CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP020018	Pediococcus pentosaceus strain KCCM 40703 chromosome, complete genome	2 crisprs	DinG,cas3,csa3,DEDDh	0	0	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020018_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020018_1

1004761-1004873

Orphan

Consensus_repeat	Method
GTATGACTTCCTGAATCTAACTGTTGAAC	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP020018_1

>merge|NZ_CP020018|1|1004761-1004873|CRISPRCasFinder
GTATGACTTCCTGAATCTAACTGTTGAACACCGCTAATTAAGGTTCCTGTACTTCCATTTAGAGTTTGAAGTCCGCTATTCAATGTATGACTTCCTGAATCTAATTGTTGAAC

>NZ_CP020018|1|1|1004761-1004873|CRISPRCasFinder
GTATGACTTCCTGAATCTAACTGTTGAAC	ACCGCTAATTAAGGTTCCTGTACTTCCATTTAGAGTTTGAAGTCCGCTATTCAAT
GTATGACTTCCTGAATCTAATTGTTGAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020018.1\|WP_105765969.1\|995150_996131_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NZ_CP020018.1\|WP_105765970.1\|999888_1001271_-\|glycoside-hydrolase-family-1-protein	unknown	unknown	gnl\|CDD\|225343
NZ_CP020018.1\|WP_099299463.1\|1015415_1016618_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP020018.1\|WP_055126517.1\|1003092_1003728_-\|DUF4767-domain-containing-protein	unknown	unknown	gnl\|CDD\|374270
NZ_CP020018.1\|WP_094104215.1\|1013804_1014641_+\|manganese-catalase	unknown	unknown	gnl\|CDD\|252986
NZ_CP020018.1\|WP_099299470.1\|1001430_1002144_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP020018.1\|WP_099299466.1\|1008265_1009129_-\|DegV-family-protein	unknown	unknown	gnl\|CDD\|273257
NZ_CP020018.1\|WP_002834268.1\|1014693_1015419_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|376350
NZ_CP020018.1\|WP_002834264.1\|1012538_1013651_-\|low-temperature-requirement-protein-A	unknown	unknown	gnl\|CDD\|377704
NZ_CP020018.1\|WP_011673888.1\|1018781_1020032_-\|PDZ-domain-containing-protein	unknown	unknown	gnl\|CDD\|273938
NZ_CP020018.1\|WP_099299469.1\|1002179_1002833_-\|nitroreductase	unknown	unknown	gnl\|CDD\|380313
NZ_CP020018.1\|WP_105765968.1\|992444_993851_-\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235798
NZ_CP020018.1\|WP_099299465.1\|1010590_1012396_-\|DUF2207-domain-containing-protein	unknown	unknown	gnl\|CDD\|378333
NZ_CP020018.1\|WP_036673200.1\|997263_998250_-\|lipoate--protein-ligase	unknown	unknown	gnl\|CDD\|161920
NZ_CP020018.1\|WP_060743524.1\|998530_999874_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|224372
NZ_CP020018.1\|WP_049752783.1\|1007742_1008246_-\|DUF1836-domain-containing-protein	unknown	unknown	gnl\|CDD\|378076
NZ_CP020018.1\|WP_011673877.1\|1007330_1007651_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP020018.1\|WP_099299473.1\|993853_995158_-\|2-oxo-acid-dehydrogenase-subunit-E2	unknown	unknown	gnl\|CDD\|237001
NZ_CP020018.1\|WP_061812202.1\|1009331_1010171_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|236841
NZ_CP020018.1\|WP_002834186.1\|996133_997252_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|213783

Protein	Function_ID	Function_description	E-value
NZ_CP020018.1\|WP_105765969.1\|995150_996131_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	1.24335e-176
NZ_CP020018.1\|WP_105765970.1\|999888_1001271_-\|glycoside-hydrolase-family-1-protein	gnl\|CDD\|225343	COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].	3.21072e-173
NZ_CP020018.1\|WP_099299463.1\|1015415_1016618_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.02783e-49
NZ_CP020018.1\|WP_055126517.1\|1003092_1003728_-\|DUF4767-domain-containing-protein	gnl\|CDD\|374270	pfam15983, DUF4767, Domain of unknown function (DUF4767). This domain family is found in bacteria, and is approximately 140 amino acids in length. There is a single completely conserved residue Q that may be functionally important.	1.39371e-47
NZ_CP020018.1\|WP_094104215.1\|1013804_1014641_+\|manganese-catalase	gnl\|CDD\|252986	pfam05067, Mn_catalase, Manganese containing catalase. Catalases are important antioxidant metalloenzymes that catalyze disproportionation of hydrogen peroxide, forming dioxygen and water. Two families of catalases are known, one having a heme cofactor, and this family that is a structurally distinct family containing non-heme manganese.	1.34329e-119
NZ_CP020018.1\|WP_099299470.1\|1001430_1002144_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	2.64281e-55
NZ_CP020018.1\|WP_099299466.1\|1008265_1009129_-\|DegV-family-protein	gnl\|CDD\|273257	TIGR00762, DegV, EDD domain protein, DegV family. This family of proteins is related to DegV of Bacillus subtilis and includes paralogous sets in several species (B. subtilis, Deinococcus radiodurans, Mycoplasma pneumoniae) that are closer in percent identity to each than to most homologs from other species. This suggests both recent paralogy and diversity of function. DegV itself is encoded immediately downstream of DegU, a transcriptional regulator of degradation, but is itself uncharacterized. Crystallography suggested a lipid-binding site, while comparison of the crystal structure to dihydroxyacetone kinase and to a mannose transporter EIIA domain suggests a conserved domain, EDD, with phosphotransferase activity. [Unknown function, General].	1.74126e-94
NZ_CP020018.1\|WP_002834268.1\|1014693_1015419_-\|EAL-domain-containing-protein	gnl\|CDD\|376350	pfam00563, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues. The EAL domain is a good candidate for a diguanylate phosphodiesterase function. The domain contains many conserved acidic residues that could participate in metal binding and might form the phosphodiesterase active site.	3.15771e-22
NZ_CP020018.1\|WP_002834264.1\|1012538_1013651_-\|low-temperature-requirement-protein-A	gnl\|CDD\|377704	pfam06772, LtrA, Bacterial low temperature requirement A protein (LtrA). This family consists of several bacteria specific low temperature requirement A (LtrA) protein sequences which have been found to be essential for growth at low temperatures in Listeria monocytogenes.	1.87144e-45
NZ_CP020018.1\|WP_011673888.1\|1018781_1020032_-\|PDZ-domain-containing-protein	gnl\|CDD\|273938	TIGR02037, Probable_periplasmic_serine_protease_do/HhoA-like, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides].	3.64249e-82
NZ_CP020018.1\|WP_099299469.1\|1002179_1002833_-\|nitroreductase	gnl\|CDD\|380313	cd02136, PnbA_NfnB-like, nitroreductase similar to Mycobacterium smegmatis NfnB. Members of this family utilize FMN as a cofactor and catalyze reduction of a variety of nitroaromatic compounds, including nitrofurans, nitrobenzens, nitrophenol, nitrobenzoate and quinones by using either NADH or NADPH as a source of reducing equivalents in an obligatory two-election transfer mechanism. The enzyme is typically a homodimer. Mycobacterium smegmatis nitroreductase NfnB plays a role in resistance to benzothiazinone.	1.18377e-39
NZ_CP020018.1\|WP_105765968.1\|992444_993851_-\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235798	PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed.	0
NZ_CP020018.1\|WP_099299465.1\|1010590_1012396_-\|DUF2207-domain-containing-protein	gnl\|CDD\|378333	pfam09972, DUF2207, Predicted membrane protein (DUF2207). This domain, found in various hypothetical bacterial proteins, has no known function.	1.10703e-115
NZ_CP020018.1\|WP_036673200.1\|997263_998250_-\|lipoate--protein-ligase	gnl\|CDD\|161920	TIGR00545, Probable_lipoate-protein_ligase_A, lipoyltransferase and lipoate-protein ligase. One member of this group of proteins is bovine lipoyltransferase, which transfers the lipoyl group from lipoyl-AMP to the specific Lys of lipoate-dependent enzymes. However, it does not first activate lipoic acid with ATP to create lipoyl-AMP and pyrophosphate. Another member of this group, lipoate-protein ligase A from E. coli, catalyzes both the activation and the transfer of lipoate. Homology between the two is full-length, except for the bovine mitochondrial targeting signal, but is strongest toward the N-terminus. [Protein fate, Protein modification and repair].	7.17989e-88
NZ_CP020018.1\|WP_060743524.1\|998530_999874_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|224372	COG1455, CelB, Phosphotransferase system cellobiose-specific component IIC [Carbohydrate transport and metabolism].	3.60599e-117
NZ_CP020018.1\|WP_049752783.1\|1007742_1008246_-\|DUF1836-domain-containing-protein	gnl\|CDD\|378076	pfam08876, DUF1836, Domain of unknown function (DUF1836). This family of proteins are functionally uncharacterized.	9.77839e-38
NZ_CP020018.1\|WP_011673877.1\|1007330_1007651_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	8.63436e-15
NZ_CP020018.1\|WP_099299473.1\|993853_995158_-\|2-oxo-acid-dehydrogenase-subunit-E2	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	1.85901e-160
NZ_CP020018.1\|WP_061812202.1\|1009331_1010171_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|236841	PRK11088, rrmA, 23S rRNA methyltransferase A; Provisional.	9.49957e-41
NZ_CP020018.1\|WP_002834186.1\|996133_997252_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|213783	TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E1 component, alpha subunit. Members of this protein family are the alpha subunit of the E1 component of pyruvate dehydrogenase (PDH). This model represents one branch of a larger family that E1-alpha proteins from 2-oxoisovalerate dehydrogenase, acetoin dehydrogenase, another PDH clade, etc. [Energy metabolism, Pyruvate dehydrogenase].	9.17135e-159

>NZ_CP020018.1|WP_055126517.1|1003092_1003728_-|DUF4767-domain-containing-protein
MRHMKKPEKRSFGSINSVVWVILALIVVIAGYKFFYPNHVTNTTSSSDRSSSTKVIKVEEGKSSSSKAQSSSKKTKKTEKKIWTDKQDSELAAFISSWQQTMGQTYTGTNANASVSFGGVSFPDYLSKGQIYVNQQEVSMQWTRSEKADSEYKVVAVYTGDQYMYLFTFHNGQPEVLVTSQSASDGMNFKVTENADLVAEFQKVAAENTDK
>NZ_CP020018.1|WP_099299469.1|1002179_1002833_-|nitroreductase
MEVKQAIQKRHSVRHFTDQKIDSKQLKEMIGIAQKAPSWVNSQPQKVYVAQGETLEAIRKQQQELAITGAKTNSDIPPMSRKRWSEQAQKNMAEWSRGIPTVLGDNWQETLGEEANQLYNAQAVVYLTLPKGYTPWSLFDLGAFSQNILLVTTEQGIGSIVAYNFVKYPQILREELNIPSDEEIIVGIGLGFEDEQAQVNRITSKRMDTESILKIKK
>NZ_CP020018.1|WP_099299470.1|1001430_1002144_+|GntR-family-transcriptional-regulator
MYKYEKISQAIRKQIIEQKIKPGALLPDQNQLAKEFNTTRITIGKALQSLIIEGLIYSKRGAGTFVRKDAHLNDEFTNDVDKPLGTTSTHPHSKVTSKYIHLTARIANEVEKKNLLLEDGETVYVIKRTRFIEGKAYSYEQTIMPTKIATITEEVLKKSIYQYLEYEYHLELAGSHRQITARKVSEEDAKFLGEKLGDPILVISQTSYLVDGTPFEFSESRFPYQSSAVSADVNLLE
>NZ_CP020018.1|WP_105765970.1|999888_1001271_-|glycoside-hydrolase-family-1-protein
MKGKLPDNFLWGNSTSSMQTEGGVHEGGKGPSVYDTYEATETTSNWDVAIDNYHHYEEDLDLMANQGMNCYRFQISWSRINPTGDGDFNEEGIQYYDRLINDLLKRGIKPMICLYHFDMPLHLAEKYNGFMSRHVVDAFVRFGKKMVDCFSDRVKLWVTFNEQNLYSQTEAFHIAGYLKGDQTDEELQLIAHHVMTAHAQVANYVHETSDAQIGGMLAYVESYPKNCRPRDVYVARQIDEFLNRNLLEVWVHGHYSTEVTQYIKNHHFDIDFTEQDQIAFEKLKSDFISFSYYASNVVDSTKIPQGTMPNRYLDYGGVENPYLKATDWGWNIDPLGFRDVITKTYNEYGIPMFPIENGIGYREIFDGTEIQDDYRIEYHRDHIQAMIDAVVEDGVPVLGYLGWGLIDIPSSSGNMEKRYGMVYVNRGNHELRDMKRVPKKSYKWFKKVIETNGNDLENDL
>NZ_CP020018.1|WP_060743524.1|998530_999874_-|PTS-sugar-transporter-subunit-IIC
MGSSNKESVNDKMQNSKFIAKFTEISVKVGNWVYLRSLRDAFAVILPMFIVAGIGVLLNNVVFTWFLSGDMLTKFQVIGNAIVNGTLNVAGILVAPMIGYSLARNKGFNNPIAAAAMSLASIFILMPGSIQLGTVASAGAKMATVTGGLSYLNTGTQGMFGGIFVGLIATGLFIKLASIKKLQIHLGENVPPAVAASFSVLIPAILLMSFFAIIAALLAGFFNTDLINLIKTWIQEPLRGFNTSIVGYCVIYTLANFLFGLGIHQTVLSGALLDPLVLVNMNENMTAYAHHQAIPNIITTSFVSNYTLIGGSGSTIALIIAILIFSKAKSSRQIAGLSLAPGIFNINEPMIFGFPIVFNLPLIIPFVLFPVVGSLMGYFATLWGWVSRTVVLVPWTTPPLIGPYLSTAGDWRAVILQILIIVVGVFLYLPFLKISERVSEIQAEENL
>NZ_CP020018.1|WP_036673200.1|997263_998250_-|lipoate--protein-ligase
MRYVTYMGTDAYTNIATDTWLLNNLNAKEPVFALWQNNNAIIVGQNQNTFGEVNQDFVDEHQIEVVRRVTGGGAVYHDLGNLNFTLFVPIESAANVDFKKFSEPVLRALHTLGIDAEASGRNDLLVNGKKISGVAQRYAKGYLMHHGTLLFDSNVDTMVRSLNVADEKFISKAAKSVRSRVGMIKDAAPKGLTLQDFWDAVQYELTDHGKDQEIVLTPQQKQEIIQLTADKFSTWDWNYGRSPEFNFKNHAKYDGGIIDVQVQAEGGTIRDINFTGDFLGLRDWREIKDQFIGLPFETAEIKTVFERNHEGRYFGNITDDELIKLFEA
>NZ_CP020018.1|WP_002834186.1|996133_997252_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MAVKDDNKQVLDFNLQMEKQTDSFPMLQVLNNDGEIVDEDALKEAGLNEDQLVELMKQMVFSRVLHERSTKLAKQGRLGFYAPTIGEEASQIASNYAFEKGDWLFPGYRDIPQLVMKGWPIYKAFLWSRGHYEGNEFDDVNGWMPQIIIGAQYVEAAGAALGLKMRKQPNVAYAYTGDGGTSQGDFYEGMNFAGAYNAPAVFFSQNNEYAISTPRKLQTKAPHLAAKGWAAGLPSLVVDGMDPIAMYLASKKARQWAVDGNGPVFIETITNRLGAHSMSGDDPLRYRTQEEIDEWTKKEPLIRFRKYLEGLGLWSEEIENDWTEVVNEQIDDGVKQADGIDKQKISDFIEQTLEVPGQAAQEQINKFRGEGK
>NZ_CP020018.1|WP_105765969.1|995150_996131_-|alpha-ketoacid-dehydrogenase-subunit-beta
MAQKTYIQAITEAQDLALANDENVVIFGEDVGKNGGVFRATDGLQAKYGEDRVFNTPLAESGIGGMAIGMTTQNYRPIMEIQFFGFVYEVMDSLAGQMARGRFRFHGIRTFPIVVRSPYGGGTKTPEMHADSLEGLVAQTPGLRVVMPATPADAKGLLLSAVESNDPVIFLENLRLYRSIRGDVPEGYYTTPLDKANVIREGKDVSIITYGGMVHTSLAAAEELAKDGIDAEVVDLRTVSPLDLDTIGESVEKTGRVVVAQEAQRQAGIGAMVMSEISERFIMSLKAPIGRVAAPDSVYPFALAENEWLPKADDIIEKVKEVVNFD
>NZ_CP020018.1|WP_099299473.1|993853_995158_-|2-oxo-acid-dehydrogenase-subunit-E2
MTEIFKMPDIGEGMAEGEIANWLVKVGDTIKEEDAVAEVQNDKLLQEILSPYGGKITKLFVEAGTVVKVGEPLIEFDGDGSGAGAESEAPKETPASTEPEPESSAPVNQTAPEVTKVGAEYTSNGQLLAMPSVREYARKNDIDLTQVPATGRHGHITMADVENFKASPASAPTASPAPAASVPETESEKAPSAPATPAEVKAGRVPLSPVRKVIAKTLTNQVQTIPHVTIMDEVEVSKLMDLRNQFKEQAKQKGYKLTYMPFIAKALAGAAHKYPELSAMVDIEKQEIVYYEDTNVSFAVDTDNGLFVPNVKNVKSKSIMEVAQEIDDMAIRGRAGDLKPNELKGGTVTITNIGSESGSGFFTPIINPGESAILGIGRIRKTPVVNEDGELAVGNTLKLSLSFDHRLIDGALAQKIMNELKALLSNPAYMLMEV
>NZ_CP020018.1|WP_105765968.1|992444_993851_-|dihydrolipoyl-dehydrogenase
MVVGTQAINVDTLIIGSGPGGYVAAIRAAELGQKVVIVERDYIGGVCLNVGCIPSKALIQAGHLYSTLQHGNPFGVSVPESKIDFTKTQEWKQNQVVNKLTGGVELLLKKHKVEIVRGEAYFNDNETVNVINGDDSHVYRFKRALIATGSRPVEIPHFKFSGRVIDSTGALNLKDVPEHLIIIGGGVIGAELAGAYMNLGSKITIIEGLDHILNGFDGELIQPVLNNFKKNGVEIVTEATAVEANQTDKDVTVTYEADGTTKTVTGDYCLVSVGRRPNTDQLGLNNTNIKLSKRGLIEVNDSMQTSVKHIYAIGDVVAGPALAHKASFEAKVAAAAMGGEDAHDTHYVLPAVAYTNIELATVGETPQSIAEKKLDAKSSKFPFAASGRAMTMDQTEGFIRLITDNPTGGIIGAQIVGPEASNLISELTLAIENGLTIKDIELTIHPHPTLGEEIMDAAELAAGLPIHV
>NZ_CP020018.1|WP_011673877.1|1007330_1007651_-|winged-helix-turn-helix-transcriptional-regulator
MVKNNAALAAFKKNIPLLDALSDERRQQIMITLGESDAGLTVSELTKLIGLSQPAVSHHIKQLKDLNLVSVRKVGTSNIYQLTIKDALAQVQELIDILRKDKKLLR
>NZ_CP020018.1|WP_049752783.1|1007742_1008246_-|DUF1836-domain-containing-protein
MDSKQLENFAKMSLPKWDELPNIELHLDQVIDLANNYLRPLEVDLLTPTMMHNYLKQAVIIRPQGKLYGRMQLAAVIIIGCLKSILSLDEIKRGFEAELKLTSSRRAYNNFVNAFNEEVQRISQHGPRNLWNELLAETAVVSLQHSAIISMLTKKMAKDLLSDLEEK
>NZ_CP020018.1|WP_099299466.1|1008265_1009129_-|DegV-family-protein
MLKQKIAVLVDSCSDVPAEIANREYFEMIPMGVFFGEEEYQDRVNIEPAEFYQKLAKANSLPTTASPKGELITKALDNLSKRGFTQIIAVCISSGLSGTAQQVKIYAKNYPQLQIEVIDTKNIGIASGFAAVRASEVIEEGWEFDQIVEEVQRVANQTKVFFYVPTLKYLIAGGRIGRVAGLVGSIINLKPIISCDDEGIYYPVAKVHGEKKALKKMLQLVDDTLKNAQKFNLAVVHGLNEGLMNQISTEFKNKYPNIGKFYNGDISPALGVHTGPGLIGIGVQIIK
>NZ_CP020018.1|WP_061812202.1|1009331_1010171_+|methyltransferase-domain-containing-protein
MNKIELATQFIQRHLHQFQCPICKSNFNEVQSGTLICNNQHSFNIAKKGSLFFLNNPVNTEYTNEMLTYRNQFLTAGFFNPMLEEVINNISGDLILDAGCGEGTTTKWMASHFDGDFVGLDISKPAINIAGSGIAPQPYPLFMVGDLAQLPFADQGLTSIVNILSPANYQEFDRTLATHGELIKVIPGNHYLSELRQLVYPDGEHATYDNAPVKNHFIEHYEYVEFSKISYKFPLDDKLFTALFNMTPLTWQAQDRKEAILQDGLKEITAEFEIGVVRK
>NZ_CP020018.1|WP_099299465.1|1010590_1012396_-|DUF2207-domain-containing-protein
MKFFTKRTFLLLVTMLTFGIFWNVKTVKADYEISQFRMQINVNKDGSANINQSVLYDFDDDYHGVYLTQDLRGTAGAELEGITVSNNKGTQNQVPINNSGENLTAKVESSKKQMKIKVYNAVSSDDQTKITYHYRINGVVTNYKDTAEINWKVIGSGWDVPLEDAQVTIKLPGKNVKGLHAWSHGEAAGYTTVDKAKGKVTLDIGDNPENTFVEAHMVFPTALTPDNKKIVNQNHLAAVKKQEYQLVKRENEAQARARRIAAYAKITSAIISVLILIGMMGWLKKHGYHQYDIPTPMEHSFDVPSISPAEAEALFNKSKADTKGISAEMLVLAAEGKLKFKQIPYGKRGKETTEIERQGKFNMSFVDRCLDRIGDGQQVTIKQINDYAKKDKKNNVATWYKEWQSEVDTNLARFKDTYNISYRHGLLGLAITTPILAFIVGIIGRFGEVTNLYWIGGIVLTLIIEAWVLATWDKVSMYNEAGLQQYNQIRGFKQMMKDIAHFNTAEIGDLILWEQILPYATAFGLAEKVAKKLKTDFGTQLNENVPFYAYYYGINGMHVGIANSISTSISHSVSASSSGSSGGFSGGSSGGFGGGSGGGAF
>NZ_CP020018.1|WP_002834264.1|1012538_1013651_-|low-temperature-requirement-protein-A
MKNELLKKVSMIELFYDLVFVYMISQVTGLIHHLQNGVISPSALSIFTLVVIVSINSWMVQTVFNNRYGKSQWSNVILSFVDMAIVLYMSNAFSDTFDRHLIGFFIAAGLLSLTLAIQYLLVFVQTKNEYDRNIAMAFMRILFFRTACLLAGGVLAGRWGTTIALFGIITSWIIPAFTGKHTQKHPIIFSHLLERLTALIIIMFGETIVGISKYFTQNTFSIQSIMIFIIVVSLFFTYIVEFDHLIEEQRTHETGNLLIYLHYFILFGLSLVTVALDFIHESEANAIFSITCLYVGIALFYIGIVIASYYNKTTLKLENYVVVAFIVVTLMGYFTSMCFATFSIIAGVTALTTLINAVVITLSLVRRYER
>NZ_CP020018.1|WP_094104215.1|1013804_1014641_+|manganese-catalase
MFKHQKELQFEAKPDRPDPIVAKYLQELIGGQYGEMSVAMQYLFQGWSCRGEEKYKDMIMDIATEEIGHVEMLATMVARLLEDAPIADQQAAMQANPTVGAIISGMNPQHAIVAGLGPRPADSVGNPWSGAYIIASGNLLADFRANLNAESQGRLQVARIYEMIDDQGVKDLLSVLLARDSYHQNLWASAVKELEEKEDSMLVPTTFPRDKERKDIAYDFYNFSQGDESSTGPWASGEALDGEGEYHWYDEPKVEGSAPNLKPVSPKMYGTPENKSEI
>NZ_CP020018.1|WP_002834268.1|1014693_1015419_-|EAL-domain-containing-protein
MSELEQKLEGICFYEQPIFLIDAAEKEEKKVIGSELLLRKTGGENRFPAMLYKEYMRDDASNLVFCTWLVKNIIEIINDNPGIQYSFNLDPQQLLYDSTFEAMKGLIPYCDRVMIEVTESIPSNRDIDQYFNYSVRDQIKRIHEMGFSVAVDDVSSGMNSFNAVREYTQDIDRLKLSLIQLRNVEEGMITVTISLWKALAANTGIDLVIEGIDSLEVSKWLLENGLEKQQGYYFATPRKLK
>NZ_CP020018.1|WP_099299463.1|1015415_1016618_-|GGDEF-domain-containing-protein
MENTVMNTIIYWAKGFFSFNTVVIAAITVGVLFMLAAGTYVVEMNMDKTKTSSTLIEELLWGVGLTIAMVFLQNVFTHLYSTIASSELGWEYSTAQFVVLFYCLYIVHRKIVLWFNIILPMYVYGLGIVRGQIGFDIAPILAILVIILISYTIYQQNDTLIDENVKYYSTLIMFGLAWWFVLKDIHHLTIVDIMCLTLEFLIAMSIVHFGNKKVRMIMKQYLNLMQEVDTDALTGVYNRNSFNKVVEGVFEFYSNNDAPLTMVMFDIDHFKQFNDQYGHQVGDKVLRLVADRFSYELVDRKAHGQLFRVGGEEFAIIFRGRTADDCEKIVRAIRDDLVKETIRVNNHDRVGIKVSIGISQLRDDDFDFQTFYKRVDDYLYQSKRNKRNSITVEGKVASLN
>NZ_CP020018.1|WP_011673888.1|1018781_1020032_-|PDZ-domain-containing-protein
MKTNKLVIVAAIAGLLGGGVAYGGASFIHNQMESSSTAVPTGSNTTGTTKTSNVKVNVSSQSSKAFSTIKDSVVSVINLQKANTNDSDSIISSIFGNESSSSSKSSSSSSELETASEGSGVIYKKSGDTAYIVTNNHVVSGSSSLEIIMSNGKKLPAKIVGTDSVTDLAVLKINSSAVTTVASFGNSDNIKVGETALAIGSPLGSEYATSLTQGIISAKKRTVETTTENGQNNGEATVIQTDAAINAGNSGGPLINLAGQVIGINSMKLSASGSDSTTVEGMGFAIPSNEVVTIIDQLVKNGKITRPALGVALVDLTQVSSTQQKSILKLPSNVTDGTVLMQVNNGPAKTAGLKKYDVITKIDDKAITDTAGLREALYKHKINDKITVGYYRDGKYKTTVVTLTKTSTTTSSTTTK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP020018_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020018_2

1691809-1691914

Orphan

Consensus_repeat	Method
TTAGCTCAGTTGGGAGAGCATCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP020018_2

>merge|NZ_CP020018|2|1691809-1691914|CRISPRCasFinder
TTAGCTCAGTTGGGAGAGCATCTGCCTTACAAGCAGGAGGTCACAGGTTCGAGCCCTGTATCCCCCATTATATTTTGAGCCGTTAGCTCAGTTGGTAGAGCATCTG

>NZ_CP020018|2|2|1691809-1691914|CRISPRCasFinder
TTAGCTCAGTTGGGAGAGCATCTG	CCTTACAAGCAGGAGGTCACAGGTTCGAGCCCTGTATCCCCCATTATATTTTGAGCCG
TTAGCTCAGTTGGTAGAGCATCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020018.1\|WP_060743922.1\|1693866_1695600_+\|pyruvate-oxidase	unknown	unknown	gnl\|CDD\|213733
NZ_CP020018.1\|WP_002833742.1\|1696573_1697764_+\|methionine-adenosyltransferase	unknown	unknown	gnl\|CDD\|235374
NZ_CP020018.1\|WP_029257840.1\|1677244_1679464_-\|ATP-dependent-Clp-protease-ATP-binding-subunit	unknown	unknown	gnl\|CDD\|223616
NZ_CP020018.1\|WP_105766208.1\|1684153_1685170_+\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP020018.1\|WP_002833744.1\|1699351_1699915_-\|16S-rRNA-(cytosine(1402)-N(4))-methyltransferase	unknown	unknown	gnl\|CDD\|377744
NZ_CP020018.1\|WP_060743448.1\|1682065_1682839_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP020018.1\|WP_055126165.1\|1697838_1699305_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP020018.1\|WP_002833905.1\|1676827_1677190_+\|DUF1634-domain-containing-protein	unknown	unknown	gnl\|CDD\|377927
NZ_CP020018.1\|WP_055126166.1\|1699907_1700540_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP020018.1\|WP_105766210.1\|1705942_1706782_-\|NAD(P)H-hydrate-dehydratase	unknown	unknown	gnl\|CDD\|238576
NZ_CP020018.1\|WP_002833902.1\|1680002_1680269_+\|phosphocarrier-protein-HPr	unknown	unknown	gnl\|CDD\|237503
NZ_CP020018.1\|WP_002833901.1\|1680268_1681993_+\|phosphoenolpyruvate--protein-phosphotransferase	unknown	unknown	gnl\|CDD\|224006
NZ_CP020018.1\|WP_055126169.1\|1705200_1705920_+\|16S-rRNA-pseudouridine(516)-synthase	unknown	unknown	gnl\|CDD\|211327
NZ_CP020018.1\|WP_023440216.1\|1695669_1696401_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020018.1\|WP_088356044.1\|1703506_1705192_+\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240529
NZ_CP020018.1\|WP_023440211.1\|1679668_1679857_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020018.1\|WP_002833906.1\|1675982_1676828_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP020018.1\|WP_105766207.1\|1682928_1684104_+\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340844
NZ_CP020018.1\|WP_105766209.1\|1685183_1686218_+\|flippase-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|377103
NZ_CP020018.1\|WP_002833746.1\|1700885_1703303_+\|leucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234743

Protein	Function_ID	Function_description	E-value
NZ_CP020018.1\|WP_060743922.1\|1693866_1695600_+\|pyruvate-oxidase	gnl\|CDD\|213733	TIGR02720, Pyruvate_oxidase, pyruvate oxidase. Members of this family are examples of pyruvate oxidase (EC 1.2.3.3), an enzyme with FAD and TPP as cofactors that catalyzes the reaction pyruvate + phosphate + O2 + H2O = acetyl phosphate + CO2 + H2O2. It should not be confused with pyruvate dehydrogenase [cytochrome] (EC 1.2.2.2) as in E. coli PoxB, although the E. coli enzyme is closely homologous and has pyruvate oxidase as an alternate name. [Energy metabolism, Aerobic].	0
NZ_CP020018.1\|WP_002833742.1\|1696573_1697764_+\|methionine-adenosyltransferase	gnl\|CDD\|235374	PRK05250, PRK05250, S-adenosylmethionine synthetase; Validated.	0
NZ_CP020018.1\|WP_105766208.1\|1684153_1685170_+\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	6.02596e-34
NZ_CP020018.1\|WP_002833744.1\|1699351_1699915_-\|16S-rRNA-(cytosine(1402)-N(4))-methyltransferase	gnl\|CDD\|377744	pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.	3.74975e-74
NZ_CP020018.1\|WP_060743448.1\|1682065_1682839_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.68968e-24
NZ_CP020018.1\|WP_055126165.1\|1697838_1699305_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.38657e-64
NZ_CP020018.1\|WP_002833905.1\|1676827_1677190_+\|DUF1634-domain-containing-protein	gnl\|CDD\|377927	pfam07843, DUF1634, Protein of unknown function (DUF1634). This family contains many hypothetical bacterial and archaeal proteins. A few members of this family are annotated as being putative transmembrane proteins, and the region in question in fact contains many hydrophobic residues.	1.23608e-28
NZ_CP020018.1\|WP_055126166.1\|1699907_1700540_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	6.6583e-52
NZ_CP020018.1\|WP_105766210.1\|1705942_1706782_-\|NAD(P)H-hydrate-dehydratase	gnl\|CDD\|238576	cd01171, YXKO-related, B.subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily.	4.83815e-77
NZ_CP020018.1\|WP_002833902.1\|1680002_1680269_+\|phosphocarrier-protein-HPr	gnl\|CDD\|237503	PRK13780, PRK13780, phosphocarrier protein HPr; Provisional.	1.69391e-54
NZ_CP020018.1\|WP_002833901.1\|1680268_1681993_+\|phosphoenolpyruvate--protein-phosphotransferase	gnl\|CDD\|224006	COG1080, PtsA, Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism].	0
NZ_CP020018.1\|WP_055126169.1\|1705200_1705920_+\|16S-rRNA-pseudouridine(516)-synthase	gnl\|CDD\|211327	cd02553, PseudoU_synth_RsuA, Pseudouridine synthase, Escherichia coli RsuA like. This group is comprised of eukaryotic and bacterial proteins similar to Escherichia coli RsuA. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. E.coli RsuA makes psi516 in 16S RNA. Psi at this position is not generally conserved in other organisms.	4.8608e-88
NZ_CP020018.1\|WP_088356044.1\|1703506_1705192_+\|polysaccharide-biosynthesis-protein	gnl\|CDD\|240529	cd13124, MATE_SpoVB_like, Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	2.69501e-136
NZ_CP020018.1\|WP_029257840.1\|1677244_1679464_-\|ATP-dependent-Clp-protease-ATP-binding-subunit	gnl\|CDD\|223616	COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP020018.1\|WP_002833906.1\|1675982_1676828_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	1.61547e-34
NZ_CP020018.1\|WP_105766207.1\|1682928_1684104_+\|glycosyltransferase-family-4-protein	gnl\|CDD\|340844	cd03817, GT4_UGDG-like, UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.	1.53455e-136
NZ_CP020018.1\|WP_105766209.1\|1685183_1686218_+\|flippase-like-domain-containing-protein	gnl\|CDD\|377103	pfam03706, LPG_synthase_TM, Lysylphosphatidylglycerol synthase TM region. LPG_synthase_TM is the N-terminal region of this family of bacterial phosphatidylglycerol lysyltransferases. The function of the family is to add lysyl groups to membrane lipids, and this region is the transmembrane domain of 7xTMs. In order to counteract attack by membrane-damaging external cationic antimicrobial molecules - from host immune systems, bacteriocins, defencins, etc - bacteria modify their anionic membrane phosphatidylglycerol with positively-charged L-lysine; this results in repulsion of the foreign cationic peptides.	3.33297e-32
NZ_CP020018.1\|WP_002833746.1\|1700885_1703303_+\|leucine--tRNA-ligase	gnl\|CDD\|234743	PRK00390, leuS, leucyl-tRNA synthetase; Validated.	0

>NZ_CP020018.1|WP_105766209.1|1685183_1686218_+|flippase-like-domain-containing-protein
MSRRNKVVLAVMILAGIIIFGFSLRNVNLNQMARDVVHLNMWWLLVALGCIVLYLGLEAVATKMLIQSNGDRLSWRDAIRIPLIEQLFNGITPFSSGGQPAQLVALMQNGIEGGRASSVLLMKFVVFQSMVVINFIFSLLIGFQYLEEKIRFLSWFVLFGFLIHLAVIIGLLMIMYWHNFTKQLISAIFIPIKHFVSKERYTTWKVTLNEKVDSFYQESVRMKSQWRLLAKVALVTFLQLLFYYLIPYFILLALGKSDVNIVMVTCLHVLIFMVISLFPIPGGAGGAEYGFSVIFAQFVGNNSKLVLAMMIWRILTYYFGMFAGMVATVVKPHKVNRVKVVKNE
>NZ_CP020018.1|WP_105766208.1|1684153_1685170_+|glycosyltransferase-family-4-protein
MPIKVNMFSSASKVKGQGVGSAYEELIRLLKTHFPKQIDVSINKFTKADISHYHTIDPNFYLSTFSKKRGVKVGYVHFLPETIEGSLNIPQPFRSIFYKYIISFYKRMDHIVVVNPTFIDKLVAYGISRDIITYIPNFVRKNEFYRFTEANRDAVRERLEVNNRFTVLGIGQVQERKGVKDFIKLAENNPDKYFIWAGGFSFGRLTDGYADLKQVVDNPPRNLKFTGIVDRNALVEYYNAADLFLLPSYNELFPMSVLEAFSCGVPVMLRDLELYHSIIKGYYIPTQDYEDMNTQLKLVSEDKERLNKFKQLSDEASEEYSEDHLADIWLDFYSSLTK
>NZ_CP020018.1|WP_105766207.1|1682928_1684104_+|glycosyltransferase-family-4-protein
MNIGLFTDTYFPQVSGVATSIKTLRDQLEKQGHQVYIFTTTDPKVDTNVYERNIFRFTSVPFVSFTDRRIAVSGFIRAAQLAKELNLDIVHTQTEFSLGWMGKFVAKSLKIPLIHTYHTMYEDYLHYVANGKLLKPYHVKQMTRAFCYHIDGIVAPSERVLDTIEGYGINVPIRVIPTGVNLEQYQKPNKRKQWREKLGYDESSPILLSLSRLAYEKNIQEVIDSFPAILKEVPNAQLLIVGDGPARASLENQVHDLHLEDSVQFTGEISNDHVYGFYQLADLFVSASDTESQGLTYIEALASNLKVVAKSGPYTDELLDDISLGKVFNTEDQLVAAIKDYIEHPDAYNDPAPREKKLYEISADYFGKQVVDYYSSAISTHTDLELDEDSE
>NZ_CP020018.1|WP_060743448.1|1682065_1682839_+|alpha/beta-hydrolase
MKLKLKSGAQIFFEDEGQGTPILFLTGFGGNTEIWSGQVNFFLQRGYRVIRLDYLNHGQSDRVDGELQIGDLADEVLQLVDYLQLKEPIGIGNSMGAAVLWNIINLRGWDFLSKAIFVDQSPKMLNDQQWHLGFKNLAEDNFDEVMNEPIVRPAYKHIDDFVFKNSKAIDSAYPFSQPQNRALVKGHAKKDWRFVLEQATKPVLFIMGEKSPFFDSTKTAELSALNANITVNVMKNVGHIPMAEDPTEFNRLVLQFV
>NZ_CP020018.1|WP_002833901.1|1680268_1681993_+|phosphoenolpyruvate--protein-phosphotransferase
MAGTLKGIAASDGIAIAKAYLMVDPDLSFEKKNITDVDAEIKRLHDALEKSKEELSLIKAKAAENLGAEEAEVFEAHLTILSDPELIGNIEDKIKNDTINAEEATKEVTDNFISMFEAMTDNAYMQERAADIRDVTKRLMSHLLGVELPNPALIDSEVVIVAHDLTPSDTAQLDRRYVKGFITDIGGRTSHSAIMSRTLEIPAVVGSEKATTSVKQGEMMIVDGLTGDAIIAPTDDEIKAYQQKGEEFKAQKAEWEKLKNEKTVSKDGVHFDLAANIGTPDDLQGVLDNGGEAVGLFRSEFLYMNASELPSEDEQFEAYKKVVEGMNGKQVVVRTMDIGGDKELPYLPLPEEMNPFLGYRAIRISLDRTDLFRTQLRALLRASAFGKLAIMFPMIATVAEFKKARAIYDDERQKMVDAGQEVGEIQVGMMMEIPAAAMIADKLAKYVDFFSIGTNDLIQYSFAADRGNEKVSYLYQPYNPSLLRLIKQTIDASHAEGKWTGMCGEMAGDQIAVPILMGLGLDEFSMSATSILKTRSLMKKLTTDDMKKLAEKAVTEAETNEDVIKLVQETVDNI
>NZ_CP020018.1|WP_002833902.1|1680002_1680269_+|phosphocarrier-protein-HPr
MEKRDFHVIAETGIHARPATLLVQSASKFNSDIQLTYKDKSVNLKSIMGVMSLGVGQGADVTISADGDDEADAIAALEDTMKKEGLSD
>NZ_CP020018.1|WP_023440211.1|1679668_1679857_+|hypothetical-protein
MRDYLQLLNDLKDGSIKELKITAEEFQDFQPRFMEFPERKQVIGKADRGGVVVYHFERIKDK
>NZ_CP020018.1|WP_029257840.1|1677244_1679464_-|ATP-dependent-Clp-protease-ATP-binding-subunit
MLCQNCQKNEASIHLYTNVNGQRTEVNLCQNCYQLLKNQRNNNINRNGGARMAQDPFGFGNLDDIFRAMQGGNMGQPENLYGQQVPPTQPGGGNGSGGNPNNRGNGGSLLSQYGLNLTDLAKQGKIDPVIGRDSEIERVIEILNRRTKNNPVLIGEAGVGKTAVVEGLAQRIVEGSVPQKLVNKQIVRLDVVSLVQGTGIRGQFEQRMQQLMKEVQANKDMVVFIDEIHEIVGAGNAEGGMDAGNVLKPALARGDFQLVGATTLKEFRDIEKDAALARRLQPVQVDEPSEEEAIKILKGIQKKYEDYHHVHYTDDAIEAAVKLSKRYIQDRFLPDKAIDLLDEAGSKKNLTINIADPETIQKKIDEAEAQKKAALQSEDYEKAAYYRDQVSKLEKNKDGATSSEEQPTVTEEDMEKIIETKTDIPVGDLQKQEQEQLQNLSENLKDHVIGQDEAVDKISRAIRRNRIGLNGTGRPIGSFLFVGPTGVGKTELAKQLAQQLFGSKDSMIRFDMSEYMEPHSISKLIGSPPGYVGYEEAGQLTEQVRRHPYSLVLLDEVEKAHPDVMHMFLQILDDGRLTDSQGRTVSFKDTIIIMTSNAGTGDVQADVGFGAAAQGKTHSVLDKLGNYFKPEFLNRFDDIVEFQALTKENLMQIVDLMIADVNSMLATQGLHVDVTKPVEERLVDLGYNPKMGARPLRRVIQEQIEDRIADFYLDHPAEKQLNAKIKDDQIEITGAPKKD
>NZ_CP020018.1|WP_002833905.1|1676827_1677190_+|DUF1634-domain-containing-protein
MNAKKQEMQHVELVIGRVLQVGVYISALVILLGIGLWLFKNGSGYSGALPTRITPIFHGVLAFKPYAVLMFGIFLLILTPVLRVIVSIYAFAKEGDRLYVVITTIVLVILIIGMAIGYRG
>NZ_CP020018.1|WP_002833906.1|1675982_1676828_+|sulfite-exporter-TauE/SafE-family-protein
MASHLIILLLVGLMAGIFGAILGIGGGMIITPVLTVAMGLDIKYAIGASIIAVIATSSGATIAYLKDEMLNLRVAMFLEIATTVGAIVGAIMTGIFNSTVLFVLFGSFLVFSSWNMYRKLRRGGGEEGSTKNDRLANQLNLNGSYYDKALKKNVDYQVENVPGGSAVMFGAGLASGLLGIGSGAFKVMAMDNIMKMPLKPSSATSNLMMGVTAAASAMVYFFNGSIHADIAGPLAIGILFGAQLGSRIMQHLQPRWIRMIFIPVLLYMGLQMILKGFGVNI
>NZ_CP020018.1|WP_060743922.1|1693866_1695600_+|pyruvate-oxidase
MTEKINASDAMIKVLESWGVHNVYGLPGGSFDSTMNALYNRKSTINYVQVRHEEVGALAAVGEAKVTGKLGVTFGSAGPGAVHLLNGLYDAKHDHMPVLALVGQVPTTLMNTDYFQELNENPIFTDVAVYNRTVMTAEQMPHVVDEAIRQAYKYSGVAVVTIPKDLGWQPIEDNYVSSANLYQAPILPEPDVKQVDEALEILSNAKHPVMYIGQGTRGAGSDIIALSEKLHIPIVTSALAKGIVPDSYKANMGSAGRVATKPGVEVLQAADAVMFVGSDFPFQPYFVAPDAKYIQVDIDASKFGRRHVVDLAILADSHKFLKVMLEKAETTAESKWYKAALENKKNWEEWKNSFVGQQDTPLNVENVFAKINALATDDAIFQVDVGNVTIDGMRFLKADQAQRFTTSGWYATMGYALPAAIGAQAEYPDRQVWSISGDGGYAMVMQDVLTQVKYHMPIINVILTNESLGFIEAEQDDSKQPHSGVDLIDADYGTSAQALGAEGFEVRTYDELEQAFEKAKDRKGPVVIDVKITNLRPLPVEQLLLDKETQDPEAVEQFVKKYHAESLIPFRKLLEEA
>NZ_CP020018.1|WP_023440216.1|1695669_1696401_-|hypothetical-protein
MNKINLPKFNYPIEKKSYLPAINALLLSVVPWYLSSHFSSEIFSKHLSIQILFFLATFMVNFLTIDRLTNKTNLRLMAPLAIIPILTFIILLFSENTYVALLGLLSFVPFLTTFLPFEQKNGVGLLTFSLSVGTLAPLAFFYIRNGFVTSILLKMGLLLSLMIIVILFAIFIKTSFKFAIFALALTLIITIFAFILLKSWTALIYPILAVFSWFIPKLHLPRNFTLLVLIALIGLASFFITIN
>NZ_CP020018.1|WP_002833742.1|1696573_1697764_+|methionine-adenosyltransferase
MSERHLFTSESVSEGHPDKIADQISDSILDELLKNDPDARVACETTVTTGLVVVVGEISTTAYIDIQKVVRKTIKDIGYVGGEYGFDGENCAVIVAIDEQSPDIAQGVDDSLETREGHEDRLNQIGAGDQGLMFGYATNETEELMPLPIMLSHHLMQRIAKLRKEQVISYLRPDAKAEVTVEYDDNDHPVRVDTVVLSTQHDPDVTLEQIRQDVIEQVIKAVIPATLLDENTNFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGAARHGGGAFSGKDATKVDRSASYAARYIAKNIVAAKLAERVEVQIAYAIGVAEPVSVMVDTFGTGTVSEEKLTQAVRKIFDLRPAGIIEMLDLKRPIYKQTAAYGHFGRTDVELPWEKTDKVEALNDFFKN
>NZ_CP020018.1|WP_055126165.1|1697838_1699305_+|MFS-transporter
MEKKQTNVIVVTVAIFVATFMSAIEGTIVSTAMPTIVGDLHGVSLMNWVISIFLLTNAIFTPIYGKLSDIFGRKRVFIFGIIIFLIGSMLSGMAHSMGFLILWRALQGIGAGSIMPVSNTIIADIYPIEKRAKVMGLNGSAWGIASIIAPLLGGFIVDNLSWHWIFFINLPIGIITIFLIQFFLKEEVSVHSKKIDYLGSFWLMVALLGLMYGFQLMGESSFSWITLVISFVIFIVGAGLFIRQEKRAEDPIIFLDLFNNRTFVIQNVATMLVSGLLIGFEVYLPSWTQGILGVPASLAGFAVTPSSILWIFGSFLAGRMIVKLKANQILTISLSILAVGSLLLALVPASTPFLAFFFIAAILGVGFGITITSTLVISQQLVTKDRIGVATSFNTLAKTLGQTIMMSVFGIIMNGTMNAGVKANPKINMDMMNKVINPQTAKTLPETLLPTLRNVLYQALHNIYIGCFILIVVALIINAFDRRSKDNI
>NZ_CP020018.1|WP_002833744.1|1699351_1699915_-|16S-rRNA-(cytosine(1402)-N(4))-methyltransferase
MLDNAMQYSHQLLTEIVQPGDVVIDATMGNGHDTLFLSELVQSTGRVFSFDVQKAALEQTRALFEHQHQTLINVELIHASHDQIDHYVTEPITGAIFNLGYLPGGDKSIITHPTSTISAVQQSLNQLKIGGRIILVCYYGHPGGQEELQQLLSFVAELDQHHYSCLRYEFINQINNPPILLCIERKK
>NZ_CP020018.1|WP_055126166.1|1699907_1700540_-|phosphatase-PAP2-family-protein
MHSRKYTHLLINILPTLLFILIVSLVIFKPSWVHAYDNSISSLVQSVRTPGFNQVVSIYTQLGNSIPYIIISLLVCSILILKHLKKAALFLACNIILGNGLNHLIKQIIQRQRPEFRLISIGGYSFPSGHSVAAMVLFGSLIFITFQVVHHQLKRNLLALIYLILMLGIGLSRIYLNVHFPTDVTAGFLLGLIVLQFTTYLFYGRKIKNA
>NZ_CP020018.1|WP_002833746.1|1700885_1703303_+|leucine--tRNA-ligase
MAYNHKDIEQKWQQFWSDNETFKTVEDADKPKYYALDMFPYPSGQGLHVGHPEGYTATDIMSRMKRMQGYKVLHPMGWDAFGLPAEQYAMKTGNNPRDFTAKNIQNFKRQIQSLGFSYDWSREVNTTDPAYYKWTQWIFEQLYKKGLAYEKETLVNWAPDLMGGTVVANEEVVDGKTERGGFPVYRKPMKQWILKITAYADRLIDDLDLVDWPDSIKEMQKNWIGRSVGASVFFNVEDSEKQIEVFTTRPDTLFGATYLVISPEHDLVDQITTPESKAAVEEYKKAVATKSDLERTDLNKDKTGVFTGAYAVNPVNGKKIPVWISDYVLASYGTGAVMAVPAHDGRDYEFAKKFKIDMVPVYEGGNLEDGVLDSEGGLINSGFLDGMDKQTAIDTMISWLEEHGVGHKKVNYRLRDWVFSRQRYWGEPIPVIHWEDGETTLIPEDELPLRLPAATDIRPSGTGESPLANLDDWVNVVDENGRKGRRETNTMPQWAGSSWYFLRYVDPKNDQKIADEDLLKEWLPVDLYVGGAEHAVLHLLYARFWHKVLYDLGVVPTKEPFQKLVNQGMILGSNHEKMSKSKGNVVNPDDIVERFGADTLRLYEMFMGPLTESVAWSEDGLNGSRKWIDRVWRLMIDDENQLRDHIVTENDGSLDMIYNQTVKKVTDDYENMRFNTAISQMMVFVNEAYKADKLPAVYMEGLVKMLAPIIPHVAEELWSLLGHEGGISYAEWPTYDESKLVEATVQVILQVNGKVRSKITVDKDIAKEELEKLALADAKIQQWTADKTVRKVIVIPNKIVNIVVG
>NZ_CP020018.1|WP_088356044.1|1703506_1705192_+|polysaccharide-biosynthesis-protein
MDKQSEMDNSESLYMGSQPLRDNSGKSSSKAKMLEGSAWMTAGSIFSRILGAIYIIPWVIWFGVYSDQANALFTKGYNIYSFFLIAAIAGIPSAISKQVSHYNAINEFALGQRLYKRGLLLSVGTGIICAAILYFGAPFLKDGDPNVITVLHALAWAVLVIPTMSLTRGFFQGYQEMGPSAVSQFIEQLARVIYMLTTAYFIMGKSGQGDWVYGVSQSTFAAFIGALGGLLVLGIYFIKYRKRLSYLSQHSANELVVSTSTLYKEIIAQAVPFIIIGSAITIFQLIDQYTFFRIMNAVSDYSTAVLNNMYAIFAFNANKLVMIVISLASAMAVTSVPILSEAKTRGDRVEISRQVTDSILLFAFLMIPAALGMAAVAQPAYTLFYHLSDVGTAILQFNSYVAIVLGLFTVISAIMQGIGENVLAVKYFCVGMIVKFIFQFPMVALFSAVGSLISTAIGFMVVNWLILRHINLEYGLDYRRINTFIGKIITYAFGTFLIAMVVTNGLYIVMDPASKVQSLLVIAAAVVLGGAFYLYFVLKSRLADEIVGARAAGLRRMLKIS
>NZ_CP020018.1|WP_055126169.1|1705200_1705920_+|16S-rRNA-pseudouridine(516)-synthase
MRVDKFLHDMNMGTRTQIRKMIKDKLIFVNDTVVKTGRVKVDPVIDEVRLKDQVIEYQQYFYFMMNKPLGVLTATEDRKQKTVMDLFNKVDLRSDLFPVGRLDKDTQGLLLITNNGQLAHDLLAPERHVDKTYEAVVTGKITDQAVEEFQKGITLKDGTTLKPAQLIIEHYSELDDQTVVKVVLKEGKYHQVRRMFGSLGEKVVTLRRTSFGPLELDVGLLPGTYRELTDDEINRLVEG
>NZ_CP020018.1|WP_105766210.1|1705942_1706782_-|NAD(P)H-hydrate-dehydratase
MLKINQDGLNYLWPVRSNDSHKGSYGRILIVAGNDQYGGAGILSSSAAVYAGGGLVTLATDKSNFTAVRSTLAEVMLLDFLDFDALKAALKKSTGVVIGPGLGTNATSLKILKFVLDHVQPQTPLVIDGSAIDLIATHQIQVDHPQTIFTPHQMEWQRLSGIKIADQAPTLNQRAVDHLKAIVVLKHYETEIYAPHTDFRQIMAGNPGMATGGSGDALTGVIIALVNQVDSLALGVTLGTFLHSYTADQIYQKEAVVLPHRLIRRLPFTLKQLQKNKLL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

31 : 9593

Lactobacillus_phage(75.0%)

capsid,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158695013.1\|31_535_+	tape measure protein	Q9T1E7	Lactobacillus_phage	4.6e-44	57.4
WP_105765757.1\|598_862_-	hypothetical protein	NA	NA	NA	NA
WP_105765758.1\|866_1640_+	hypothetical protein	A0A286QRZ7	Streptococcus_phage	1.6e-19	36.8
WP_158694999.1\|1767_1998_+	hypothetical protein	NA	NA	NA	NA
WP_158695000.1\|1969_3871_+	peptidoglycan DD-metalloendopeptidase family protein	A0A2P0ZLG0	Lactobacillus_phage	6.4e-46	31.5
WP_105765760.1\|3880_4717_+\|tail	phage tail family protein	A0A0M7RF73	Lactobacillus_phage	3.0e-48	37.5
WP_105765761.1\|4646_5870_+	hypothetical protein	A0A0M7RDS2	Lactobacillus_phage	2.6e-77	45.4
WP_158695001.1\|5859_6177_+	hypothetical protein	NA	NA	NA	NA
WP_105765763.1\|6173_6416_+	hypothetical protein	NA	NA	NA	NA
WP_105765764.1\|6415_8317_+\|capsid	capsid protein	O03968	Lactobacillus_phage	1.9e-29	24.7
WP_105765765.1\|8330_9068_+	hypothetical protein	NA	NA	NA	NA
WP_105766255.1\|9099_9441_+	DUF2977 domain-containing protein	Q7M292	Lactobacillus_phage	1.6e-08	41.0
WP_105765766.1\|9437_9593_+	XkdX family protein	B6SBV5	Clostridium_virus	6.3e-05	54.8

DBSCAN-SWA_2

177025 : 183381

Megavirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011673326.1\|177025_178885_+	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	5.3e-138	47.2
WP_002833625.1\|178981_180106_+	molecular chaperone DnaJ	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	1.3e-22	33.2
WP_002833626.1\|180211_180439_-	DUF378 domain-containing protein	NA	NA	NA	NA
WP_105765794.1\|180567_181038_-	tryptophan-rich sensory protein	NA	NA	NA	NA
WP_011673329.1\|181274_181757_+	QueT transporter family protein	E7DN70	Pneumococcus_phage	4.9e-11	35.0
WP_011673330.1\|181773_181995_+	DUF2829 domain-containing protein	G3MBC9	Bacillus_virus	2.0e-07	33.3
WP_011673331.1\|181995_182736_+	3-oxoacyl-ACP reductase	Q06VL0	Trichoplusia_ni_ascovirus	1.8e-17	30.5
WP_105765795.1\|182859_183381_+	DUF4373 domain-containing protein	A0A0P0HRQ2	Lactobacillus_phage	2.3e-43	57.1

DBSCAN-SWA_3

312698 : 322316

Staphylococcus_phage(37.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029258025.1\|312698_313544_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	1.4e-16	35.2
WP_002833194.1\|313780_314518_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-33	39.9
WP_011673472.1\|314514_315966_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_099046115.1\|316087_316564_-	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	3.8e-24	38.8
WP_011673474.1\|316601_317552_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	3.4e-117	62.7
WP_105765835.1\|317564_319442_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	8.5e-51	30.3
WP_041526969.1\|319444_320653_-\|tRNA	CCA tRNA nucleotidyltransferase	G3MAR3	Bacillus_virus	3.5e-34	40.0
WP_002833200.1\|320906_321791_+	YitT family protein	M1Q1P6	Streptococcus_phage	2.1e-52	38.1
WP_002833201.1\|321845_322316_-	nucleoside deoxyribosyltransferase	A0A1G5S9Z4	Enterococcus_phage	3.8e-16	40.1

DBSCAN-SWA_4

687597 : 696161

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_055126385.1\|687597_688179_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	3.9e-23	34.7
WP_055126386.1\|688175_689225_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D8KLC2	Synechococcus_phage	4.0e-58	40.2
WP_011673678.1\|689224_690694_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.4e-56	32.3
WP_088355936.1\|690678_692886_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	2.8e-146	41.5
WP_011673680.1\|692903_693578_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002833288.1\|693580_693835_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002833286.1\|693827_694556_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SLB8	Cyanophage	1.6e-42	43.4
WP_105765898.1\|694555_695695_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_011673684.1\|695678_696161_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.6e-20	42.9

DBSCAN-SWA_5

705520 : 714388

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011673692.1\|705520_706537_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.5e-33	30.6
WP_002833272.1\|706536_706872_-	hypothetical protein	NA	NA	NA	NA
WP_002833271.1\|706887_707517_-	dTMP kinase	M1PSC7	Streptococcus_phage	2.0e-52	52.7
WP_002833270.1\|707681_708281_-	recombination protein RecR	NA	NA	NA	NA
WP_002833269.1\|708307_708622_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_011673693.1\|708637_710383_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	2.8e-56	48.4
WP_011673694.1\|710595_711081_-	nucleoside deaminase	A0A2H4PQS8	Staphylococcus_phage	1.8e-05	31.6
WP_011673695.1\|711073_711679_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011673696.1\|711890_712121_+	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	8.0e-12	48.1
WP_105765900.1\|712222_714388_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	1.1e-248	59.8

DBSCAN-SWA_6

941047 : 951894

Bacillus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105765947.1\|941047_942223_+	class I SAM-dependent methyltransferase	A0A2K9L4K8	Tupanvirus	5.7e-45	33.6
WP_002834110.1\|942364_942697_-	AzlD domain-containing protein	NA	NA	NA	NA
WP_002834111.1\|942717_943506_-	branched-chain amino acid ABC transporter	NA	NA	NA	NA
WP_105765948.1\|943637_944894_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.3e-07	23.8
WP_105765949.1\|945073_946210_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.7e-25	26.1
WP_002834114.1\|946221_946911_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.7e-37	37.3
WP_002834116.1\|946993_947491_-	methylated-DNA--[protein]-cysteine S-methyltransferase	G5CRV0	Megavirus	6.4e-14	36.4
WP_105765950.1\|947622_948765_-	guanosine monophosphate reductase	A0A1V0SHK8	Klosneuvirus	1.4e-64	34.0
WP_002834119.1\|948786_949491_-	DUF1129 domain-containing protein	NA	NA	NA	NA
WP_002834120.1\|949519_950626_-	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_002834122.1\|950843_951029_-	DUF951 domain-containing protein	NA	NA	NA	NA
WP_023440818.1\|951042_951894_-	ParB/RepB/Spo0J family partition protein	S5VTK0	Leptospira_phage	2.1e-12	34.9

DBSCAN-SWA_7

1506716 : 1514334

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105766143.1\|1506716_1507832_+	peptide chain release factor 2	B5LLF2	Mycobacterium_phage	1.9e-05	47.1
WP_002834460.1\|1507843_1508548_+	response regulator transcription factor	W8CYM9	Bacillus_phage	6.9e-38	37.3
WP_002834459.1\|1508519_1509905_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	6.3e-27	33.3
WP_105766144.1\|1510066_1510948_+	phosphate ABC transporter substrate-binding protein PstS family protein	H6WG65	Cyanophage	9.3e-08	25.9
WP_105766145.1\|1510947_1511856_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_002834456.1\|1511856_1512744_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_011673074.1\|1512761_1513562_+	phosphate ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	3.4e-09	42.0
WP_105766146.1\|1513575_1514334_+	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-18	30.5

DBSCAN-SWA_8

1700885 : 1752819

Lactobacillus_phage(54.05%)

protease,integrase,portal,head,capsid,holin,terminase,tRNA,tail

attL 1710431:1710449|attR 1753407:1753425

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002833746.1\|1700885_1703303_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	67.9
WP_088356044.1\|1703506_1705192_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_055126169.1\|1705200_1705920_+	16S rRNA pseudouridine(516) synthase	NA	NA	NA	NA
WP_105766210.1\|1705942_1706782_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_055126171.1\|1706916_1707369_+	universal stress protein	NA	NA	NA	NA
WP_002833751.1\|1707446_1708106_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	6.4e-46	45.5
WP_023440223.1\|1708349_1709171_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002833753.1\|1709372_1709588_+	hypothetical protein	NA	NA	NA	NA
WP_011673189.1\|1709588_1709867_+	hypothetical protein	NA	NA	NA	NA
WP_002833755.1\|1709966_1710191_-	hypothetical protein	NA	NA	NA	NA
1710431:1710449	attL	NA	NA	NA	NA
WP_105766211.1\|1710507_1711656_-\|integrase	site-specific integrase	E9LUS1	Lactobacillus_phage	1.1e-93	47.7
WP_105766212.1\|1711952_1712849_-	hypothetical protein	Q4ZE81	Staphylococcus_phage	2.2e-12	32.5
WP_099300170.1\|1712927_1713344_-	ImmA/IrrE family metallo-endopeptidase	A0A2P0ZLA0	Lactobacillus_phage	6.9e-14	31.9
WP_105766213.1\|1713356_1713737_-	helix-turn-helix transcriptional regulator	E3W8B9	Leuconostoc_phage	1.2e-12	42.0
WP_105766214.1\|1714005_1714269_+	hypothetical protein	NA	NA	NA	NA
WP_105766215.1\|1714234_1714672_+	hypothetical protein	NA	NA	NA	NA
WP_105766216.1\|1714820_1715519_-	hypothetical protein	A0A2I6PCS6	Staphylococcus_phage	2.0e-29	36.4
WP_105766217.1\|1715573_1715777_+	DUF2829 domain-containing protein	A0A2I6PF15	Staphylococcus_phage	9.8e-06	42.6
WP_060743632.1\|1715773_1716130_-	hypothetical protein	NA	NA	NA	NA
WP_105766218.1\|1716472_1716823_-	hypothetical protein	NA	NA	NA	NA
WP_099300173.1\|1716991_1717318_-	hypothetical protein	NA	NA	NA	NA
WP_105766219.1\|1717374_1718121_+	Rha family transcriptional regulator	A0A0K2CZD5	Paenibacillus_phage	1.7e-42	42.9
WP_105766220.1\|1718137_1718440_+	DUF771 domain-containing protein	Q4ZD49	Staphylococcus_phage	9.5e-05	27.7
WP_158695007.1\|1718537_1718846_+	hypothetical protein	NA	NA	NA	NA
WP_105766221.1\|1718781_1719390_-	hypothetical protein	NA	NA	NA	NA
WP_105766222.1\|1719611_1720073_+	chromosome segregation protein SMC	NA	NA	NA	NA
WP_105766223.1\|1720072_1720840_+	AAA family ATPase	A8YQL5	Lactobacillus_phage	2.3e-63	53.8
WP_105766224.1\|1720839_1721361_+	DUF669 domain-containing protein	A0A1P8VVN0	Streptococcus_phage	1.9e-29	46.6
WP_105766225.1\|1721380_1722172_+	hypothetical protein	A0A0N7IRA7	Lactobacillus_phage	4.8e-40	64.7
WP_105766226.1\|1722155_1723382_+	DNA helicase	A0A2D1GP91	Lactobacillus_phage	2.5e-59	36.5
WP_105766227.1\|1723389_1723806_+	hypothetical protein	NA	NA	NA	NA
WP_105766228.1\|1723802_1724345_+	hypothetical protein	A0A2P0ZKV6	Lactobacillus_phage	2.3e-25	48.4
WP_105766229.1\|1724319_1724538_+	hypothetical protein	NA	NA	NA	NA
WP_105766230.1\|1724549_1724777_+	hypothetical protein	NA	NA	NA	NA
WP_158695008.1\|1724776_1724914_+	hypothetical protein	NA	NA	NA	NA
WP_002833141.1\|1724900_1725095_+	hypothetical protein	NA	NA	NA	NA
WP_105766231.1\|1725094_1725388_+	hypothetical protein	NA	NA	NA	NA
WP_105766232.1\|1725388_1725841_+	DUF1642 domain-containing protein	NA	NA	NA	NA
WP_105766233.1\|1725833_1726319_+	class I SAM-dependent methyltransferase	A8ATY8	Listeria_phage	1.0e-56	65.6
WP_105766234.1\|1726311_1726497_+	hypothetical protein	NA	NA	NA	NA
WP_105766235.1\|1726584_1726782_+	hypothetical protein	NA	NA	NA	NA
WP_158695009.1\|1726778_1726952_+	hypothetical protein	NA	NA	NA	NA
WP_105766236.1\|1727015_1727432_+	hypothetical protein	A0A1X9I632	Streptococcus_phage	9.1e-06	31.8
WP_105766273.1\|1727511_1728675_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_105766237.1\|1729066_1729789_+	hypothetical protein	NA	NA	NA	NA
WP_105766238.1\|1729846_1730059_+	hypothetical protein	NA	NA	NA	NA
WP_105766239.1\|1730024_1730300_+	hypothetical protein	NA	NA	NA	NA
WP_105766240.1\|1730303_1730834_+	HNH endonuclease	E9LUP7	Lactobacillus_phage	1.3e-49	63.2
WP_158695010.1\|1730826_1730991_+	hypothetical protein	NA	NA	NA	NA
WP_105766241.1\|1731111_1731567_+\|terminase	phage terminase small subunit P27 family	A0A2P0VG04	Streptococcus_phage	7.0e-44	56.9
WP_105766242.1\|1731590_1733468_+\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	4.9e-240	64.6
WP_105766243.1\|1733468_1733660_+	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	4.0e-09	50.0
WP_105766244.1\|1733662_1734835_+\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	5.5e-125	58.3
WP_105766245.1\|1734812_1735511_+\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.6e-71	60.2
WP_105766246.1\|1735525_1736737_+\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	6.1e-151	67.0
WP_105766247.1\|1736818_1737100_+	hypothetical protein	A0A173GAW4	Staphylococcus_phage	6.1e-06	56.5
WP_105766248.1\|1737113_1737452_+\|head,tail	phage gp6-like head-tail connector protein	A0A286QPP0	Streptococcus_phage	4.0e-20	51.1
WP_105766249.1\|1737429_1737777_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	3.3e-17	37.5
WP_105766250.1\|1737776_1738163_+\|head,tail	phage head-tail adapter protein	Q3L0S9	Lactobacillus_rhamnosus_Lc-Nu-like_prophage	2.2e-22	50.4
WP_105766251.1\|1738167_1738557_+	DUF806 family protein	A0A0M7RE53	Lactobacillus_phage	2.9e-22	41.3
WP_099300110.1\|1738557_1739199_+\|tail	phage tail protein	A0A0M7RF39	Lactobacillus_phage	1.3e-59	54.7
WP_158695011.1\|1739311_1739761_+	hypothetical protein	NA	NA	NA	NA
WP_105766253.1\|1739997_1744782_+	peptidoglycan DD-metalloendopeptidase family protein	A0A286QQ86	Streptococcus_phage	3.7e-111	35.1
WP_105765760.1\|1744791_1745628_+\|tail	phage tail family protein	A0A0M7RF73	Lactobacillus_phage	3.0e-48	37.5
WP_105765761.1\|1745557_1746781_+	hypothetical protein	A0A0M7RDS2	Lactobacillus_phage	2.6e-77	45.4
WP_158695001.1\|1746770_1747088_+	hypothetical protein	NA	NA	NA	NA
WP_105765763.1\|1747084_1747327_+	hypothetical protein	NA	NA	NA	NA
WP_105765764.1\|1747326_1749228_+\|capsid	capsid protein	O03968	Lactobacillus_phage	1.9e-29	24.7
WP_105765765.1\|1749241_1749979_+	hypothetical protein	NA	NA	NA	NA
WP_105766255.1\|1750010_1750352_+	DUF2977 domain-containing protein	Q7M292	Lactobacillus_phage	1.6e-08	41.0
WP_105765766.1\|1750348_1750504_+	XkdX family protein	B6SBV5	Clostridium_virus	6.3e-05	54.8
WP_105765767.1\|1750654_1751119_-	hypothetical protein	NA	NA	NA	NA
WP_128886971.1\|1751133_1751478_+	hypothetical protein	NA	NA	NA	NA
WP_105765768.1\|1751480_1751711_+\|holin	holin	NA	NA	NA	NA
WP_105766254.1\|1751694_1752819_+	N-acetylmuramoyl-L-alanine amidase	A0A0P0I386	Lactobacillus_phage	1.3e-94	51.9
1753407:1753425	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP020018

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection