CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP026743	Lactiplantibacillus plantarum strain KC28 chromosome, complete genome	2 crisprs	DinG,DEDDh,cas3,csa3,WYL	0	0	10	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP026743_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026743_1

518722-518878

Orphan

Consensus_repeat	Method
AGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTACGAAAAA	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP026743_1

>merge|NZ_CP026743|1|518722-518878|PILER-CR
AGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTACGAAAAATACTAGTCAGACAACCAGTACAAGCAATCAAGAAGCTAACAGTGCCAAGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTGCGAAAAA

>NZ_CP026743|1|1|518722-518878|PILER-CR
AGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTACGAAAAA	TACTAGTCAGAC
AACCAGTACAAGCAATCAAGAAGCTAACAGTGCCAAGAGTATTAATCAAGCGACC	CGTACAAGCAATC
AAGAATCCAGTAGTGCGAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026743.1\|WP_003644193.1\|527664_528423_+\|competence-protein-ComK	unknown	unknown	gnl\|CDD\|368849
NZ_CP026743.1\|WP_021356757.1\|516328_517105_+\|DUF4422-domain-containing-protein	unknown	unknown	gnl\|CDD\|379595
NZ_CP026743.1\|WP_063490755.1\|508144_509038_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133028
NZ_CP026743.1\|WP_063490750.1\|515113_516193_+\|acyltransferase-family-protein	unknown	unknown	gnl\|CDD\|226122
NZ_CP026743.1\|WP_063490752.1\|512803_514024_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026743.1\|WP_003644190.1\|526324_526537_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026743.1\|WP_003645955.1\|528455_529259_+\|recombination-regulator-RecX	unknown	unknown	gnl\|CDD\|237619
NZ_CP026743.1\|WP_003643208.1\|526067_526295_-\|DUF2922-domain-containing-protein	unknown	unknown	gnl\|CDD\|378571
NZ_CP026743.1\|WP_063722014.1\|514020_515130_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377101
NZ_CP026743.1\|WP_027822090.1\|522265_523687_-\|flippase	unknown	unknown	gnl\|CDD\|240533
NZ_CP026743.1\|WP_013355415.1\|526881_527430_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NZ_CP026743.1\|WP_003643204.1\|521695_522136_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP026743.1\|WP_063490757.1\|505941_506940_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371500
NZ_CP026743.1\|WP_027822092.1\|517229_517976_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP026743.1\|WP_063490756.1\|506996_508094_+\|EpsG-family-protein	unknown	unknown	gnl\|CDD\|379716
NZ_CP026743.1\|WP_011101326.1\|525660_525966_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026743.1\|WP_003644191.1\|526651_526846_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026743.1\|WP_063490753.1\|512184_512817_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP026743.1\|WP_063490754.1\|509245_510667_+\|polysaccharide-biosynthesis-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|240533
NZ_CP026743.1\|WP_003643206.1\|524124_524793_-\|sugar-transferase	unknown	unknown	gnl\|CDD\|376775

Protein	Function_ID	Function_description	E-value
NZ_CP026743.1\|WP_003644193.1\|527664_528423_+\|competence-protein-ComK	gnl\|CDD\|368849	pfam06338, ComK, ComK protein. This family consists of several bacterial ComK proteins. The ComK protein of Bacillus subtilis positively regulates the transcription of several late competence genes as well as comK itself. It has been found that ClpX plays an important role in the regulation of ComK at the post-transcriptional level.	1.74267e-05
NZ_CP026743.1\|WP_021356757.1\|516328_517105_+\|DUF4422-domain-containing-protein	gnl\|CDD\|379595	pfam14393, DUF4422, Domain of unknown function (DUF4422). This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 255 and 371 amino acids in length.	1.45088e-120
NZ_CP026743.1\|WP_063490755.1\|508144_509038_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133028	cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.11769e-75
NZ_CP026743.1\|WP_063490750.1\|515113_516193_+\|acyltransferase-family-protein	gnl\|CDD\|226122	COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism].	2.65645e-15
NZ_CP026743.1\|WP_013355415.1\|526881_527430_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	3.09477e-08
NZ_CP026743.1\|WP_003645955.1\|528455_529259_+\|recombination-regulator-RecX	gnl\|CDD\|237619	PRK14135, recX, recombination regulator RecX; Provisional.	5.53268e-120
NZ_CP026743.1\|WP_003643208.1\|526067_526295_-\|DUF2922-domain-containing-protein	gnl\|CDD\|378571	pfam11148, DUF2922, Protein of unknown function (DUF2922). This bacterial family of proteins has no known function.	7.46609e-13
NZ_CP026743.1\|WP_063722014.1\|514020_515130_+\|hypothetical-protein	gnl\|CDD\|377101	pfam03699, UPF0182, Uncharacterized protein family (UPF0182). This family contains uncharacterized integral membrane proteins.	0.000537598
NZ_CP026743.1\|WP_027822090.1\|522265_523687_-\|flippase	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	1.42954e-41
NZ_CP026743.1\|WP_003643204.1\|521695_522136_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	3.5268e-13
NZ_CP026743.1\|WP_063490757.1\|505941_506940_+\|hypothetical-protein	gnl\|CDD\|371500	pfam11380, Stealth_CR2, Stealth protein CR2, conserved region 2. Stealth_CR2 is the second of several highly conserved regions on stealth proteins in metazoa and bacteria. There are up to four CR regions on all member proteins. CR2 carries a well-conserved NDD sequence-motif. The domain is found in tandem with CR1, CR3 and CR4 on both potential metazoan hosts and pathogenic eubacterial species that are capsular polysaccharide phosphotransferases. The CR domains appear on eukaryotic proteins such as GNPTAB, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta. Horizontal gene-transfer seems to have occurred between host and bacteria of these sequence-regions in order for the bacteria to evade detection by the host innate immune system.	5.63726e-50
NZ_CP026743.1\|WP_027822092.1\|517229_517976_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	3.68549e-18
NZ_CP026743.1\|WP_063490756.1\|506996_508094_+\|EpsG-family-protein	gnl\|CDD\|379716	pfam14897, EpsG, EpsG family. This family of proteins are related to the EpsG protein from B. subtilis. These proteins are likely glycosyl transferases belonging to the membrane protein GT-C clan.	2.67517e-15
NZ_CP026743.1\|WP_063490754.1\|509245_510667_+\|polysaccharide-biosynthesis-C-terminal-domain-containing-protein	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	5.84579e-40
NZ_CP026743.1\|WP_003643206.1\|524124_524793_-\|sugar-transferase	gnl\|CDD\|376775	pfam02397, Bac_transf, Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.	1.56324e-95

>NZ_CP026743.1|WP_027822092.1|517229_517976_-|helix-turn-helix-transcriptional-regulator
MNIARFTPLRISSSEQEFILNFSLLEHDLIHFFKIRDFDHAISRINKFKEVHPINWIDAEILNQLLLGLIGSLTAASYTHNLNLNDFLKLRLYFFNFIKKSPCTSSTFWPLSNDIITTYFNLLDNFDFHVSYQNLSKQVALTAYYISAHPQELTNSHGVLHTLNLNNDYTQKLFKKELGFSINAYIQHIKLSEAKRLLLQRQLSVGKIASLLHFYDTPTFSKTFKKAVGLSPLKYRELNYLSLTSQSY
>NZ_CP026743.1|WP_021356757.1|516328_517105_+|DUF4422-domain-containing-protein
MKVQIYVAAHKPYQMPQDPTYRPIFVGAAIHGGAPQNYQPDDVGDNISASNPNFNELTAMYWIWKNCHADVKGLNQYRRYLSEAPKRKLAGILSMTEIESLLQQYDVIVPKKRHYYIESNYSHYVHAHHREPLDMMRTVISERHAAYLDDFDQLMHQTSAHMFNMMIMAGPKFDDYAKWVFDILFAVRDRIDIADYDVQEARVFGYLSEFLLDVWINHNQLKYVEVPVMYMEKQQLPAKAYNLLKRKFFPQAAKRTHF
>NZ_CP026743.1|WP_063490750.1|515113_516193_+|acyltransferase-family-protein
MRKRIEWIDIAKGIAILAVVVGHTLGPYNGQFFGSLIFAFHMPIFFMLSGYLYHSRPARQECQRGIINLLLPYLATAVVLLVVSAIARLLPNPLLNAYFPSWRQGLIATAYGAGSAVFNPWHWQVQPIGAVWFLLSMFIALQLFNGVMLLTARRHQRWRQAIVRGGVFAIFAILGGWLGQVAYLPWAVNAALLAQLFLYAGYLVNQTALLSRISSAWYLLFTFMWLVSAFQGYFALTVPTSPNLLISVMGGVAGSLCIIRVSDWLSHYPNARPIKWLKRYGQLSLVVLCFHLIDLNVIGIEGWLTNHLITHMGPLVTTIIAISYRIGFVTVAMLAIPHLPGIRACFLPRQYLFRRLQRR
>NZ_CP026743.1|WP_063722014.1|514020_515130_+|hypothetical-protein
MNHQQAYRVQRLILIIALMLILFGDTGMNAVFSFSHQPQSIWFYPQLVIALITAAGPNLLLMALGAYQLRRTALTVPQLIRRVLWIIGGITLFSLAFYLEDLVTQGSLTSFNIAGFLTALAQAPVGFYDILYELLGFFVTLPLLRVIAHHASVAIQQYLFWAELVFIGMVPILAYFTGLTTISVNPPLAITAGCFFALMGYWLSQTEVLHRITREHLLVAWLLTCGCYAVMVSVTMYQVNLEKNFDLISSQPFAQTFQAIPCLTLWVTIATWMMNRPRSKAVRRHNFVQTGYGDMLVAGLLITPFMVINRLLTPIIGAWWSGWLWSIAVLIVSVELVWLLRHVRWLQRILPDLFGGSQLIGGSVNAQKN
>NZ_CP026743.1|WP_063490752.1|512803_514024_+|hypothetical-protein
MMRRRGASMQQHRNVLYLIIFGIYLASVTLQTTTFNEMIPHRVGVLLELATLAALLGLVVCLDTLTPGQIIGEVSLLVLVTVVTLTSGAHYLMPTIMLVIAAREVSFRQIIQVYLGVVGTILLLALVASEVGLIKNITFATADGLRQSFGVVYTTDFAAHIFYLCAAYLYLLARRFRLVALLPVLFGLAMIYQFTKTMTDVIALLVLISLYLVYIYRRQLRWLRPMIRYSFLMLPLASGLIIGLSNIFNYQDRLLVALNNTLSTRLALGNNALLAYGVKLFGQAPIPINGWGGDRFETFTNGVGDATYFFIDSSFLNMLISYGLLLTLIIIIGMTWFLYQRTRQHDYLLPVIFVAIAISSMFDQHFLEVTYNVFILMLFADLPNYQTAVGPAFDQPVVIRRGASCR
>NZ_CP026743.1|WP_063490753.1|512184_512817_+|hypothetical-protein
MRHMKVQPKERFSLAWRWLPLELLIIMLSVGLGWAGNRWLPKPVYQASVDIQIAQTPRSGLSTARLKRQRRQDIKAITQFNVMPHQSAVLTRASTYAYAHYGIWQPIQELSESVQAAPVARRPVLRVTATSSSRQVAQQNAQAFNVAIKANLTGLKNYRVKTVKRTVTRETNVIRGALWKLILVVGGGLALLSPYLVKYGQGWGRHDDET
>NZ_CP026743.1|WP_063490754.1|509245_510667_+|polysaccharide-biosynthesis-C-terminal-domain-containing-protein
MKLIKNYLYNVGYNILILLTPLLTVPYISRVLGPTGVGINATTNSVITYFLLAGTVGITIYGNREIAFIRDNRKKRSKTFWEIECLQLTTIAIAYIGFCIFLYLQKELRIYFFYQSFYIIAGAFDISWFFMGLEDFKKTVLRNMLVKLLSLVAIFTFVKTHNDVGIYILILSVSQLLGNMTLWPYLPKMVDAPKFKQMHIFKHLRPSLALFVPQVATTIYLAVNKTMLWKLDSVTASGYYDYSDKLVKIVLAVVTSTGTVMLPHIANLYANKKMKQVKEYLYTSFDFVLSISIPMALGIAALATALAPWFFGQQFSLVNKLLMIEAPVIVLIGLSNVIGQQFLLPTKQTFTYTVSVVLGAVTNIIVNVPLILAWGVYGAMVATLLSELAVTLYQLIRVRKALHMRRLFSNSLKYGVAGICMFIPVYLLNVNMKISTFSLAGQIIEGILFYVGVILILQPDILKKVTQLRKGKV
>NZ_CP026743.1|WP_063490755.1|508144_509038_+|glycosyltransferase-family-2-protein
MNSKSTCAIIVTYNRIELLKECIDKLLNQTTKINHILIFNNNSTDGTREWLAKMSESDQLIIINSPKNLGGAGGFSEAVRQGYIRTNDNYFWLMDDDTMPNKEALSSLQTYADNLHNHFGFLCSKVLWKDDSVVNVPILKANKWYSKLNDQILEVERATFVSVFFKRTSVAKVGIPAADMVIWGDDTEYTTRLSNESPSYLVLDSVVYHKTPIKISDVTIVNDDKNRMNRYFYGIRNNLAVSRMYSSRVKTVKIFLKDIKTIIQVLIASKDNKFFRIKTILKGMFVGLFFTPKIKKV
>NZ_CP026743.1|WP_063490756.1|506996_508094_+|EpsG-family-protein
MIYIYMTIFSMFFAYLYTSIEKIRIVDGIENNMTAKIEKYLFFTLSFLIICIPGMIRYNVGIDYTTYSSYQIPAVLGHQVVKVELLYKVVIWAGYWLGQGRTYQYIFAITNFLIVFFVFKYIKDQSTNVYLSILIFMMGGFFTFSLSGMRQSIGVAIVLYALKYIKEKRPILFLVFIGIATLFHSACILFVFFYIFKKIKINPFYMTLTMIFVFLLSGYIRQGIIFISDKLGLYSEYFGGQFDNGSFSKLLALVVIMMMCFVCFVYLQVPKAEFYKFNTEINLHYCACLVVAMIAKLPTPSRLLFLFIPIYITLVPNLGSVIKDARIRHLVYSAISVILVLFFIRFVLIQNTYGTVPYQDIFNLL
>NZ_CP026743.1|WP_063490757.1|505941_506940_+|hypothetical-protein
MTEEEYPVDIVVTWVNDDDIQWKTKRDKLAAQKQIQLHDERYRDFGTIKFFFRSIDKYCPWINKVFFITDHQVPDWLDVNNPKIKVIFHEDFIPGKYLPTFNSNVIELNLFRIKELSEHFVLFNDDTLVNHVTKKNDFFKNGLPKEFGLYDALTPKESFDHILVNDIAVINKYFVKNRSRIITSRKFLSFGYGKYLFKSLLLFPWKRVTGYYNSHLPASHLKSTFQHLVKIEPAMFEKTFVDNFRIPENEINQWLIKYWNVESGMFEPQRVDFGTFLEVNEIDRIEKSLFHAKYKVICLNDVELNEENSKIIGSKLNQMLSKKFSAKSNFEI
>NZ_CP026743.1|WP_003643204.1|521695_522136_+|MarR-family-transcriptional-regulator
MLNHQQIKAQFESLETLQSIQKQVHQMSIQGLVTTGISMREWEVLVYLEQHEQASASELAKVFKVTRTLISRNTWHLIQDNLIQPQIDQSDRRIVWLSLTTTGQETIGKVARQIQANLQAFDCNHELATLMKQLRYLKQQLIILNN
>NZ_CP026743.1|WP_027822090.1|522265_523687_-|flippase
MRIIRNYFYTAGYNLLILLTPLLTVPYISRVLGPTGVGINATTNSIITYFLLFGTVGITIYGNREIAFIRDNRGQRSQTFWEIEILQLLTISCAYLAFLVFLFFEHQLQIYFFYQSFYIIAGAVDISWYFMGLEDFKKTVLRNMLVKIASVIAIFIFVKTRQDTGIYILILAGSQVLGNLTLWPYLRHSVERPNWRQLNLFRHLRPSLALFVPQIATTVYLALNKTMLWQMDSLTAAGFYDYSDKLIKLVLALVTATGTVMLPHIANLFMKQQLERVKQYLYMSFDFVLAIAIPMALGVAAVATTLAPLFFGRAFWAVDRLLMIEAPVIILIGMSNVLGQQFLLPTKQTKTYTISVTIGALVNIACNIPLIWFWGVAGAMCATLISEVCVTGYQLFITRHVLHAQSLFTGIWKYTLAGGLMFTFVFRLNVTMTASYLNLCLQIGVGVLLYLGLILLLQPPVLRNAIKLRNNLH
>NZ_CP026743.1|WP_003643206.1|524124_524793_-|sugar-transferase
MELKEREIRPITIDAGRQHRRYGYRFIKRVFDFVASLLGLIILSPLFLLIAIAIKVEDPKGAVFYSQTRLGRGEVPFKMYKFRSMVSNADELLEKLLKDNEIDGAMFKMQDDPRVTKIGRFIRKYSIDELPQLLNVLQGSMSLVGPRPPLPREVEEYSDYDKQRLAVKPGCTGLWQATVRNSVGFDEMVKLDLTYISKRSVAFDVYILFKTVVIMFKPNGAY
>NZ_CP026743.1|WP_011101326.1|525660_525966_+|hypothetical-protein
MNDDWITVFPADYNNSYHLILKRGTAHYAYYYFKVDKLDQRVIFYDDIERSGISIKTQITRTFMRALVKAIDWHPVGNSIIIEIYPVDRQETKAMRLSCDI
>NZ_CP026743.1|WP_003643208.1|526067_526295_-|DUF2922-domain-containing-protein
MKTLDLSFKTSTNKVHHLKLHYANDNLSKDVVSKAMADLAATKLFVKDGENLVAEPLAAKYVETIETPIVTAPKA
>NZ_CP026743.1|WP_003644190.1|526324_526537_-|hypothetical-protein
MTKTWLKATLTVQTTTELDEQRKQTFNAIAQDATDEQLAAFGKIVEVLTGDQFTAANLANAYRYDPQPIA
>NZ_CP026743.1|WP_003644191.1|526651_526846_-|hypothetical-protein
MHIWMNTHVLLTVTDSNQRQFHQHWLADRELTDSDFTTLITILTPLFAEKIISITVRTITEFAD
>NZ_CP026743.1|WP_013355415.1|526881_527430_-|sigma-70-family-RNA-polymerase-sigma-factor
MHADRFDNQMAFDLLARPEHQHLLYGALKAAQVTKYHPQFEDCVTVAHLTWLSAYQNYAPELPANLPDFRKFAFRRIKWRTVDYLRKQTLRTQSQVNLEHALPITIDPMTEQETHWQLTALLTELLVQCRPGERIYLTEFFFEEQTVSSIMRRHQVSRRTVYNWRASLLVKAHKLYQQQTTN
>NZ_CP026743.1|WP_003644193.1|527664_528423_+|competence-protein-ComK
MLEINTDFEGDLPSMNQNIDVPHHVNTFWQCHAGTWDTRQPQRLLIIAQRSELATIDVLETLFLLDIKHLTCVENTLIFDRQRGLIKTKLTTRQIMMNYAGRLGLSGTQLIKQLAGELGLSKHKLPVIHGDAILMPLSTAKRGTTSWYNRHYLKHIEAQGFMTALVYDGQITIQVDMSERVATRQLAKAGQLQAALQEHHRRRLVPDQSVPSMADTDHEMMQSYTDQVLKHFGILALPGEISCLTRRFFGKL
>NZ_CP026743.1|WP_003645955.1|528455_529259_+|recombination-regulator-RecX
MTKKVTKIVAQKRAGRYNIYLDEQYAFPISESVMIKFRVFKGMEVDEQLQAAMIAADDVSKAYTRALDYLSHQLRTEKEVHDKLRDEEIDESVIDATMQQLRELRLLNDQQYADAFVRTAKRTSDKGPRVIRQNLRQKGVGEQLIDDALAGQFSAEEQIDNASELARKLAKRYHRQAFKTMQQKVRQGMMTKGFDNDTITAAIASLALEPDEDEQWEALVAQGAKLWQRNRKYAFRERMMRTKRSLFQKGFMMDDINRFIDEQVADE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP026743_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP026743_2

2212338-2212423

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP026743_2

>merge|NZ_CP026743|2|2212338-2212423|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>NZ_CP026743|2|1|2212338-2212423|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP026743.1\|WP_003642350.1\|2214326_2215121_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP026743.1\|WP_104880319.1\|2202540_2204871_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|119382
NZ_CP026743.1\|WP_104880320.1\|2209774_2210728_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP026743.1\|WP_003642338.1\|2200857_2202270_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NZ_CP026743.1\|WP_011102043.1\|2216112_2217108_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP026743.1\|WP_011102040.1\|2207109_2207676_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP026743.1\|WP_011102044.1\|2217844_2218738_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP026743.1\|WP_003643400.1\|2215117_2216116_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP026743.1\|WP_003642355.1\|2219031_2219778_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP026743.1\|WP_003642342.1\|2206222_2206951_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP026743.1\|WP_011102039.1\|2205724_2206090_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP026743.1\|WP_022638460.1\|2210844_2212323_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP026743.1\|WP_003643398.1\|2212440_2213040_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP026743.1\|WP_003642345.1\|2208988_2209555_-\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP026743.1\|WP_022638457.1\|2219794_2220250_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|100047
NZ_CP026743.1\|WP_003643401.1\|2217351_2217864_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP026743.1\|WP_044432936.1\|2213160_2214042_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP026743.1\|WP_003642357.1\|2220559_2221396_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP026743.1\|WP_003642344.1\|2207802_2208840_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP026743.1\|WP_003642340.1\|2205156_2205441_+\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097

Protein	Function_ID	Function_description	E-value
NZ_CP026743.1\|WP_003642350.1\|2214326_2215121_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP026743.1\|WP_104880319.1\|2202540_2204871_-\|SH3-domain-containing-protein	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	2.22238e-71
NZ_CP026743.1\|WP_104880320.1\|2209774_2210728_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	1.91883e-130
NZ_CP026743.1\|WP_003642338.1\|2200857_2202270_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NZ_CP026743.1\|WP_011102043.1\|2216112_2217108_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.80019e-78
NZ_CP026743.1\|WP_011102040.1\|2207109_2207676_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.31502e-05
NZ_CP026743.1\|WP_011102044.1\|2217844_2218738_-\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.15129e-131
NZ_CP026743.1\|WP_003643400.1\|2215117_2216116_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NZ_CP026743.1\|WP_003642355.1\|2219031_2219778_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP026743.1\|WP_003642342.1\|2206222_2206951_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
NZ_CP026743.1\|WP_011102039.1\|2205724_2206090_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
NZ_CP026743.1\|WP_022638460.1\|2210844_2212323_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.10264e-72
NZ_CP026743.1\|WP_003643398.1\|2212440_2213040_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP026743.1\|WP_003642345.1\|2208988_2209555_-\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	5.75015e-29
NZ_CP026743.1\|WP_022638457.1\|2219794_2220250_-\|hypothetical-protein	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	4.35635e-53
NZ_CP026743.1\|WP_003643401.1\|2217351_2217864_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
NZ_CP026743.1\|WP_044432936.1\|2213160_2214042_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.72098e-56
NZ_CP026743.1\|WP_003642357.1\|2220559_2221396_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.07613e-56
NZ_CP026743.1\|WP_003642344.1\|2207802_2208840_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NZ_CP026743.1\|WP_003642340.1\|2205156_2205441_+\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22

>NZ_CP026743.1|WP_022638460.1|2210844_2212323_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAETYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP026743.1|WP_104880320.1|2209774_2210728_-|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLEIVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKRENFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP026743.1|WP_003642345.1|2208988_2209555_-|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP026743.1|WP_003642344.1|2207802_2208840_+|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP026743.1|WP_011102040.1|2207109_2207676_-|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>NZ_CP026743.1|WP_003642342.1|2206222_2206951_+|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP026743.1|WP_011102039.1|2205724_2206090_-|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP026743.1|WP_003642340.1|2205156_2205441_+|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NZ_CP026743.1|WP_104880319.1|2202540_2204871_-|SH3-domain-containing-protein
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNNTNVHADATNATTTSSSAASTASSASVATSSAASDATTKATSVSSSAATQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKTASSAATSTSATATSQATSVASSTATTTQVSHTASSTAASAASSTATVKAVKAASSTVSSAATTATKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDATTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEITTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNVSVVGQYSAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>NZ_CP026743.1|WP_003642338.1|2200857_2202270_+|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL
>NZ_CP026743.1|WP_003643398.1|2212440_2213040_+|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP026743.1|WP_044432936.1|2213160_2214042_-|ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP026743.1|WP_003642350.1|2214326_2215121_+|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP026743.1|WP_003643400.1|2215117_2216116_+|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP026743.1|WP_011102043.1|2216112_2217108_+|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTSRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NZ_CP026743.1|WP_003643401.1|2217351_2217864_+|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP026743.1|WP_011102044.1|2217844_2218738_-|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITIAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP026743.1|WP_003642355.1|2219031_2219778_-|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP026743.1|WP_022638457.1|2219794_2220250_-|hypothetical-protein
MNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIKLADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP026743.1|WP_003642357.1|2220559_2221396_+|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVMLPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1128 : 35436

Lactobacillus_phage(54.17%)

holin,integrase,capsid,terminase,head,tail,portal

attL 4431:4445|attR 30681:30695

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_104880088.1\|1128_1965_+\|tail	phage tail family protein	NA	NA	NA	NA
WP_104880089.1\|2031_3219_+\|tail	phage tail protein	NA	NA	NA	NA
WP_104880090.1\|3193_3535_+	hypothetical protein	NA	NA	NA	NA
WP_104880091.1\|3552_3777_+	hypothetical protein	NA	NA	NA	NA
WP_158660474.1\|4022_4751_+	hypothetical protein	A0A291I9J9	Lactobacillus_phage	3.4e-56	44.9
4431:4445	attL	NA	NA	NA	NA
WP_104880093.1\|5118_5520_+	hypothetical protein	NA	NA	NA	NA
WP_104880094.1\|6657_7059_+	hypothetical protein	NA	NA	NA	NA
WP_104880095.1\|7074_7395_+	hypothetical protein	NA	NA	NA	NA
WP_104880096.1\|7384_7522_+	XkdX family protein	NA	NA	NA	NA
WP_104880097.1\|7686_8859_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.5e-199	89.5
WP_104880098.1\|9141_9519_+\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	1.2e-17	65.4
WP_052661610.1\|9873_10137_+	hypothetical protein	A9D9X7	Lactobacillus_prophage	1.8e-07	45.2
WP_104880099.1\|10218_10551_+	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_104880100.1\|10996_12199_-\|integrase	tyrosine-type recombinase/integrase	A0A126GGK4	Streptococcus_phage	9.0e-38	29.2
WP_158660475.1\|12357_12534_+	hypothetical protein	NA	NA	NA	NA
WP_104880101.1\|12507_13341_-	DUF4393 domain-containing protein	NA	NA	NA	NA
WP_104880102.1\|13665_14097_-	hypothetical protein	NA	NA	NA	NA
WP_104880103.1\|14089_14653_-	hypothetical protein	NA	NA	NA	NA
WP_104880104.1\|14751_15453_-	hypothetical protein	NA	NA	NA	NA
WP_104880105.1\|15510_15933_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_104880106.1\|15947_16451_-	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	1.1e-21	41.4
WP_060417532.1\|16597_16852_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_064971994.1\|17008_17290_-	hypothetical protein	NA	NA	NA	NA
WP_104880107.1\|17348_17531_+	hypothetical protein	NA	NA	NA	NA
WP_104880108.1\|17527_17926_-	DUF2513 domain-containing protein	A0A1P8L6H1	Staphylococcus_phage	8.7e-14	37.6
WP_003642789.1\|17925_18156_-	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-06	36.8
WP_003642790.1\|18298_18505_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_104880109.1\|18504_18801_+	hypothetical protein	NA	NA	NA	NA
WP_104880110.1\|18825_19008_+	hypothetical protein	NA	NA	NA	NA
WP_104880111.1\|19068_19623_+	hypothetical protein	O03909	Lactobacillus_phage	4.5e-93	94.6
WP_104880112.1\|19628_19916_+	DNA-binding protein	NA	NA	NA	NA
WP_174255161.1\|20016_20154_+	hypothetical protein	NA	NA	NA	NA
WP_104880113.1\|20295_20682_+	hypothetical protein	NA	NA	NA	NA
WP_104880114.1\|20678_21578_+	recombinase RecT	E9LUM3	Lactobacillus_phage	6.0e-63	47.7
WP_187345468.1\|21609_22362_+	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	5.0e-71	50.2
WP_095762473.1\|22440_23346_+	DnaD domain protein	NA	NA	NA	NA
WP_104880116.1\|23359_23860_+	hypothetical protein	O03915	Lactobacillus_phage	4.2e-82	87.3
WP_077143399.1\|23856_24237_+	hypothetical protein	NA	NA	NA	NA
WP_104880117.1\|24229_24388_+	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	8.7e-18	90.4
WP_154566810.1\|24390_24558_+	hypothetical protein	NA	NA	NA	NA
WP_104880443.1\|24586_24931_+	hypothetical protein	O03921	Lactobacillus_phage	2.9e-26	55.3
WP_104880118.1\|24923_25367_+	DUF1642 domain-containing protein	A0A2P0ZLB8	Lactobacillus_phage	2.4e-52	65.4
WP_003642805.1\|25779_26241_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_104880119.1\|27036_27249_+	hypothetical protein	NA	NA	NA	NA
WP_187345466.1\|27442_27625_+	hypothetical protein	NA	NA	NA	NA
WP_104880121.1\|27611_27926_+	hypothetical protein	A0A0A8WIH8	Clostridium_phage	1.7e-17	46.1
WP_063204162.1\|27983_28247_+	hypothetical protein	A0A1S5RCN3	Lactobacillus_phage	2.2e-29	70.9
WP_104880122.1\|28286_28802_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	6.1e-60	83.6
WP_104880123.1\|28794_30108_+\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	2.5e-126	54.6
WP_104880124.1\|30122_31859_+\|portal	phage portal protein	D2IZF6	Enterococcus_phage	1.6e-75	34.4
30681:30695	attR	NA	NA	NA	NA
WP_104880125.1\|31858_32770_+\|capsid	minor capsid protein	NA	NA	NA	NA
WP_104880126.1\|32880_33540_+	DUF4355 domain-containing protein	A0A2H4J4U9	uncultured_Caudovirales_phage	1.7e-06	28.2
WP_104880127.1\|33553_33925_+	hypothetical protein	A0A0K2CNR0	Brevibacillus_phage	1.7e-08	35.2
WP_104880128.1\|33940_35050_+\|capsid	major capsid protein	A0A2H4J022	uncultured_Caudovirales_phage	5.3e-61	40.1
WP_104880129.1\|35067_35436_+\|head,tail	phage head-tail connector protein	NA	NA	NA	NA

DBSCAN-SWA_2

45049 : 51643

Lactobacillus_phage(83.33%)

plate,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_104880135.1\|45049_47023_+	hypothetical protein	A0A291I9J9	Lactobacillus_phage	4.8e-129	43.2
WP_104880136.1\|47038_48139_+\|plate	phage baseplate upper protein	O03968	Lactobacillus_phage	9.9e-68	66.3
WP_104880094.1\|48161_48563_+	hypothetical protein	NA	NA	NA	NA
WP_104880095.1\|48578_48899_+	hypothetical protein	NA	NA	NA	NA
WP_104880137.1\|48898_49027_+	XkdX family protein	NA	NA	NA	NA
WP_104880097.1\|49191_50364_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.5e-199	89.5
WP_015380597.1\|50364_50661_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	1.2e-39	77.6
WP_104880098.1\|50647_51025_+\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	1.2e-17	65.4
WP_052661610.1\|51379_51643_+	hypothetical protein	A9D9X7	Lactobacillus_prophage	1.8e-07	45.2

DBSCAN-SWA_3

698246 : 708886

Lactobacillus_phage(90.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644269.1\|698246_699485_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	5.7e-221	99.7
WP_104880161.1\|699575_700547_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.8e-182	99.4
WP_003643099.1\|700732_701680_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_003643097.1\|702023_702638_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_104880162.1\|702640_705079_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.9
WP_003643095.1\|705166_705727_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_003643094.1\|705797_706238_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_003643092.1\|706582_707050_+	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	2.7e-83	100.0
WP_158048377.1\|707033_707255_+	hypothetical protein	A0A2P0ZL95	Lactobacillus_phage	1.3e-35	98.6
WP_054605159.1\|707191_708886_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.8e-92	41.3

DBSCAN-SWA_4

923987 : 961914

Lactobacillus_phage(59.09%)

integrase,capsid,terminase,head,tail,plate,portal

attL 923186:923199|attR 928517:928530

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
923186:923199	attL	NA	NA	NA	NA
WP_058011823.1\|923987_925208_-\|integrase	site-specific integrase	A0A0P0I3D2	Lactobacillus_phage	2.1e-82	41.1
WP_058011822.1\|926840_927272_-	hypothetical protein	O03904	Lactobacillus_phage	2.8e-66	83.6
WP_053566661.1\|927280_927679_-	helix-turn-helix transcriptional regulator	O03970	Lactobacillus_phage	3.6e-68	97.0
WP_058011821.1\|927846_928113_+	helix-turn-helix transcriptional regulator	O03906	Lactobacillus_phage	3.0e-39	96.6
WP_053566663.1\|928210_928525_-	hypothetical protein	NA	NA	NA	NA
WP_058011820.1\|928562_928799_-	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	5.9e-10	42.7
928517:928530	attR	NA	NA	NA	NA
WP_072536108.1\|928802_929138_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058011819.1\|929277_929484_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058011818.1\|929483_929780_+	hypothetical protein	NA	NA	NA	NA
WP_058011817.1\|929804_929987_+	hypothetical protein	NA	NA	NA	NA
WP_072536110.1\|930051_930600_+	hypothetical protein	NA	NA	NA	NA
WP_053566667.1\|930614_930878_+	hypothetical protein	NA	NA	NA	NA
WP_053566668.1\|931410_931920_+	hypothetical protein	NA	NA	NA	NA
WP_104880184.1\|931926_932595_+	AAA family ATPase	E9LUU1	Lactobacillus_phage	2.7e-92	75.1
WP_104880185.1\|932591_933137_+	DUF669 domain-containing protein	D2KRE3	Lactobacillus_phage	8.5e-28	46.0
WP_069710545.1\|933217_934006_+	DNA replication protein DnaD	NA	NA	NA	NA
WP_062688445.1\|933986_934829_+	ATP-binding protein	O03914	Lactobacillus_phage	4.6e-158	99.3
WP_061871421.1\|934961_935264_+	hypothetical protein	E9LUN7	Lactobacillus_phage	6.3e-41	81.0
WP_104880186.1\|935630_937394_-	hypothetical protein	NA	NA	NA	NA
WP_058011782.1\|937776_938205_+	transcriptional regulator	E9LUP5	Lactobacillus_phage	3.3e-59	77.3
WP_104880187.1\|938724_939207_+	hypothetical protein	NA	NA	NA	NA
WP_169484152.1\|939247_940096_+\|terminase	terminase small subunit	V5URT8	Oenococcus_phage	2.7e-44	42.0
WP_104880188.1\|941356_943015_+\|portal	phage portal protein	D2IYW2	Enterococcus_phage	1.4e-65	33.4
WP_104880189.1\|943014_943959_+\|capsid	minor capsid protein	NA	NA	NA	NA
WP_104880190.1\|944067_944715_+	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_053566685.1\|945812_946178_+\|head,tail	phage head-tail connector protein	A0A2H4IYR7	uncultured_Caudovirales_phage	6.8e-05	38.2
WP_072536128.1\|946182_946506_+	hypothetical protein	NA	NA	NA	NA
WP_104880191.1\|946495_947050_+\|tail	phage tail protein	NA	NA	NA	NA
WP_011101119.1\|947050_947437_+	hypothetical protein	NA	NA	NA	NA
WP_053566689.1\|947448_948036_+\|tail	phage tail protein	NA	NA	NA	NA
WP_011101121.1\|948053_948566_+	hypothetical protein	NA	NA	NA	NA
WP_011101122.1\|948634_948871_+	hypothetical protein	NA	NA	NA	NA
WP_104880192.1\|948870_952875_+	tape measure protein	E9LUR1	Lactobacillus_phage	5.2e-82	44.3
WP_011101124.1\|952868_953606_+	hypothetical protein	A0A1S5SA63	Streptococcus_phage	4.1e-41	36.6
WP_104880193.1\|953605_955456_+\|tail	phage tail protein	A0A1X9IGI5	Lactococcus_phage	7.8e-49	33.4
WP_103419954.1\|955460_956453_+	SGNH/GDSL hydrolase family protein	Q8LTH0	Staphylococcus_virus	4.8e-37	41.0
WP_011101127.1\|956467_957082_+\|plate	phage baseplate upper protein	A0A1J0MFQ3	Staphylococcus_phage	7.3e-44	47.8
WP_011101128.1\|957087_957828_+	hypothetical protein	NA	NA	NA	NA
WP_011101129.1\|957828_958149_+	DUF2977 domain-containing protein	NA	NA	NA	NA
WP_011101130.1\|958148_958325_+	XkdX family protein	NA	NA	NA	NA
WP_104880194.1\|958302_959460_+	LysM peptidoglycan-binding domain-containing protein	A0A2K9V5A4	Lactobacillus_phage	8.6e-46	67.2
WP_058011763.1\|959459_959723_+	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	8.5e-26	73.6
WP_058011762.1\|959736_960099_+	hypothetical protein	A0A2H4PBB2	Lactobacillus_phage	2.4e-18	67.1
WP_058011761.1\|960430_960637_-	hypothetical protein	NA	NA	NA	NA
WP_058011760.1\|960888_961113_-	hypothetical protein	NA	NA	NA	NA
WP_104880195.1\|961308_961914_+	lytic polysaccharide monooxygenase	A0A0K1Y848	Apis_mellifera_filamentous_virus	3.5e-14	28.7

DBSCAN-SWA_5

1085758 : 1158386

Lactobacillus_phage(52.94%)

holin,tRNA,integrase,capsid,head,terminase,tail,portal

attL 1085210:1085225|attR 1165384:1165399

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1085210:1085225	attL	NA	NA	NA	NA
WP_003644416.1\|1085758_1086613_+\|integrase	phage integrase N-terminal SAM-like domain-containing protein	NA	NA	NA	NA
WP_104880213.1\|1087113_1087896_+	hypothetical protein	NA	NA	NA	NA
WP_103152531.1\|1088145_1088505_-\|holin	holin	A0A2P0ZLG6	Lactobacillus_phage	3.0e-29	81.9
WP_103152532.1\|1088514_1088784_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.2e-29	81.9
WP_103152533.1\|1089802_1090162_-	hypothetical protein	E9LUR7	Lactobacillus_phage	3.8e-45	78.2
WP_187337756.1\|1090145_1090307_-	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	8.0e-19	94.3
WP_063487227.1\|1090310_1090562_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	1.6e-29	95.8
WP_103152534.1\|1090554_1093752_-	hypothetical protein	A0A2P0ZL34	Lactobacillus_phage	3.7e-187	56.8
WP_104880214.1\|1093769_1096181_-\|tail	phage tail protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	94.0
WP_103152536.1\|1096247_1098020_-\|tail	phage tail family protein	A0A2P0ZLH2	Lactobacillus_phage	8.8e-308	92.9
WP_104880215.1\|1098095_1103009_-	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	61.8
WP_103152538.1\|1103050_1103236_-	hypothetical protein	NA	NA	NA	NA
WP_104880216.1\|1103280_1103655_-\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	1.9e-58	95.2
WP_103152539.1\|1103734_1104391_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	6.9e-109	93.0
WP_103152540.1\|1104407_1104788_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	4.5e-60	92.9
WP_103152541.1\|1104787_1105195_-	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	5.3e-67	94.7
WP_104880217.1\|1105197_1105545_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.5e-54	91.3
WP_103152608.1\|1105545_1105827_-	hypothetical protein	A0A2P0ZLF2	Lactobacillus_phage	3.2e-39	91.2
WP_104880218.1\|1105956_1107786_-\|capsid	phage major capsid protein	A0A2P0ZLF9	Lactobacillus_phage	2.5e-148	62.5
WP_103152609.1\|1107751_1108876_-\|portal	phage portal protein	Q9AZM4	Lactococcus_phage	1.9e-69	42.6
WP_103152544.1\|1108914_1109100_-	DUF1056 family protein	NA	NA	NA	NA
WP_103152545.1\|1109122_1111042_-\|terminase	terminase large subunit	A0A286QRK5	Streptococcus_phage	2.7e-121	41.1
WP_158245746.1\|1111031_1111472_-\|terminase	phage terminase small subunit P27 family	A0A2P0VG04	Streptococcus_phage	1.0e-23	42.6
WP_103152547.1\|1112007_1112265_-	hypothetical protein	NA	NA	NA	NA
WP_103152548.1\|1112338_1112641_-	hypothetical protein	NA	NA	NA	NA
WP_103152549.1\|1112628_1112808_-	hypothetical protein	NA	NA	NA	NA
WP_103152550.1\|1112804_1113317_-	HNH endonuclease	E9LUN5	Lactobacillus_phage	1.2e-10	40.2
WP_103152551.1\|1113307_1114156_-	hypothetical protein	NA	NA	NA	NA
WP_103152552.1\|1114155_1114563_-	hypothetical protein	NA	NA	NA	NA
WP_103152553.1\|1114692_1115226_-	HNH endonuclease	A0A142F1H8	Bacillus_phage	3.9e-09	38.2
WP_103152554.1\|1115469_1116348_-	hypothetical protein	NA	NA	NA	NA
WP_033608711.1\|1117929_1118445_+	hypothetical protein	NA	NA	NA	NA
WP_104880219.1\|1118465_1119224_+	hypothetical protein	NA	NA	NA	NA
WP_103152556.1\|1119523_1120666_+\|integrase	site-specific integrase	A0A2H4JCB7	uncultured_Caudovirales_phage	9.1e-32	30.0
WP_003640551.1\|1120927_1121128_+	sterile alpha motif-like domain-containing protein	NA	NA	NA	NA
WP_003640552.1\|1121291_1121807_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_003644417.1\|1121834_1122269_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_003640554.1\|1122396_1123326_-	manganese-dependent inorganic pyrophosphatase	NA	NA	NA	NA
WP_003644418.1\|1123348_1124308_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003640556.1\|1124491_1126942_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	1.4e-93	31.9
WP_003640557.1\|1126955_1128962_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.6e-124	42.7
WP_003644419.1\|1129446_1130073_+	glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640559.1\|1130268_1131147_-	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_003638820.1\|1132607_1133150_-	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
WP_003640561.1\|1133133_1134078_-	tyrosine recombinase XerC	S5M872	Bacillus_phage	4.2e-14	26.5
WP_013355556.1\|1134157_1135483_-\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
WP_003645027.1\|1135761_1137909_-	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	4.1e-102	37.3
WP_003640564.1\|1137997_1138864_-	DNA-protecting protein DprA	NA	NA	NA	NA
WP_003640565.1\|1138942_1139710_-	ribonuclease HII	G4YAY0	Emiliania_huxleyi_virus	7.5e-22	35.6
WP_003640566.1\|1139702_1140557_-	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_003640567.1\|1141124_1142273_-	cobalamin-independent methionine synthase II family protein	A0A218MNE0	uncultured_virus	1.6e-47	33.2
WP_003640568.1\|1142462_1143392_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	9.1e-06	35.0
WP_003640569.1\|1143641_1144577_-	restriction endonuclease	NA	NA	NA	NA
WP_003640570.1\|1144763_1145462_-	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_003640571.1\|1145458_1146517_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_003640572.1\|1146801_1148277_-	MFS transporter	NA	NA	NA	NA
WP_003640573.1\|1148643_1150122_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	1.8e-19	29.9
WP_003640574.1\|1150151_1150373_-	YozE family protein	NA	NA	NA	NA
WP_003640575.1\|1150384_1151029_-	YpmS family protein	NA	NA	NA	NA
WP_003644430.1\|1151041_1151986_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_003640577.1\|1152135_1152987_-	DegV family protein	NA	NA	NA	NA
WP_003640578.1\|1153093_1153585_-	dihydrofolate reductase	A0A1L7N103	Ralstonia_phage	9.4e-18	37.9
WP_104880220.1\|1153594_1154545_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	3.8e-116	61.5
WP_003644431.1\|1154557_1156468_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	6.6e-51	28.4
WP_003640581.1\|1156653_1157106_-	hypothetical protein	NA	NA	NA	NA
WP_003640582.1\|1157162_1158386_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	1.3e-44	50.0
1165384:1165399	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1624722 : 1674325

Lactobacillus_phage(40.48%)

holin,protease,integrase,capsid,head,terminase,tail,portal

attL 1628335:1628351|attR 1674550:1674566

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644665.1\|1624722_1626453_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-46	27.6
WP_003641420.1\|1626680_1627073_-	YxeA family protein	NA	NA	NA	NA
WP_003644667.1\|1627295_1628147_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
1628335:1628351	attL	NA	NA	NA	NA
WP_104880255.1\|1628559_1629078_+	hypothetical protein	NA	NA	NA	NA
WP_104880256.1\|1629223_1629394_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	2.0e-07	63.0
WP_025015693.1\|1629617_1629992_-\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	2.2e-19	67.9
WP_016511341.1\|1629978_1630275_-	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	4.4e-39	77.6
WP_187345469.1\|1630275_1631391_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	7.5e-47	64.2
WP_104880257.1\|1631569_1632004_-	hypothetical protein	NA	NA	NA	NA
WP_104880258.1\|1632006_1632456_-	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	2.0e-22	41.1
WP_104880259.1\|1632477_1637733_-	hypothetical protein	Q6SE68	Lactobacillus_prophage	3.7e-144	59.4
WP_099739626.1\|1637747_1638080_-	hypothetical protein	V5UQS8	Oenococcus_phage	2.2e-42	73.4
WP_104880260.1\|1638123_1643955_-\|tail	phage tail protein	V5URV5	Oenococcus_phage	5.8e-231	41.2
WP_031275283.1\|1643970_1644234_-	hypothetical protein	V9QKH3	Oenococcus_phage	2.3e-23	65.4
WP_003642826.1\|1644341_1644740_-	hypothetical protein	V9QJA0	Oenococcus_phage	3.0e-46	74.8
WP_099447638.1\|1644839_1645223_-\|tail	phage tail protein	V5USQ9	Oenococcus_phage	1.8e-37	58.4
WP_003642824.1\|1645324_1645690_-	hypothetical protein	V5UQS4	Oenococcus_phage	3.0e-29	53.4
WP_003642823.1\|1645689_1646241_-	HK97 gp10 family phage protein	V5URV0	Oenococcus_phage	3.3e-64	61.7
WP_003642822.1\|1646242_1646590_-	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
WP_104880261.1\|1646589_1646922_-\|head,tail	phage head-tail connector protein	V9QJ97	Oenococcus_phage	8.8e-12	44.2
WP_104880262.1\|1646933_1647110_-	conjugal transfer protein	NA	NA	NA	NA
WP_003642819.1\|1647122_1648145_-\|capsid	major capsid protein	V5US24	Oenococcus_phage	3.7e-117	62.5
WP_104880263.1\|1648164_1648512_-	hypothetical protein	V5UTH9	Oenococcus_phage	1.2e-27	60.0
WP_104880264.1\|1648526_1649195_-	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	2.0e-15	32.6
WP_033609661.1\|1650741_1651038_-\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	1.1e-10	40.2
WP_104880265.1\|1650967_1652476_-\|portal	phage portal protein	V5US18	Oenococcus_phage	5.3e-136	51.6
WP_104880266.1\|1652487_1653726_-\|terminase	PBSX family phage terminase large subunit	M1PG09	Streptococcus_phage	1.0e-137	61.2
WP_104880267.1\|1653715_1654588_-\|terminase	terminase small subunit	V5URT8	Oenococcus_phage	1.2e-52	47.6
WP_024624622.1\|1654628_1654874_-	DUF2829 domain-containing protein	S5VZM6	Pseudomonas_phage	5.7e-16	51.9
WP_024624623.1\|1655086_1655293_+	CsbD family protein	NA	NA	NA	NA
WP_104880269.1\|1656329_1656977_+	hypothetical protein	NA	NA	NA	NA
WP_104880270.1\|1657218_1657668_-	hypothetical protein	B8R690	Lactobacillus_phage	1.4e-12	37.7
WP_074029814.1\|1657804_1657972_-	hypothetical protein	E9LUP4	Lactobacillus_phage	9.5e-15	91.5
WP_104880271.1\|1658044_1658641_-	hypothetical protein	E9LUN9	Lactobacillus_phage	8.5e-98	86.1
WP_063487884.1\|1658740_1658935_-	hypothetical protein	A0A2P0ZLB7	Lactobacillus_phage	9.1e-17	72.4
WP_104880272.1\|1658938_1659250_-	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	2.7e-47	90.3
WP_064578080.1\|1659252_1659627_-	hypothetical protein	NA	NA	NA	NA
WP_069302540.1\|1659623_1660124_-	hypothetical protein	O03915	Lactobacillus_phage	2.8e-86	92.2
WP_104880273.1\|1660137_1661088_-	DUF4373 domain-containing protein	NA	NA	NA	NA
WP_016527206.1\|1661177_1661573_-	single-stranded DNA-binding protein	D6PSU2	Lactobacillus_phage	2.5e-45	67.2
WP_063494033.1\|1661569_1662217_-	ERF family protein	D6PSU1	Lactobacillus_phage	3.0e-64	59.0
WP_063494032.1\|1662219_1662732_-	hypothetical protein	NA	NA	NA	NA
WP_187345472.1\|1662724_1662907_-	hypothetical protein	NA	NA	NA	NA
WP_022638124.1\|1663226_1663739_-	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	2.0e-23	39.4
WP_003642793.1\|1663806_1664112_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_003642792.1\|1664123_1664294_-	hypothetical protein	NA	NA	NA	NA
WP_011101086.1\|1664452_1664653_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101085.1\|1664799_1665036_+	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-09	30.7
WP_003642787.1\|1665073_1665388_+	hypothetical protein	NA	NA	NA	NA
WP_033099030.1\|1665444_1665699_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013355754.1\|1665844_1666348_+	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	1.7e-22	42.6
WP_013355755.1\|1666362_1666785_+	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	3.0e-12	35.1
WP_013355756.1\|1666891_1667611_+	hypothetical protein	NA	NA	NA	NA
WP_024002855.1\|1668083_1668875_+	hypothetical protein	NA	NA	NA	NA
WP_016527215.1\|1668884_1669139_+	hypothetical protein	NA	NA	NA	NA
WP_024002853.1\|1669217_1669592_+	hypothetical protein	A0A0P0I7G8	Lactobacillus_phage	1.9e-34	65.8
WP_003642778.1\|1669879_1670056_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.6e-10	51.7
WP_076638540.1\|1670291_1671332_+	DNA cytosine methyltransferase	A0A0R6PG08	Moraxella_phage	3.4e-86	49.4
WP_104880274.1\|1671336_1672386_+	DUF262 domain-containing protein	A0A0R6PKN1	Moraxella_phage	2.2e-48	35.7
WP_158660477.1\|1672441_1673107_+	hypothetical protein	A0A0R6PKK0	Moraxella_phage	5.5e-05	27.2
WP_104880275.1\|1673203_1674325_+\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	1.7e-46	32.7
1674550:1674566	attR	NA	NA	NA	NA

DBSCAN-SWA_7

1866516 : 1875027

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|1866516_1867095_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_024002687.1\|1867087_1868113_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	4.2e-60	40.7
WP_003642591.1\|1868109_1869564_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003645864.1\|1869548_1871768_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_011101895.1\|1871760_1872441_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|1872440_1872695_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|1872696_1873428_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003642586.1\|1873430_1874561_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|1874544_1875027_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

DBSCAN-SWA_8

3045711 : 3092900

Staphylococcus_virus(33.33%)

protease,transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_104880424.1\|3045711_3046275_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_057136819.1\|3046468_3047137_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_104880425.1\|3047286_3048792_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|3049056_3049425_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_104880426.1\|3049617_3051351_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	6.3e-93	41.5
WP_003641932.1\|3051305_3051815_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003641933.1\|3051845_3053042_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641934.1\|3053151_3053622_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|3053640_3054096_+	hypothetical protein	NA	NA	NA	NA
WP_047672626.1\|3054199_3054772_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003646441.1\|3054937_3055858_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_015825107.1\|3055994_3056894_+	oxidoreductase	NA	NA	NA	NA
WP_033608289.1\|3057333_3059214_+	hypothetical protein	NA	NA	NA	NA
WP_003646442.1\|3059385_3059832_-	ribonuclease H	NA	NA	NA	NA
WP_003641940.1\|3060069_3061596_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_015825109.1\|3061596_3062568_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_024971425.1\|3062645_3063977_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|3064442_3065960_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003643774.1\|3065974_3067804_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|3067818_3068541_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_158660478.1\|3074633_3075014_+	hypothetical protein	NA	NA	NA	NA
WP_033608294.1\|3076697_3076970_+	hypothetical protein	NA	NA	NA	NA
WP_050495849.1\|3077351_3077552_+	hypothetical protein	NA	NA	NA	NA
WP_053566430.1\|3077809_3078043_+	hypothetical protein	NA	NA	NA	NA
WP_003643792.1\|3078171_3078591_+	hypothetical protein	NA	NA	NA	NA
WP_053566431.1\|3078882_3079347_+	hypothetical protein	NA	NA	NA	NA
WP_015379760.1\|3079625_3080243_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_063722044.1\|3080246_3081401_-	MFS transporter	NA	NA	NA	NA
WP_011100993.1\|3081404_3082196_-	HAD family hydrolase	NA	NA	NA	NA
WP_003641965.1\|3082266_3083139_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_053566435.1\|3083298_3084114_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_003643798.1\|3084639_3086016_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_104880427.1\|3086060_3087245_+	cation:proton antiporter	NA	NA	NA	NA
WP_003643800.1\|3087905_3088049_+	hypothetical protein	NA	NA	NA	NA
WP_050495850.1\|3088060_3088249_+	hypothetical protein	NA	NA	NA	NA
WP_071665317.1\|3088518_3088725_-	hypothetical protein	NA	NA	NA	NA
WP_080029873.1\|3088694_3089024_-\|transposase	transposase	NA	NA	NA	NA
WP_117288141.1\|3089130_3089334_-\|transposase	transposase	NA	NA	NA	NA
WP_003643802.1\|3089489_3090005_+	cation:proton antiporter	NA	NA	NA	NA
WP_003641969.1\|3090209_3090413_+	hypothetical protein	NA	NA	NA	NA
WP_104880428.1\|3090824_3091493_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_046947768.1\|3092753_3092900_+\|bacteriocin	bacteriocin	NA	NA	NA	NA

DBSCAN-SWA_9

3096329 : 3155421

Tupanvirus(22.22%)

protease,tRNA,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646470.1\|3096329_3097103_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|3097201_3097360_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|3097384_3097555_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_003641986.1\|3097821_3099972_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_003641987.1\|3099988_3101365_+	HlyD family secretion protein	NA	NA	NA	NA
WP_003641990.1\|3102211_3102880_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641991.1\|3102966_3103647_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_104880429.1\|3103740_3104427_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641993.1\|3104564_3104768_+	hypothetical protein	NA	NA	NA	NA
WP_046947770.1\|3104862_3107172_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_021356643.1\|3107430_3108207_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003643815.1\|3108646_3109663_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003641997.1\|3110068_3110779_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003641998.1\|3110851_3112213_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641999.1\|3112219_3112408_+	hypothetical protein	NA	NA	NA	NA
WP_046947771.1\|3112397_3112820_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003643816.1\|3113042_3114398_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642002.1\|3114415_3115852_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_011101006.1\|3115972_3116869_+	ROK family protein	NA	NA	NA	NA
WP_003642004.1\|3117018_3117765_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_046947772.1\|3117877_3118891_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_046947773.1\|3119344_3120478_+	hypothetical protein	NA	NA	NA	NA
WP_003643820.1\|3120482_3121277_+	hypothetical protein	NA	NA	NA	NA
WP_003642008.1\|3121444_3122362_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_104880430.1\|3122407_3123682_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_027821492.1\|3123674_3124634_+	hypothetical protein	NA	NA	NA	NA
WP_027821491.1\|3124655_3125360_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_027821490.1\|3125359_3126202_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_024971611.1\|3126796_3127186_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003643823.1\|3127507_3129559_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_003642016.1\|3129791_3130976_+	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_104880431.1\|3131098_3131875_+	TatD family hydrolase	NA	NA	NA	NA
WP_063488739.1\|3131861_3132425_+	ribonuclease M5	NA	NA	NA	NA
WP_003642019.1\|3132421_3133312_+	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_003642020.1\|3133416_3133668_+	Veg family protein	NA	NA	NA	NA
WP_104880432.1\|3133800_3134667_+	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642022.1\|3134976_3135921_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003642023.1\|3136189_3136888_+	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_003646500.1\|3136880_3137678_+	metal ABC transporter permease	NA	NA	NA	NA
WP_162899478.1\|3138046_3138208_+	hypothetical protein	NA	NA	NA	NA
WP_003642028.1\|3138757_3139300_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_003642029.1\|3139314_3139578_+	hypothetical protein	NA	NA	NA	NA
WP_003642030.1\|3140070_3140907_+	pur operon repressor	NA	NA	NA	NA
WP_104880433.1\|3140975_3142358_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_063722865.1\|3142593_3143418_+	serine hydrolase	NA	NA	NA	NA
WP_003643830.1\|3143783_3144764_+	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_015379808.1\|3145052_3146075_+	YdcF family protein	NA	NA	NA	NA
WP_024971609.1\|3146157_3147144_+	hypothetical protein	NA	NA	NA	NA
WP_015379810.1\|3147312_3148122_-	sugar-phosphatase	NA	NA	NA	NA
WP_169484456.1\|3148141_3149500_-	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_024971479.1\|3149508_3150441_-	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_003642040.1\|3150803_3151244_+	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003642041.1\|3151288_3151897_+	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642042.1\|3152069_3153683_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_104880434.1\|3154149_3155421_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.4e-96	43.7

DBSCAN-SWA_10

3278957 : 3291812

Lactobacillus_phage(71.43%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_104880106.1\|3278957_3279461_-	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	1.1e-21	41.4
WP_060417532.1\|3279607_3279862_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_064971994.1\|3280018_3280300_-	hypothetical protein	NA	NA	NA	NA
WP_104880107.1\|3280358_3280541_+	hypothetical protein	NA	NA	NA	NA
WP_104880108.1\|3280537_3280936_-	DUF2513 domain-containing protein	A0A1P8L6H1	Staphylococcus_phage	8.7e-14	37.6
WP_003642789.1\|3280935_3281166_-	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-06	36.8
WP_003642790.1\|3281308_3281515_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_104880109.1\|3281514_3281811_+	hypothetical protein	NA	NA	NA	NA
WP_104880110.1\|3281835_3282018_+	hypothetical protein	NA	NA	NA	NA
WP_104880111.1\|3282078_3282633_+	hypothetical protein	O03909	Lactobacillus_phage	4.5e-93	94.6
WP_104880112.1\|3282638_3282926_+	DNA-binding protein	NA	NA	NA	NA
WP_174255161.1\|3283026_3283164_+	hypothetical protein	NA	NA	NA	NA
WP_104880113.1\|3283305_3283692_+	hypothetical protein	NA	NA	NA	NA
WP_104880114.1\|3283688_3284588_+	recombinase RecT	E9LUM3	Lactobacillus_phage	6.0e-63	47.7
WP_187345468.1\|3284619_3285372_+	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	5.0e-71	50.2
WP_095762473.1\|3285450_3286356_+	DnaD domain protein	NA	NA	NA	NA
WP_104880116.1\|3286369_3286870_+	hypothetical protein	O03915	Lactobacillus_phage	4.2e-82	87.3
WP_077143399.1\|3286866_3287247_+	hypothetical protein	NA	NA	NA	NA
WP_104880117.1\|3287239_3287398_+	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	8.7e-18	90.4
WP_154566810.1\|3287400_3287568_+	hypothetical protein	NA	NA	NA	NA
WP_104880443.1\|3287596_3287941_+	hypothetical protein	O03921	Lactobacillus_phage	2.9e-26	55.3
WP_104880118.1\|3287933_3288377_+	DUF1642 domain-containing protein	A0A2P0ZLB8	Lactobacillus_phage	2.4e-52	65.4
WP_003642805.1\|3288789_3289251_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_104880119.1\|3290047_3290260_+	hypothetical protein	NA	NA	NA	NA
WP_187345466.1\|3290453_3290636_+	hypothetical protein	NA	NA	NA	NA
WP_104880121.1\|3290622_3290937_+	hypothetical protein	A0A0A8WIH8	Clostridium_phage	1.7e-17	46.1
WP_063204162.1\|3290993_3291257_+	hypothetical protein	A0A1S5RCN3	Lactobacillus_phage	2.2e-29	70.9
WP_104880122.1\|3291296_3291812_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	6.1e-60	83.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP026743

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection