	ExeA family protein	NA	NA	NA	NA
WP_003414198.1\|577758_579168_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_003414195.1\|579238_579847_-	hypothetical protein	NA	NA	NA	NA
WP_003414190.1\|580266_580578_-	hypothetical protein	NA	NA	NA	NA
WP_003899489.1\|580682_580940_-	hypothetical protein	NA	NA	NA	NA
WP_003899488.1\|581173_582328_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_003414184.1\|582526_582718_-	hypothetical protein	NA	NA	NA	NA
WP_003414181.1\|582714_583119_-	hypothetical protein	NA	NA	NA	NA
WP_003917684.1\|583266_583521_+	hypothetical protein	NA	NA	NA	NA
WP_003911993.1\|583696_583972_-	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_003414172.1\|584162_585206_+	DUF2293 domain-containing protein	NA	NA	NA	NA
WP_003901465.1\|585248_585479_+	antitoxin MazE	NA	NA	NA	NA
WP_003414166.1\|585462_585819_+	type II toxin-antitoxin system toxin endoribonuclease MazF9	NA	NA	NA	NA
WP_003899485.1\|585920_587570_-	CocE/NonD family hydrolase	NA	NA	NA	NA
WP_003414158.1\|587588_588218_-	DUF3558 family protein	NA	NA	NA	NA
WP_003414157.1\|588348_588675_+	hypothetical protein	NA	NA	NA	NA
WP_003414155.1\|588678_590367_+	hypothetical protein	NA	NA	NA	NA
WP_003900574.1\|590366_590930_+	hypothetical protein	NA	NA	NA	NA
WP_003414151.1\|591074_592049_+	metallophosphoesterase	NA	NA	NA	NA
WP_003414149.1\|592045_592729_+	4'-phosphopantetheinyl transferase	NA	NA	NA	NA
WP_003414147.1\|592725_593622_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003414146.1\|593823_594405_+\|transposase	IS607-like element IS1602 family transposase	F9VHY9	Thermus_phage	5.0e-18	30.6
WP_003899482.1\|594404_595784_+\|transposase	transposase	A0A7P9	Microcystis_virus	9.3e-31	30.3
WP_003414142.1\|595816_597022_+	lipid-transfer protein	NA	NA	NA	NA
WP_003414139.1\|597047_598280_+	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_003414136.1\|598340_599027_-	manganese-binding transcriptional regulator MntR	NA	NA	NA	NA
WP_003414134.1\|599111_600875_-	AAA family ATPase	NA	NA	NA	NA
WP_003414131.1\|601085_602081_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_003414128.1\|602237_602507_+	30S ribosomal protein S15	NA	NA	NA	NA
WP_003899480.1\|602519_603035_+	hypothetical protein	NA	NA	NA	NA
WP_003414124.1\|603388_605647_+	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_003414119.1\|605624_606941_+	insulinase family protein	J3IZ03	Acanthamoeba_polyphaga_lentillevirus	5.4e-28	24.4
WP_003899478.1\|607001_608036_+	nitronate monooxygenase	NA	NA	NA	NA
WP_106420768.1\|608050_609166_-	alanine dehydrogenase	NA	NA	NA	NA
WP_003899476.1\|609231_609771_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_003899475.1\|609802_610273_+	SRPBCC family protein	NA	NA	NA	NA
WP_003414107.1\|610430_611501_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_003414104.1\|611682_612612_+	oxidoreductase	NA	NA	NA	NA
WP_003414102.1\|612615_613077_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_087902221.1\|613461_614722_+\|transposase	IS3-like element IS987 family transposase	Q8W6R2	Burkholderia_virus	9.6e-83	59.1
614706:616060	attR	NA	NA	NA	NA

DBSCAN-SWA_2

712930 : 725676

Mycobacterium_phage(57.14%)

terminase,capsid,head,protease,integrase

attL 716587:716614|attR 726211:726238

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003413845.1\|712930_713689_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A249XSS8	Mycobacterium_phage	4.7e-16	40.8
WP_003899423.1\|714604_714886_-	hypothetical protein	NA	NA	NA	NA
WP_003413719.1\|715233_715488_-	hypothetical protein	NA	NA	NA	NA
WP_003413717.1\|715498_715732_-	hypothetical protein	NA	NA	NA	NA
WP_003900544.1\|715830_716103_-	hypothetical protein	NA	NA	NA	NA
WP_003899422.1\|716008_716398_+	hypothetical protein	NA	NA	NA	NA
WP_003899421.1\|716394_716622_+	hypothetical protein	NA	NA	NA	NA
716587:716614	attL	NA	NA	NA	NA
WP_003899420.1\|716766_717894_+\|integrase	site-specific integrase	A0A1X9SFC1	Mycobacterium_phage	1.5e-66	40.4
WP_003900543.1\|717896_718259_+	hypothetical protein	NA	NA	NA	NA
WP_003899418.1\|718275_718536_+	helix-turn-helix domain-containing protein	A0A2P1CHK7	Mycobacterium_phage	3.0e-15	64.6
WP_003899417.1\|718532_718925_+	DUF2742 domain-containing protein	NA	NA	NA	NA
WP_003899416.1\|718926_720354_+	DUF3631 domain-containing protein	NA	NA	NA	NA
WP_003899415.1\|720350_720596_+	type II toxin-antitoxin system antitoxin	NA	NA	NA	NA
WP_003899414.1\|720675_720999_+	type II toxin-antitoxin system toxin	NA	NA	NA	NA
WP_003899413.1\|721030_721657_+\|terminase	phage terminase small subunit P27 family	V9H0V4	Actinophage	1.6e-17	47.2
WP_003899412.1\|721809_722343_+\|head,protease	HK97 family phage prohead protease	A0A2H4JB68	uncultured_Caudovirales_phage	3.1e-06	32.9
WP_003901443.1\|722350_723790_+\|capsid	phage major capsid protein	A0A1B3AYS4	Gordonia_phage	1.4e-66	40.6
WP_003908028.1\|723960_724212_-	hypothetical protein	NA	NA	NA	NA
WP_003900539.1\|724199_724664_-	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_003900538.1\|724677_725676_-\|integrase	tyrosine-type recombinase/integrase	A0A2D1G8E2	Mycobacterium_phage	7.4e-62	47.8
726211:726238	attR	NA	NA	NA	NA

DBSCAN-SWA_3

4309124 : 4393742

Pandoravirus(33.33%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087902221.1\|4309124_4310386_-\|transposase	IS3-like element IS987 family transposase	Q8W6R2	Burkholderia_virus	9.6e-83	59.1
WP_003417912.1\|4310827_4311817_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_003918607.1\|4311813_4313652_+	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_003417908.1\|4313660_4314551_+	diterpene synthase	NA	NA	NA	NA
WP_003417905.1\|4314555_4316061_+	type B diterpene cyclase	NA	NA	NA	NA
WP_003417903.1\|4316099_4316753_-	HAD family phosphatase	NA	NA	NA	NA
WP_003417900.1\|4316860_4318288_-	amidase	NA	NA	NA	NA
WP_003417897.1\|4318292_4318541_-	enoyl-CoA hydratase	NA	NA	NA	NA
WP_003900037.1\|4318541_4319183_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_003417895.1\|4319261_4319366_-	PE family protein	NA	NA	NA	NA
WP_003417892.1\|4319419_4320595_-	trehalose-phosphatase	NA	NA	NA	NA
WP_003900036.1\|4320636_4321977_-	diacyglycerol O-acyltransferase	NA	NA	NA	NA
WP_003908228.1\|4322168_4325408_+	error-prone DNA polymerase DnaE2	A0A1C9LWS4	Streptomyces_phage	1.6e-118	32.4
WP_003417882.1\|4325496_4325931_-	TIGR03667 family PPOX class F420-dependent oxidoreductase	NA	NA	NA	NA
WP_003417881.1\|4325929_4326574_+	nitroreductase family protein	NA	NA	NA	NA
WP_009938654.1\|4326574_4328350_-	PE family protein	NA	NA	NA	NA
WP_003901617.1\|4328716_4329181_-\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_003901616.1\|4329416_4332047_+	sensor histidine kinase	NA	NA	NA	NA
WP_003417776.1\|4332043_4332436_+	roadblock/LC7 domain-containing protein	NA	NA	NA	NA
WP_003417772.1\|4332413_4332782_+	DUF742 domain-containing protein	NA	NA	NA	NA
WP_003417769.1\|4332762_4333344_+	ATP/GTP-binding protein	NA	NA	NA	NA
WP_003417767.1\|4333350_4333902_+	pentapeptide repeat protein MfpA	NA	NA	NA	NA
WP_003417765.1\|4333898_4334267_-	FHA domain-containing protein	NA	NA	NA	NA
WP_003900033.1\|4334383_4335574_-	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_003417760.1\|4335615_4335873_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_003417757.1\|4335869_4336145_-	type II toxin-antitoxin system antitoxin RelJ	NA	NA	NA	NA
WP_003417751.1\|4336268_4337114_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	NA	NA	NA	NA
WP_003417749.1\|4337110_4337404_+	DUF3017 domain-containing protein	NA	NA	NA	NA
WP_003417745.1\|4337417_4337807_-	DUF732 domain-containing protein	NA	NA	NA	NA
WP_003417741.1\|4337921_4338182_+	hypothetical protein	NA	NA	NA	NA
WP_157132559.1\|4338208_4338427_+	hypothetical protein	NA	NA	NA	NA
WP_003417739.1\|4338324_4338696_+	FAD-binding oxidoreductase	A0A0B5JBT9	Pandoravirus	3.3e-15	56.4
WP_003417738.1\|4338777_4339572_+	BBE domain-containing protein	NA	NA	NA	NA
WP_009938650.1\|4351301_4351589_+	hypothetical protein	NA	NA	NA	NA
WP_003911006.1\|4351883_4352624_+\|transposase	transposase	NA	NA	NA	NA
WP_049961743.1\|4352660_4353107_-\|transposase	transposase	NA	NA	NA	NA
WP_003901612.1\|4353732_4363206_+	PPE family protein	NA	NA	NA	NA
WP_003417619.1\|4363461_4363719_+	DUF3017 domain-containing protein	NA	NA	NA	NA
WP_031654342.1\|4369107_4370088_+	hypothetical protein	NA	NA	NA	NA
WP_003417461.1\|4376135_4376867_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003417458.1\|4376863_4378003_-	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_003900028.1\|4378014_4379364_-	bifunctional o-acetylhomoserine/o-acetylserine sulfhydrylase	A0A0B5JD48	Pandoravirus	2.5e-12	26.5
WP_003417452.1\|4379646_4380876_+	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_003905041.1\|4380942_4381587_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_003417440.1\|4381859_4382870_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003417435.1\|4382890_4383760_+	inner membrane protein YhjD	NA	NA	NA	NA
WP_003900026.1\|4383793_4384234_-	heavy metal-responsive transcriptional regulator	NA	NA	NA	NA
WP_003417421.1\|4384708_4385554_+\|protease	PDZ-interacting protease regulator Ppr1	NA	NA	NA	NA
WP_003417418.1\|4385744_4386896_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_003417416.1\|4386892_4388401_-	sugar porter family MFS transporter	NA	NA	NA	NA
WP_003417415.1\|4388496_4389714_-	D-alanyl-D-alanine carboxypeptidase DacB1	A0A1P8VVG5	Erythrobacter_phage	8.0e-10	27.3
WP_003902446.1\|4389782_4391150_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	9.0e-18	25.8
WP_003417413.1\|4391158_4392097_+	sigma-70 family RNA polymerase sigma factor SigJ	NA	NA	NA	NA
WP_003902445.1\|4392029_4393559_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_009937401.1\|4393580_4393742_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022577

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection