CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP025992	Lactiplantibacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2A, complete sequence	0 crisprs	NA	1
NZ_CP025991	Lactiplantibacillus plantarum subsp. plantarum strain LB1-2 chromosome, complete genome	1 crisprs	cas3,DEDDh,DinG,csa3,WYL	10
NZ_CP025994	Lactiplantibacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2C, complete sequence	0 crisprs	NA	0
NZ_CP025993	Lactiplantibacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2B, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

21167 : 74312

Bacillus_phage(20.0%)

transposase,integrase

attL 21565:21582|attR 57900:57917

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_103420744.1\|21167_22019_-\|integrase	phage integrase N-terminal SAM-like domain-containing protein	NA	NA	NA	NA
21565:21582	attL	NA	NA	NA	NA
WP_103420746.1\|24859_25237_+	YxeA family protein	NA	NA	NA	NA
WP_103420749.1\|26802_31425_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_103420751.1\|32079_33585_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_103420753.1\|34055_34217_+	hypothetical protein	NA	NA	NA	NA
WP_103420757.1\|34682_34976_-\|transposase	transposase	NA	NA	NA	NA
WP_187344406.1\|39948_42225_+	bacterial Ig-like domain-containing protein	NA	NA	NA	NA
WP_103420761.1\|42237_42657_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_103420763.1\|42900_43746_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_158664267.1\|44320_44416_+	hypothetical protein	NA	NA	NA	NA
WP_103420765.1\|44941_45214_+	hypothetical protein	NA	NA	NA	NA
WP_103420771.1\|46175_46871_+	hypothetical protein	NA	NA	NA	NA
WP_103420773.1\|46924_48004_+	tyrosine recombinase XerS	A0A1B1IQT7	uncultured_Mediterranean_phage	3.3e-07	31.3
WP_103420775.1\|48088_48757_+	Fic family protein	NA	NA	NA	NA
WP_103420777.1\|48876_49071_+	hypothetical protein	A0A1I9KKG0	Lactobacillus_phage	5.1e-20	71.7
WP_103420779.1\|50001_50685_-	hypothetical protein	NA	NA	NA	NA
WP_158664268.1\|50871_51576_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	2.1e-23	36.2
WP_103420783.1\|51843_53145_+	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	5.8e-75	38.0
WP_103420785.1\|53137_53458_+	acetyl-CoA carboxylase	NA	NA	NA	NA
WP_103420787.1\|53450_53810_+	hypothetical protein	NA	NA	NA	NA
WP_103420788.1\|53884_54316_-	hypothetical protein	NA	NA	NA	NA
WP_103420789.1\|54482_55283_+	manganese catalase family protein	NA	NA	NA	NA
WP_158664269.1\|55638_56349_-	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_072535544.1\|56694_56976_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	8.8e-13	42.7
WP_106427228.1\|56885_57839_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.4e-38	33.7
WP_103420796.1\|60394_61297_-	hypothetical protein	NA	NA	NA	NA
57900:57917	attR	NA	NA	NA	NA
WP_103420798.1\|61311_63573_-	hypothetical protein	NA	NA	NA	NA
WP_103420800.1\|63562_64567_-	hypothetical protein	NA	NA	NA	NA
WP_103420802.1\|64563_66564_-	hypothetical protein	NA	NA	NA	NA
WP_103420804.1\|66550_67441_-	ABC transporter permease	NA	NA	NA	NA
WP_103420806.1\|67424_68384_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.6e-19	27.7
WP_103420810.1\|68380_68857_-	beta-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
WP_103420812.1\|68856_69165_-	acyl carrier protein	NA	NA	NA	NA
WP_103420814.1\|69157_69865_-	3-oxoacyl-ACP reductase FabG	F2NZ40	Diadromus_pulchellus_ascovirus	1.7e-07	27.6
WP_158664270.1\|69875_70736_-	hypothetical protein	NA	NA	NA	NA
WP_103420818.1\|70903_71833_-\|transposase	IS30 family transposase	H7BW47	unidentified_phage	7.0e-22	32.8
WP_187344405.1\|72188_72749_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_103420824.1\|73313_74312_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.6e-51	37.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP025991

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP025991_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025991_1

2815886-2815971

Orphan

Consensus_repeat	Method
AATAAGATACTTTAAGTTTCTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025991_1

>merge|NZ_CP025991|1|2815886-2815971|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTATTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCGAATAAGACACTTTAAGTTTCTTA

>NZ_CP025991|1|1|2815886-2815971|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTA	TTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCG
AATAAGACACTTTAAGTTTCTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025991.1\|WP_003642350.1\|2813187_2813982_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP025991.1\|WP_033608962.1\|2823437_2826020_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|119382
NZ_CP025991.1\|WP_003642345.1\|2818753_2819320_+\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP025991.1\|WP_003642338.1\|2826290_2827703_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NZ_CP025991.1\|WP_022638457.1\|2808058_2808514_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|100047
NZ_CP025991.1\|WP_022638460.1\|2815985_2817464_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP025991.1\|WP_103420560.1\|2822867_2823152_-\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP025991.1\|WP_003642344.1\|2819468_2820506_-\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP025991.1\|WP_011102040.1\|2820632_2821199_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP025991.1\|WP_011102044.1\|2809570_2810464_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP025991.1\|WP_103420558.1\|2821357_2822086_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP025991.1\|WP_003642346.1\|2817580_2818534_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP025991.1\|WP_003643398.1\|2815268_2815868_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP025991.1\|WP_003643401.1\|2810444_2810957_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP025991.1\|WP_003643400.1\|2812192_2813191_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP025991.1\|WP_044432936.1\|2814266_2815148_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP025991.1\|WP_011102039.1\|2822218_2822584_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP025991.1\|WP_003642355.1\|2808530_2809277_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP025991.1\|WP_011102046.1\|2806912_2807749_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP025991.1\|WP_011102043.1\|2811200_2812196_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439

Protein	Function_ID	Function_description	E-value
NZ_CP025991.1\|WP_003642350.1\|2813187_2813982_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP025991.1\|WP_033608962.1\|2823437_2826020_+\|SH3-domain-containing-protein	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	2.86064e-70
NZ_CP025991.1\|WP_003642345.1\|2818753_2819320_+\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	5.75015e-29
NZ_CP025991.1\|WP_003642338.1\|2826290_2827703_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NZ_CP025991.1\|WP_022638457.1\|2808058_2808514_+\|hypothetical-protein	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	4.35635e-53
NZ_CP025991.1\|WP_022638460.1\|2815985_2817464_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.10264e-72
NZ_CP025991.1\|WP_103420560.1\|2822867_2823152_-\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	6.42866e-21
NZ_CP025991.1\|WP_003642344.1\|2819468_2820506_-\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NZ_CP025991.1\|WP_011102040.1\|2820632_2821199_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.31502e-05
NZ_CP025991.1\|WP_011102044.1\|2809570_2810464_+\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.15129e-131
NZ_CP025991.1\|WP_103420558.1\|2821357_2822086_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.99547e-89
NZ_CP025991.1\|WP_003642346.1\|2817580_2818534_+\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	5.65843e-131
NZ_CP025991.1\|WP_003643398.1\|2815268_2815868_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP025991.1\|WP_003643401.1\|2810444_2810957_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
NZ_CP025991.1\|WP_003643400.1\|2812192_2813191_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NZ_CP025991.1\|WP_044432936.1\|2814266_2815148_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.72098e-56
NZ_CP025991.1\|WP_011102039.1\|2822218_2822584_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
NZ_CP025991.1\|WP_003642355.1\|2808530_2809277_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP025991.1\|WP_011102046.1\|2806912_2807749_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.88105e-54
NZ_CP025991.1\|WP_011102043.1\|2811200_2812196_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.80019e-78

>NZ_CP025991.1|WP_003643398.1|2815268_2815868_-|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP025991.1|WP_044432936.1|2814266_2815148_+|ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP025991.1|WP_003642350.1|2813187_2813982_-|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP025991.1|WP_003643400.1|2812192_2813191_-|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP025991.1|WP_011102043.1|2811200_2812196_-|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTSRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NZ_CP025991.1|WP_003643401.1|2810444_2810957_-|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP025991.1|WP_011102044.1|2809570_2810464_+|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITIAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP025991.1|WP_003642355.1|2808530_2809277_+|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP025991.1|WP_022638457.1|2808058_2808514_+|hypothetical-protein
MNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIKLADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP025991.1|WP_011102046.1|2806912_2807749_-|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVILPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY
>NZ_CP025991.1|WP_022638460.1|2815985_2817464_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAETYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP025991.1|WP_003642346.1|2817580_2818534_+|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP025991.1|WP_003642345.1|2818753_2819320_+|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP025991.1|WP_003642344.1|2819468_2820506_-|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP025991.1|WP_011102040.1|2820632_2821199_+|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>NZ_CP025991.1|WP_103420558.1|2821357_2822086_-|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLPHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP025991.1|WP_011102039.1|2822218_2822584_+|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP025991.1|WP_103420560.1|2822867_2823152_-|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGGVVAVTVTAID
>NZ_CP025991.1|WP_033608962.1|2823437_2826020_+|SH3-domain-containing-protein
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNNTNVHADATNATTTSSSAASTASSASVATSSAASDATTKATSVSSSAATQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKTASSAATSTSATATSQATSVASSTATTTQVSHTASSTAASAASSTATVKAVKAASSTVSSAATTATKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEITTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTTTSSKSTATASAKTVAQSGTYKFAKTTAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYSAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>NZ_CP025991.1|WP_003642338.1|2826290_2827703_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

932 : 25815

Lactobacillus_phage(45.83%)

portal,tail,head,terminase,lysis,plate,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_103419771.1\|932_1118_+	hypothetical protein	E9LUP6	Lactobacillus_phage	2.1e-07	60.9
WP_103419773.1\|1083_1275_+	hypothetical protein	NA	NA	NA	NA
WP_103419775.1\|1288_1504_+	hypothetical protein	A0A2P0ZLC2	Lactobacillus_phage	3.0e-05	52.5
WP_164906367.1\|1515_1665_+	hypothetical protein	NA	NA	NA	NA
WP_080396931.1\|2299_3589_+\|terminase	PBSX family phage terminase large subunit	G8FUZ2	Pediococcus_virus	8.3e-207	79.9
WP_103420666.1\|3615_5154_+\|portal	phage portal protein	G8FUZ1	Pediococcus_virus	1.5e-191	66.4
WP_103419777.1\|5071_5878_+\|capsid	minor capsid protein	G8FUZ0	Pediococcus_virus	1.5e-100	66.4
WP_103419779.1\|5893_6115_+	hypothetical protein	NA	NA	NA	NA
WP_103419781.1\|6257_6848_+	DUF4355 domain-containing protein	Q597V6	Lactobacillus_virus	3.7e-21	42.5
WP_103419783.1\|6867_7728_+\|capsid	phage capsid protein	K4I067	Lactobacillus_virus	2.8e-142	89.9
WP_103420668.1\|7748_8003_+	Ig-like domain-containing protein	G8FUY7	Pediococcus_virus	3.5e-16	64.9
WP_058906820.1\|8062_8401_+\|head,tail	phage head-tail connector protein	K4I470	Lactobacillus_virus	3.3e-46	78.6
WP_103419785.1\|8397_8676_+	hypothetical protein	G8FUY5	Pediococcus_virus	1.4e-31	73.9
WP_103419787.1\|8668_9055_+	hypothetical protein	G8FUY4	Pediococcus_virus	1.3e-38	67.8
WP_102124501.1\|9045_9399_+	hypothetical protein	K4I072	Lactobacillus_virus	3.9e-42	72.6
WP_103419789.1\|9418_10207_+\|tail	phage major tail protein, TP901-1 family	Q597U9	Lactobacillus_virus	3.0e-98	91.6
WP_103419791.1\|10227_10641_+	hypothetical protein	A0A2K9VBY8	Lactobacillus_phage	1.8e-38	59.1
WP_103419793.1\|10706_10949_+	hypothetical protein	A0A2P0ZL20	Lactobacillus_phage	3.2e-11	47.4
WP_103419795.1\|10961_14402_+\|tail	phage tail tape measure protein	A0A2P0ZL32	Lactobacillus_phage	8.6e-17	53.6
WP_103419797.1\|14414_15674_+\|tail	phage tail family protein	A0A2P0ZL23	Lactobacillus_phage	2.3e-121	51.1
WP_103419799.1\|15688_17902_+\|tail	phage tail protein	Q597U4	Lactobacillus_virus	0.0e+00	78.5
WP_103419801.1\|17891_20354_+\|plate	BppU family phage baseplate upper protein	A0A291I9J9	Lactobacillus_phage	6.7e-173	46.8
WP_103419803.1\|20412_20796_+	hypothetical protein	A0A2P0ZLF7	Lactobacillus_phage	3.0e-64	92.1
WP_103419805.1\|20798_20993_+	hypothetical protein	A0A2P0ZLG4	Lactobacillus_phage	1.2e-21	90.6
WP_103419807.1\|20992_21277_+\|lysis	lysis protein	A0A2P0ZLE8	Lactobacillus_phage	1.0e-40	96.8
WP_103419809.1\|21276_22347_+	LysM peptidoglycan-binding domain-containing protein	A0A2P0ZLG2	Lactobacillus_phage	4.3e-100	61.2
WP_003646619.1\|23224_23416_+	hypothetical protein	NA	NA	NA	NA
WP_003642761.1\|23820_25815_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.2e-32	41.3

DBSCAN-SWA_2

687838 : 707078

Lactobacillus_phage(50.0%)

integrase,tail,holin,head,plate

attL 684674:684688|attR 714660:714674

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
684674:684688	attL	NA	NA	NA	NA
WP_079111789.1\|687838_688003_+\|integrase	tyrosine-type recombinase/integrase	A0A0P0I3D2	Lactobacillus_phage	8.5e-08	49.0
WP_103419938.1\|689020_689560_+	hypothetical protein	NA	NA	NA	NA
WP_103419940.1\|689671_690643_+	ETX/MTX2 family pore-forming toxin	NA	NA	NA	NA
WP_103419942.1\|690965_691571_-	lytic polysaccharide monooxygenase	A0A0K1Y848	Apis_mellifera_filamentous_virus	3.5e-14	30.0
WP_058011760.1\|691766_691991_+	hypothetical protein	NA	NA	NA	NA
WP_141654610.1\|692239_692449_+	hypothetical protein	NA	NA	NA	NA
WP_103419944.1\|692781_693144_-\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	5.3e-18	67.1
WP_058011763.1\|693157_693421_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	8.5e-26	73.6
WP_103419946.1\|693420_694578_-	LysM peptidoglycan-binding domain-containing protein	A0A2K9V5A4	Lactobacillus_phage	2.3e-43	65.6
WP_103419948.1\|694555_694732_-	XkdX family protein	NA	NA	NA	NA
WP_103419950.1\|694731_695052_-	DUF2977 domain-containing protein	NA	NA	NA	NA
WP_103419952.1\|695051_695792_-	hypothetical protein	NA	NA	NA	NA
WP_011101127.1\|695797_696412_-\|plate	phage baseplate upper protein	A0A1J0MFQ3	Staphylococcus_phage	7.3e-44	47.8
WP_103419954.1\|696426_697419_-	SGNH/GDSL hydrolase family protein	Q8LTH0	Staphylococcus_virus	4.8e-37	41.0
WP_011101124.1\|699284_700022_-	hypothetical protein	A0A1S5SA63	Streptococcus_phage	4.1e-41	36.6
WP_103419956.1\|700015_704020_-	tape measure protein	E9LUR1	Lactobacillus_phage	1.2e-81	44.0
WP_011101122.1\|704019_704256_-	hypothetical protein	NA	NA	NA	NA
WP_103419958.1\|704324_704837_-	hypothetical protein	NA	NA	NA	NA
WP_053566689.1\|704854_705442_-\|tail	phage tail protein	NA	NA	NA	NA
WP_011101119.1\|705453_705840_-	hypothetical protein	NA	NA	NA	NA
WP_103419960.1\|705840_706395_-\|tail	phage tail protein	NA	NA	NA	NA
WP_103419962.1\|706384_706708_-	hypothetical protein	NA	NA	NA	NA
WP_103419964.1\|706712_707078_-\|head,tail	phage head-tail connector protein	H9A0V3	Staphylococcus_phage	3.0e-05	38.2
714660:714674	attR	NA	NA	NA	NA

DBSCAN-SWA_3

718384 : 730304

Lactobacillus_phage(90.0%)

integrase

attL 717399:717410|attR 730409:730420

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
717399:717410	attL	NA	NA	NA	NA
WP_103419976.1\|718384_718687_-	hypothetical protein	E9LUN7	Lactobacillus_phage	1.1e-40	81.0
WP_062688445.1\|718819_719662_-	ATP-binding protein	O03914	Lactobacillus_phage	4.6e-158	99.3
WP_069710545.1\|719642_720431_-	DNA replication protein DnaD	NA	NA	NA	NA
WP_069710544.1\|720511_721057_-	DUF669 domain-containing protein	D2KRE3	Lactobacillus_phage	3.8e-28	46.0
WP_103419978.1\|721053_721722_-	AAA family ATPase	E9LUU1	Lactobacillus_phage	3.9e-91	74.7
WP_053566668.1\|721728_722238_-	hypothetical protein	NA	NA	NA	NA
WP_053566667.1\|722770_723034_-	hypothetical protein	NA	NA	NA	NA
WP_103419980.1\|723048_723597_-	hypothetical protein	NA	NA	NA	NA
WP_062688435.1\|723661_723865_-	hypothetical protein	NA	NA	NA	NA
WP_062688431.1\|724285_724684_+	helix-turn-helix transcriptional regulator	O03970	Lactobacillus_phage	7.1e-40	60.6
WP_062688429.1\|724692_725124_+	hypothetical protein	O03904	Lactobacillus_phage	7.3e-67	83.7
WP_103419982.1\|725469_725901_+	universal stress protein	A0A2P0ZL98	Lactobacillus_phage	9.0e-49	65.0
WP_080453314.1\|726566_726743_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	6.3e-09	55.2
WP_103419984.1\|726914_727880_+	AAA family ATPase	A0A1X9IGI7	Lactococcus_phage	3.0e-28	34.5
WP_053339036.1\|727872_728310_+	hypothetical protein	NA	NA	NA	NA
WP_103419986.1\|728312_728996_+	hypothetical protein	NA	NA	NA	NA
WP_103419988.1\|729089_730304_+\|integrase	site-specific integrase	A0A0P0I3D2	Lactobacillus_phage	9.9e-77	39.4
730409:730420	attR	NA	NA	NA	NA

DBSCAN-SWA_4

945456 : 953145

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060683890.1\|945456_945696_-	DUF11 domain-containing protein	A0A2P0ZL95	Lactobacillus_phage	1.8e-35	100.0
WP_003643092.1\|945670_946138_-	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	2.7e-83	100.0
WP_003643094.1\|946482_946923_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_003643095.1\|946993_947554_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_103420023.1\|947641_950080_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.5
WP_003643097.1\|950082_950697_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_003643099.1\|951040_951988_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_063733823.1\|952173_953145_+	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.0e-180	98.5

DBSCAN-SWA_5

1158303 : 1246527

Lactobacillus_phage(64.29%)

integrase,tail,portal,protease,holin,head,terminase,tRNA,capsid

attL 1213638:1213653|attR 1229550:1229565

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080440298.1\|1158303_1158882_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	9.3e-33	42.5
WP_063721030.1\|1158913_1159756_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	3.2e-34	37.2
WP_063721031.1\|1159825_1160854_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	4.9e-69	42.1
WP_016511284.1\|1160863_1161445_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	3.9e-39	45.6
WP_063721032.1\|1161574_1163008_-	polysaccharide biosynthesis C-terminal domain-containing protein	NA	NA	NA	NA
WP_139246913.1\|1164074_1165163_-	hypothetical protein	NA	NA	NA	NA
WP_158664255.1\|1165216_1166062_-	glycosyltransferase	NA	NA	NA	NA
WP_063721035.1\|1166128_1166992_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.0e-104	62.5
WP_016511278.1\|1167009_1167975_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	3.4e-11	38.6
WP_063721036.1\|1167980_1168688_-	glycosyltransferase	NA	NA	NA	NA
WP_063721037.1\|1168698_1169514_-	glycosyltransferase	NA	NA	NA	NA
WP_063721038.1\|1169513_1170377_-	glycosyltransferase	NA	NA	NA	NA
WP_063721039.1\|1170363_1171623_-	hypothetical protein	NA	NA	NA	NA
WP_063721040.1\|1171591_1172233_-	hypothetical protein	NA	NA	NA	NA
WP_063721041.1\|1172307_1173444_-	hypothetical protein	NA	NA	NA	NA
WP_063721042.1\|1173467_1175414_-	hypothetical protein	NA	NA	NA	NA
WP_016511270.1\|1175520_1175925_+	GtrA family protein	NA	NA	NA	NA
WP_063721043.1\|1175917_1177036_-	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	8.9e-173	79.3
WP_003643315.1\|1177185_1177902_-	aquaporin family protein	A0A1J0F964	Only_Syngen_Nebraska_virus	5.6e-19	32.7
WP_015825371.1\|1178091_1179021_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_003646267.1\|1179407_1180526_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	2.7e-20	31.2
WP_103420056.1\|1180714_1181890_-	serine hydrolase	NA	NA	NA	NA
WP_172821799.1\|1182149_1183505_+	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_003646269.1\|1183587_1184151_-	hypothetical protein	NA	NA	NA	NA
WP_003643305.1\|1184583_1185024_-	hypothetical protein	NA	NA	NA	NA
WP_021356765.1\|1185222_1185423_+	hypothetical protein	NA	NA	NA	NA
WP_003643303.1\|1185572_1186439_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003644138.1\|1186431_1187739_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003643301.1\|1187872_1188313_+	universal stress protein	NA	NA	NA	NA
WP_103420058.1\|1188988_1189489_+	N-acetyltransferase	NA	NA	NA	NA
WP_158664263.1\|1189604_1189718_-	hypothetical protein	NA	NA	NA	NA
WP_103420060.1\|1190508_1191045_-\|holin	holin	E9LUS0	Lactobacillus_phage	1.7e-36	96.6
WP_003644510.1\|1191057_1191321_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_076637106.1\|1192351_1192711_-	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	2.3e-45	79.8
WP_003644513.1\|1192694_1192856_-	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	9.5e-20	100.0
WP_103420062.1\|1192859_1193102_-	hypothetical protein	A0A2P0ZLG3	Lactobacillus_phage	3.5e-26	92.5
WP_103420064.1\|1193094_1195641_-\|tail	phage tail protein	A0A2K9VCB6	Lactobacillus_phage	1.6e-238	46.6
WP_103420066.1\|1195657_1198069_-	hypothetical protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	94.6
WP_103420068.1\|1198133_1199906_-\|tail	phage tail family protein	A0A2P0ZLH2	Lactobacillus_phage	5.5e-310	89.5
WP_103420070.1\|1199982_1204728_-	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	74.8
WP_003644519.1\|1204759_1204951_-	hypothetical protein	NA	NA	NA	NA
WP_003644520.1\|1204989_1205364_-\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	3.2e-58	96.0
WP_061876152.1\|1205434_1206094_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	2.6e-111	94.0
WP_103420072.1\|1206110_1206491_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	4.5e-60	91.3
WP_103420074.1\|1206490_1206898_-	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	3.4e-66	94.7
WP_103420076.1\|1206900_1207248_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.3e-42	72.2
WP_103420078.1\|1207237_1207570_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	1.1e-43	82.7
WP_103420080.1\|1207642_1208875_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	1.5e-205	90.4
WP_103420082.1\|1208874_1209633_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.9e-126	94.0
WP_103420084.1\|1209610_1210804_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	3.4e-223	98.0
WP_003644528.1\|1210806_1211001_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	7.4e-27	98.4
WP_103420086.1\|1210990_1212889_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	92.2
WP_016511011.1\|1212898_1213354_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	3.0e-79	96.7
WP_187344402.1\|1213572_1214043_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	6.5e-85	96.2
1213638:1213653	attL	NA	NA	NA	NA
WP_103420090.1\|1214053_1214233_-	hypothetical protein	E9LUP6	Lactobacillus_phage	1.2e-12	66.1
WP_103420092.1\|1214419_1214986_-	hypothetical protein	NA	NA	NA	NA
WP_103420094.1\|1214997_1215972_-	hypothetical protein	NA	NA	NA	NA
WP_103420096.1\|1216286_1216715_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	1.4e-65	85.2
WP_103420099.1\|1216989_1217298_-	hypothetical protein	E9LUN7	Lactobacillus_phage	3.0e-46	91.2
WP_158664256.1\|1217301_1218138_-	helix-turn-helix domain-containing protein	U5U793	Lactobacillus_phage	1.3e-38	41.3
WP_103420103.1\|1218179_1218872_-	hypothetical protein	E9LUU3	Lactobacillus_phage	2.8e-116	87.8
WP_103420105.1\|1218886_1219348_-	single-stranded DNA-binding protein	Q938M7	Temperate_phage	4.1e-39	55.6
WP_103420107.1\|1219344_1219971_-	ERF family protein	D7RWM8	Brochothrix_phage	1.0e-13	37.4
WP_103420109.1\|1219970_1220831_-	DUF1351 domain-containing protein	A0A0P0IV40	Lactobacillus_phage	6.4e-38	34.0
WP_164971120.1\|1220830_1220977_-	hypothetical protein	E9LUT9	Lactobacillus_phage	4.7e-18	97.9
WP_187344399.1\|1220979_1221144_-	hypothetical protein	E9LUT8	Lactobacillus_phage	9.3e-15	76.9
WP_103420111.1\|1221155_1221356_-	hypothetical protein	E9LUT7	Lactobacillus_phage	2.9e-26	89.4
WP_103420113.1\|1221368_1221605_-	tagatose-bisphosphate aldolase	E9LUT6	Lactobacillus_phage	1.9e-21	64.3
WP_063485662.1\|1221747_1222008_-	hypothetical protein	NA	NA	NA	NA
WP_103420115.1\|1222417_1222774_+	hypothetical protein	NA	NA	NA	NA
WP_103420117.1\|1222770_1222974_-	hypothetical protein	NA	NA	NA	NA
WP_103420119.1\|1222987_1223776_-	phage antirepressor KilAC domain-containing protein	L0P8P6	Lactobacillus_phage	1.5e-81	57.8
WP_087615016.1\|1223776_1224025_-	helix-turn-helix transcriptional regulator	A0A0P0IX93	Lactobacillus_phage	7.3e-19	65.7
WP_103420121.1\|1224188_1224623_+	helix-turn-helix transcriptional regulator	Q6J1W4	Lactobacillus_phage	2.7e-29	65.0
WP_158664257.1\|1224638_1225136_+	hypothetical protein	A0A0A7RTX7	Clostridium_phage	1.5e-10	34.9
WP_103420125.1\|1225166_1225901_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	1.6e-42	54.5
WP_103420127.1\|1225903_1226122_+	hypothetical protein	NA	NA	NA	NA
WP_103420131.1\|1226928_1227417_+	cupin domain-containing protein	A0A291ATU0	Pandoravirus	1.3e-11	34.8
WP_103420133.1\|1227580_1228762_+\|integrase	site-specific integrase	Q5YAA6	Bacillus_phage	3.3e-61	37.9
WP_003641354.1\|1229003_1230338_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.9e-37	30.9
1229550:1229565	attR	NA	NA	NA	NA
WP_003641353.1\|1230350_1231358_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_003638174.1\|1231544_1231745_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.1e-20	71.4
WP_003641352.1\|1232088_1232454_+	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_003641351.1\|1232609_1233386_-	lysozyme	A0A141HSE6	Bacillus_phage	2.6e-06	31.1
WP_003644133.1\|1233410_1234289_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003641349.1\|1234413_1235298_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003644132.1\|1235290_1236607_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003646275.1\|1236847_1239187_-	cation-translocating P-type ATPase	M1HI01	Paramecium_bursaria_Chlorella_virus	7.1e-39	24.8
WP_003641346.1\|1239453_1240032_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003644130.1\|1240485_1241859_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	4.2e-124	50.0
WP_003641344.1\|1242192_1243215_-	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	2.6e-17	26.5
WP_003641343.1\|1243319_1244744_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_003644129.1\|1244743_1246207_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_003641341.1\|1246206_1246527_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA

DBSCAN-SWA_6

1285259 : 1358043

Lactobacillus_phage(62.86%)

integrase,tail,portal,head,transposase,terminase,tRNA,plate,capsid

attL 1287511:1287526|attR 1360406:1360421

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060683828.1\|1285259_1286258_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.3e-50	36.7
WP_003641305.1\|1286328_1287867_-	citrate lyase subunit alpha	NA	NA	NA	NA
1287511:1287526	attL	NA	NA	NA	NA
WP_015825304.1\|1287856_1288771_-	citrate (pro-3S)-lyase subunit beta	NA	NA	NA	NA
WP_003641303.1\|1288770_1289061_-	citrate lyase acyl carrier protein	NA	NA	NA	NA
WP_015825303.1\|1289050_1290106_-	[citrate (pro-3S)-lyase] ligase	NA	NA	NA	NA
WP_003641301.1\|1290123_1291284_-	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_003641300.1\|1291479_1292442_+	citrate lyase	NA	NA	NA	NA
WP_060683827.1\|1292518_1293937_-	anion permease	NA	NA	NA	NA
WP_027822238.1\|1293968_1294898_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_003641297.1\|1295294_1295606_+	hypothetical protein	NA	NA	NA	NA
WP_103420139.1\|1295717_1296659_-	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016511596.1\|1296655_1297528_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003645514.1\|1297527_1298265_-	metal ABC transporter ATP-binding protein	W5SAS9	Pithovirus	4.4e-11	26.1
WP_011101256.1\|1298595_1299438_-	triphosphoribosyl-dephospho-CoA synthase	NA	NA	NA	NA
WP_053566505.1\|1299674_1300700_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011101254.1\|1300956_1301889_+	L(+)-tartrate dehydratase subunit alpha	NA	NA	NA	NA
WP_103420141.1\|1301885_1302497_+	L(+)-tartrate dehydratase subunit beta	NA	NA	NA	NA
WP_015380009.1\|1302560_1302887_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_063720913.1\|1302990_1304412_+	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_060683826.1\|1304843_1305923_-	3-dehydroquinate synthase	NA	NA	NA	NA
WP_003641285.1\|1305932_1306928_-	3-deoxy-7-phosphoheptulonate synthase	NA	NA	NA	NA
WP_003644101.1\|1306968_1307862_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_063720912.1\|1307881_1309894_-	transketolase	NA	NA	NA	NA
WP_103420143.1\|1310723_1311860_-	Ldh family oxidoreductase	NA	NA	NA	NA
WP_060683822.1\|1313536_1314406_+	DegV family protein	NA	NA	NA	NA
WP_103420145.1\|1314980_1315193_-	DUF3923 family protein	NA	NA	NA	NA
WP_103420147.1\|1315490_1316621_-	LysM peptidoglycan-binding domain-containing protein	A0A0P0HRN9	Lactobacillus_phage	3.5e-92	49.1
WP_103420149.1\|1316604_1317015_-	hypothetical protein	O03941	Lactobacillus_phage	9.9e-21	79.7
WP_103420151.1\|1317029_1317386_-	hypothetical protein	NA	NA	NA	NA
WP_103420676.1\|1317378_1317732_-	hypothetical protein	D6PSR9	Lactobacillus_phage	1.1e-25	50.0
WP_103420153.1\|1317826_1317973_-	XkdX family protein	NA	NA	NA	NA
WP_103420155.1\|1317972_1318296_-	hypothetical protein	NA	NA	NA	NA
WP_103420157.1\|1318308_1318707_-	hypothetical protein	NA	NA	NA	NA
WP_103420159.1\|1318720_1319890_-\|plate	BppU family phage baseplate upper protein	O03968	Lactobacillus_phage	1.9e-61	63.0
WP_103420161.1\|1319905_1322158_-	hypothetical protein	A0A291I9J9	Lactobacillus_phage	1.2e-184	49.2
WP_103420163.1\|1322144_1322414_-	hypothetical protein	NA	NA	NA	NA
WP_187344400.1\|1322413_1323589_-\|tail	phage tail protein	Q9T1A5	Listeria_phage	2.7e-18	24.1
WP_103420167.1\|1323588_1324485_-\|tail	phage tail family protein	A8ATA8	Listeria_phage	7.7e-18	29.0
WP_103420169.1\|1324494_1328421_-	tape measure protein	E9LUR1	Lactobacillus_phage	1.1e-81	44.0
WP_011101122.1\|1328420_1328657_-	hypothetical protein	NA	NA	NA	NA
WP_103420172.1\|1328725_1329238_-	hypothetical protein	NA	NA	NA	NA
WP_103420174.1\|1329255_1329849_-\|tail	phage tail protein	NA	NA	NA	NA
WP_103420176.1\|1329860_1330247_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_103420178.1\|1330248_1330803_-\|tail	phage tail protein	NA	NA	NA	NA
WP_103420678.1\|1330792_1331116_-	hypothetical protein	NA	NA	NA	NA
WP_103420181.1\|1331120_1331486_-\|head,tail	phage head-tail connector protein	H9A0V3	Staphylococcus_phage	4.0e-05	37.1
WP_103420183.1\|1331500_1332571_-\|capsid	phage capsid protein	A0A0S0N2Q7	Pseudomonas_phage	5.4e-34	31.0
WP_103420185.1\|1332584_1333232_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_103420187.1\|1333340_1334285_-\|capsid	minor capsid protein	NA	NA	NA	NA
WP_103420189.1\|1334298_1335975_-\|portal	phage portal protein	D2IYW2	Enterococcus_phage	1.7e-66	33.1
WP_103420191.1\|1335964_1337251_-\|terminase	PBSX family phage terminase large subunit	A0A2H4IYR5	uncultured_Caudovirales_phage	2.8e-114	49.9
WP_103420193.1\|1337234_1337702_-	hypothetical protein	Q597W0	Lactobacillus_virus	6.4e-32	55.7
WP_063723236.1\|1337741_1338005_-	hypothetical protein	A0A1S5RCN3	Lactobacillus_phage	1.1e-28	68.6
WP_164906367.1\|1338066_1338216_-	hypothetical protein	NA	NA	NA	NA
WP_103419775.1\|1338227_1338443_-	hypothetical protein	A0A2P0ZLC2	Lactobacillus_phage	3.0e-05	52.5
WP_103419773.1\|1338456_1338648_-	hypothetical protein	NA	NA	NA	NA
WP_103419771.1\|1338613_1338799_-	hypothetical protein	E9LUP6	Lactobacillus_phage	2.1e-07	60.9
WP_015380624.1\|1338776_1338974_-	hypothetical protein	NA	NA	NA	NA
WP_103420196.1\|1339910_1340354_-	transcriptional regulator	O03925	Lactobacillus_phage	8.9e-68	86.4
WP_187344401.1\|1340542_1340686_-	hypothetical protein	NA	NA	NA	NA
WP_103420198.1\|1340700_1341012_-	hypothetical protein	A0A2K9VC43	Lactobacillus_phage	5.9e-18	43.1
WP_103420200.1\|1341008_1341464_-	DUF1642 domain-containing protein	A0A2K9VC25	Lactobacillus_phage	5.2e-47	67.4
WP_103420202.1\|1341528_1341930_-	hypothetical protein	O03921	Lactobacillus_phage	2.1e-36	62.1
WP_063487243.1\|1341942_1342272_-	hypothetical protein	NA	NA	NA	NA
WP_103420204.1\|1342504_1342996_-	methyltransferase domain-containing protein	O03918	Lactobacillus_phage	2.5e-87	93.1
WP_103420680.1\|1343080_1343344_-	DUF3310 domain-containing protein	A0A2P0ZL48	Lactobacillus_phage	2.4e-28	74.7
WP_103420208.1\|1344312_1344543_-	hypothetical protein	O03916	Lactobacillus_phage	3.8e-22	61.8
WP_103420210.1\|1344539_1344959_-	RusA family crossover junction endodeoxyribonuclease	A8YQM5	Lactobacillus_phage	3.7e-23	41.6
WP_103420212.1\|1344951_1345485_-	hypothetical protein	O03915	Lactobacillus_phage	1.4e-38	53.0
WP_003642800.1\|1345481_1345769_-	hypothetical protein	NA	NA	NA	NA
WP_103420214.1\|1345765_1346650_-	DNA replication protein DnaD	NA	NA	NA	NA
WP_103420216.1\|1346699_1347392_-	hypothetical protein	E9LUU3	Lactobacillus_phage	3.2e-128	96.1
WP_103420218.1\|1347438_1348098_-	DUF669 domain-containing protein	O03912	Lactobacillus_phage	2.7e-76	65.2
WP_103420220.1\|1348100_1348763_-	AAA family ATPase	O03911	Lactobacillus_phage	2.9e-107	85.5
WP_103420222.1\|1348769_1349279_-	hypothetical protein	NA	NA	NA	NA
WP_103420224.1\|1349712_1350027_-	hypothetical protein	NA	NA	NA	NA
WP_103420226.1\|1350033_1350558_-	hypothetical protein	NA	NA	NA	NA
WP_054399383.1\|1350614_1350803_-	hypothetical protein	NA	NA	NA	NA
WP_103420228.1\|1350871_1351075_-	helix-turn-helix transcriptional regulator	A0A139ZPI6	Marinitoga_camini_virus	4.9e-05	42.3
WP_063491280.1\|1351232_1351580_+	helix-turn-helix domain-containing protein	A8ASM2	Listeria_phage	1.7e-10	38.7
WP_080474029.1\|1351576_1352002_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	6.2e-26	46.8
WP_103420230.1\|1352156_1352867_+	hypothetical protein	NA	NA	NA	NA
WP_069710568.1\|1353181_1354300_+	hypothetical protein	A0A141E0C6	Streptococcus_phage	4.7e-41	31.7
WP_103420234.1\|1354670_1354967_+	hypothetical protein	NA	NA	NA	NA
WP_103420236.1\|1354981_1356163_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	7.2e-48	32.6
WP_003638099.1\|1356296_1356689_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_003638098.1\|1356702_1357146_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_003644097.1\|1357254_1358043_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
1360406:1360421	attR	NA	NA	NA	NA

DBSCAN-SWA_7

1678013 : 1750288

Lactobacillus_phage(56.82%)

tail,portal,holin,terminase,tRNA,plate,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640980.1\|1678013_1679060_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	3.5e-62	41.7
WP_003640979.1\|1679064_1679520_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_011101142.1\|1679512_1680091_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_003640977.1\|1680074_1680800_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_003643945.1\|1681079_1682132_+	PhnD/SsuA/transferrin family substrate-binding protein	NA	NA	NA	NA
WP_003640975.1\|1682169_1682940_+	phosphonate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.9e-13	31.8
WP_003640974.1\|1682929_1683733_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_063720881.1\|1683729_1684584_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_011101141.1\|1684608_1685406_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_003640971.1\|1685427_1686528_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_103420297.1\|1686661_1687657_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.6e-51	38.5
WP_003640969.1\|1687795_1688581_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355239.1\|1688584_1689481_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.4e-82	55.7
WP_003640967.1\|1689579_1689927_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003640966.1\|1689951_1690971_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640965.1\|1690987_1691317_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_103420299.1\|1691313_1691979_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640963.1\|1692482_1693121_-	ketohydroxyglutarate aldolase	NA	NA	NA	NA
WP_003640962.1\|1693135_1694398_-	PTS transporter subunit IIC	NA	NA	NA	NA
WP_003640961.1\|1694408_1694684_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_003640960.1\|1694690_1695128_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_063720880.1\|1695259_1697308_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_003640957.1\|1697660_1697912_-	YaaL family protein	NA	NA	NA	NA
WP_103420301.1\|1697926_1698526_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|1698541_1698850_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003643940.1\|1698871_1700569_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640954.1\|1701095_1701602_-	nucleoside deaminase	NA	NA	NA	NA
WP_003643939.1\|1701604_1702213_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003640952.1\|1702435_1702666_+	redoxin NrdH	X2KRY7	Enterococcus_phage	2.8e-09	40.0
WP_003643938.1\|1702804_1704970_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	5.7e-269	63.5
WP_003640950.1\|1704997_1706008_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.1e-108	60.5
WP_003643936.1\|1706089_1706665_+	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	4.9e-26	41.7
WP_022638342.1\|1706839_1709443_-	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_003643934.1\|1709746_1710415_+	hypothetical protein	NA	NA	NA	NA
WP_003640946.1\|1710427_1711405_+	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_103420303.1\|1711941_1712172_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	7.2e-05	74.5
WP_103420305.1\|1712352_1712715_-\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	1.9e-20	71.8
WP_015380597.1\|1712701_1712998_-	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	1.2e-39	77.6
WP_187344393.1\|1712998_1714162_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	4.6e-39	36.9
WP_103420307.1\|1714168_1714315_-	XkdX family protein	NA	NA	NA	NA
WP_103420309.1\|1714314_1714638_-	hypothetical protein	NA	NA	NA	NA
WP_103420311.1\|1714650_1715049_-	hypothetical protein	NA	NA	NA	NA
WP_103420313.1\|1715062_1716232_-\|plate	BppU family phage baseplate upper protein	O03968	Lactobacillus_phage	1.9e-61	63.0
WP_103420315.1\|1716247_1718518_-	hypothetical protein	A0A291I9J9	Lactobacillus_phage	6.6e-183	48.9
WP_103420317.1\|1718492_1718741_-	hypothetical protein	NA	NA	NA	NA
WP_103420319.1\|1718733_1719861_-\|tail	phage tail protein	O03938	Lactobacillus_phage	6.8e-72	41.8
WP_103420321.1\|1719872_1720691_-\|tail	phage tail family protein	NA	NA	NA	NA
WP_103420323.1\|1720691_1726322_-\|tail	phage tail tape measure protein	A0A1S5SFC1	Streptococcus_phage	1.2e-20	24.8
WP_103420325.1\|1726337_1726979_-	hypothetical protein	U3PFU8	Lactobacillus_phage	3.7e-06	26.3
WP_103420327.1\|1726975_1727494_-	hypothetical protein	NA	NA	NA	NA
WP_103420329.1\|1727612_1728221_-	hypothetical protein	NA	NA	NA	NA
WP_158664258.1\|1728238_1728664_-	hypothetical protein	NA	NA	NA	NA
WP_103420333.1\|1728663_1729065_-	hypothetical protein	NA	NA	NA	NA
WP_103420335.1\|1729061_1729451_-	hypothetical protein	NA	NA	NA	NA
WP_103420337.1\|1729451_1729856_-	hypothetical protein	A5GYM1	Lactococcus_phage	2.3e-06	28.2
WP_185864219.1\|1729866_1730127_-	hypothetical protein	NA	NA	NA	NA
WP_103420339.1\|1730215_1731163_-\|capsid	N4-gp56 family major capsid protein	A8ASJ6	Listeria_phage	1.4e-89	59.9
WP_103420341.1\|1731176_1731776_-	hypothetical protein	NA	NA	NA	NA
WP_158664259.1\|1731839_1732925_-	hypothetical protein	Q9T1B9	Listeria_phage	6.2e-38	32.4
WP_158664260.1\|1732917_1734513_-\|portal	phage portal protein	B5LPR1	Bacillus_virus	2.2e-84	37.3
WP_103420347.1\|1734515_1735847_-\|terminase	PBSX family phage terminase large subunit	A0A1S5SA45	Streptococcus_phage	4.3e-134	55.4
WP_103420349.1\|1735821_1736337_-	helix-turn-helix domain-containing protein	L0P6X1	Lactobacillus_phage	7.8e-15	33.8
WP_063723236.1\|1736376_1736640_-	hypothetical protein	A0A1S5RCN3	Lactobacillus_phage	1.1e-28	68.6
WP_164906367.1\|1736701_1736851_-	hypothetical protein	NA	NA	NA	NA
WP_103419775.1\|1736862_1737078_-	hypothetical protein	A0A2P0ZLC2	Lactobacillus_phage	3.0e-05	52.5
WP_103419773.1\|1737091_1737283_-	hypothetical protein	NA	NA	NA	NA
WP_103419771.1\|1737248_1737434_-	hypothetical protein	E9LUP6	Lactobacillus_phage	2.1e-07	60.9
WP_015380624.1\|1737411_1737609_-	hypothetical protein	NA	NA	NA	NA
WP_103420351.1\|1738559_1739021_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	4.8e-40	57.8
WP_103420353.1\|1739106_1739364_-	hypothetical protein	NA	NA	NA	NA
WP_103420684.1\|1739406_1739706_-	hypothetical protein	O03924	Lactobacillus_phage	1.7e-25	58.2
WP_103420355.1\|1739731_1739977_-	DUF3850 domain-containing protein	C9E2N9	Enterococcus_phage	4.1e-14	54.1
WP_103420686.1\|1740049_1740388_-	hypothetical protein	O03921	Lactobacillus_phage	6.0e-32	85.5
WP_103420357.1\|1740467_1740659_-	hypothetical protein	D6PSV3	Lactobacillus_phage	1.5e-19	71.4
WP_063487243.1\|1740671_1741001_-	hypothetical protein	NA	NA	NA	NA
WP_187344394.1\|1741016_1741175_-	hypothetical protein	O03920	Lactobacillus_phage	1.1e-15	78.8
WP_158664261.1\|1741192_1741342_-	hypothetical protein	NA	NA	NA	NA
WP_103420359.1\|1741345_1741576_-	hypothetical protein	O03916	Lactobacillus_phage	1.2e-20	56.6
WP_103420361.1\|1741587_1741926_-	hypothetical protein	NA	NA	NA	NA
WP_103420363.1\|1741903_1742302_-	hypothetical protein	NA	NA	NA	NA
WP_103420365.1\|1742298_1742817_-	hypothetical protein	O03915	Lactobacillus_phage	9.1e-64	75.2
WP_013355745.1\|1742813_1743101_-	hypothetical protein	NA	NA	NA	NA
WP_103420367.1\|1743097_1743982_-	DNA replication protein DnaD	NA	NA	NA	NA
WP_103420369.1\|1744031_1744724_-	hypothetical protein	E9LUU3	Lactobacillus_phage	3.7e-129	96.5
WP_103420371.1\|1744770_1745430_-	DUF669 domain-containing protein	O03912	Lactobacillus_phage	3.5e-76	65.2
WP_103420220.1\|1745432_1746095_-	AAA family ATPase	O03911	Lactobacillus_phage	2.9e-107	85.5
WP_103420222.1\|1746101_1746611_-	hypothetical protein	NA	NA	NA	NA
WP_103420373.1\|1747105_1747393_-	DNA-binding protein	NA	NA	NA	NA
WP_103420375.1\|1747398_1747953_-	hypothetical protein	O03909	Lactobacillus_phage	6.1e-98	99.5
WP_076633211.1\|1748013_1748196_-	hypothetical protein	NA	NA	NA	NA
WP_103420377.1\|1748276_1748615_+	hypothetical protein	NA	NA	NA	NA
WP_103420379.1\|1748611_1748821_-	DUF2829 domain-containing protein	NA	NA	NA	NA
WP_158664262.1\|1748839_1749001_-	hypothetical protein	NA	NA	NA	NA
WP_103420381.1\|1749494_1749863_+	helix-turn-helix transcriptional regulator	D6PSS9	Lactobacillus_phage	2.0e-25	53.3
WP_103420399.1\|1749862_1750288_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	3.1e-25	46.8

DBSCAN-SWA_8

1873971 : 1982541

103

uncultured_Mediterranean_phage(16.67%)

bacteriocin,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_103420416.1\|1873971_1875243_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	5.3e-97	43.9
WP_003642042.1\|1875710_1877324_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003642041.1\|1877496_1878105_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642040.1\|1878149_1878590_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_021356493.1\|1878950_1879883_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_169484456.1\|1879891_1881250_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_053566450.1\|1881269_1882079_+	sugar-phosphatase	NA	NA	NA	NA
WP_024971609.1\|1882248_1883235_-	hypothetical protein	NA	NA	NA	NA
WP_015379808.1\|1883317_1884340_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|1884628_1885609_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_044429183.1\|1885974_1886799_-	serine hydrolase	NA	NA	NA	NA
WP_044429181.1\|1887034_1888417_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_003642030.1\|1888485_1889322_-	pur operon repressor	NA	NA	NA	NA
WP_003642029.1\|1889814_1890078_-	hypothetical protein	NA	NA	NA	NA
WP_003646503.1\|1890092_1890635_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_162899478.1\|1891184_1891346_-	hypothetical protein	NA	NA	NA	NA
WP_003646500.1\|1891714_1892512_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|1892504_1893203_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_021356652.1\|1893469_1894414_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003643828.1\|1894723_1895590_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|1895722_1895974_-	Veg family protein	NA	NA	NA	NA
WP_063721083.1\|1896078_1896969_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_063204069.1\|1896965_1897529_-	ribonuclease M5	NA	NA	NA	NA
WP_103420418.1\|1897515_1898292_-	TatD family hydrolase	NA	NA	NA	NA
WP_063487597.1\|1898414_1899599_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_003643823.1\|1899831_1901883_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_011101012.1\|1902204_1902594_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003642012.1\|1903190_1904033_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003646490.1\|1904032_1904737_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642010.1\|1904758_1905718_-	hypothetical protein	NA	NA	NA	NA
WP_003642009.1\|1905710_1906985_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642008.1\|1907030_1907948_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_060684284.1\|1908116_1908911_-	hypothetical protein	NA	NA	NA	NA
WP_047672680.1\|1908915_1910049_-	hypothetical protein	NA	NA	NA	NA
WP_053566444.1\|1910503_1911517_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_063721084.1\|1911629_1912376_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003642003.1\|1912525_1913422_-	ROK family protein	NA	NA	NA	NA
WP_003642002.1\|1913542_1914979_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_103420689.1\|1914996_1916352_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_053566443.1\|1916574_1916997_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|1916986_1917175_-	hypothetical protein	NA	NA	NA	NA
WP_003641998.1\|1917181_1918543_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641997.1\|1918615_1919326_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_103420420.1\|1919733_1920750_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_021356643.1\|1921189_1921966_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_053566442.1\|1922224_1924534_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_003646479.1\|1924823_1925117_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	9.9e-07	48.3
WP_076633895.1\|1925128_1925416_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_103420422.1\|1925576_1926263_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_053566440.1\|1926356_1927037_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063721086.1\|1927123_1927792_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_062688864.1\|1927858_1928548_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_062688861.1\|1928637_1930014_-	HlyD family secretion protein	NA	NA	NA	NA
WP_103420424.1\|1930029_1932180_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	8.0e-45	27.9
WP_003641985.1\|1932446_1932617_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_021356667.1\|1932641_1932800_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_021356666.1\|1932898_1933672_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063204018.1\|1933965_1934709_-	response regulator transcription factor	NA	NA	NA	NA
WP_063486822.1\|1934827_1935571_-	response regulator transcription factor	NA	NA	NA	NA
WP_003641979.1\|1937089_1937236_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641977.1\|1938113_1938860_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_103420426.1\|1938890_1940090_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003641975.1\|1940207_1940375_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641974.1\|1940502_1940703_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641973.1\|1941564_1941732_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641972.1\|1941762_1941936_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_103420428.1\|1941932_1942601_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641969.1\|1943012_1943216_-	hypothetical protein	NA	NA	NA	NA
WP_011100995.1\|1943600_1944785_-	cation:proton antiporter	NA	NA	NA	NA
WP_011100994.1\|1944829_1946206_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_103420430.1\|1946731_1947547_-	HAD family phosphatase	NA	NA	NA	NA
WP_003641965.1\|1947706_1948579_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_011100993.1\|1948649_1949441_+	HAD family hydrolase	NA	NA	NA	NA
WP_003641963.1\|1949444_1950599_+	MFS transporter	NA	NA	NA	NA
WP_003641962.1\|1950602_1951220_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003641960.1\|1951601_1951877_-	hypothetical protein	NA	NA	NA	NA
WP_003641956.1\|1953147_1953555_-	immunity 63 family protein	NA	NA	NA	NA
WP_114071742.1\|1953631_1953778_-	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_003641954.1\|1953980_1954172_-	hypothetical protein	NA	NA	NA	NA
WP_003641952.1\|1954621_1955008_-	hypothetical protein	NA	NA	NA	NA
WP_003641950.1\|1955387_1955666_-	hypothetical protein	NA	NA	NA	NA
WP_003641949.1\|1955777_1956041_-	hypothetical protein	NA	NA	NA	NA
WP_003641948.1\|1956084_1957002_-	hypothetical protein	NA	NA	NA	NA
WP_041161944.1\|1956998_1958798_-	pre-toxin TG domain-containing protein	NA	NA	NA	NA
WP_103420432.1\|1958799_1962483_-	MucBP domain-containing protein	NA	NA	NA	NA
WP_003641945.1\|1963069_1963792_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_003641944.1\|1963806_1965636_-	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003643773.1\|1965650_1967168_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_003646444.1\|1967633_1968965_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_103420434.1\|1969042_1970014_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-23	31.7
WP_003641940.1\|1970014_1971541_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_103420436.1\|1971778_1972225_+	ribonuclease H	NA	NA	NA	NA
WP_063721090.1\|1973114_1974026_-	oxidoreductase	NA	NA	NA	NA
WP_003646441.1\|1974162_1975083_+	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_013355176.1\|1975248_1975821_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003641935.1\|1975924_1976380_-	hypothetical protein	NA	NA	NA	NA
WP_003646440.1\|1976398_1976869_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_024521227.1\|1976978_1978175_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|1978205_1978715_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003643763.1\|1978827_1979196_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641930.1\|1979460_1980966_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_011100974.1\|1981115_1981784_-	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003643762.1\|1981977_1982541_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_9

3158522 : 3167033

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645861.1\|3158522_3159005_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_011101896.1\|3158988_3160119_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642587.1\|3160121_3160853_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003642588.1\|3160854_3161109_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_011101895.1\|3161108_3161789_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003645864.1\|3161781_3164001_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_016527273.1\|3163985_3165440_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-50	34.0
WP_103420616.1\|3165436_3166462_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-59	41.7
WP_003645867.1\|3166454_3167033_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9

DBSCAN-SWA_10

3344347 : 3358462

Lactobacillus_phage(71.43%)

integrase

attL 3342406:3342420|attR 3352630:3352644

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3342406:3342420	attL	NA	NA	NA	NA
WP_103420632.1\|3344347_3345616_-\|integrase	site-specific integrase	A0A0P0I3D2	Lactobacillus_phage	1.3e-90	42.5
WP_103420634.1\|3345886_3346168_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_103420636.1\|3346236_3346425_-	hypothetical protein	NA	NA	NA	NA
WP_187344396.1\|3346581_3346758_-	hypothetical protein	NA	NA	NA	NA
WP_103420638.1\|3346910_3347246_-	hypothetical protein	A0A1B0Y4P2	Lactobacillus_phage	3.7e-26	53.9
WP_103420640.1\|3347300_3347861_-	DUF5067 domain-containing protein	Q6SEF8	Lactobacillus_prophage	6.0e-45	65.2
WP_103420642.1\|3347910_3349257_-	DUF4041 domain-containing protein	A0A1B0Y697	Lactobacillus_phage	1.0e-74	49.6
WP_069302545.1\|3349282_3349696_-	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3
WP_011101082.1\|3349707_3350070_-	helix-turn-helix domain-containing protein	A0A0U4KKM4	Exiguobacterium_phage	2.6e-09	32.0
WP_011101083.1\|3350242_3350473_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024623923.1\|3350719_3351235_+	hypothetical protein	D6PST4	Lactobacillus_phage	1.7e-25	38.6
WP_103420644.1\|3351247_3351493_+	hypothetical protein	NA	NA	NA	NA
WP_187344397.1\|3351693_3352218_+	hypothetical protein	NA	NA	NA	NA
WP_103420646.1\|3352220_3352478_+	hypothetical protein	NA	NA	NA	NA
WP_103420648.1\|3352505_3353180_+	ERF family protein	A0A2H4J439	uncultured_Caudovirales_phage	1.3e-30	51.5
3352630:3352644	attR	NA	NA	NA	NA
WP_103420650.1\|3353272_3354223_+	DUF4373 domain-containing protein	NA	NA	NA	NA
WP_103420652.1\|3354236_3354752_+	hypothetical protein	O03915	Lactobacillus_phage	2.2e-54	65.9
WP_103420654.1\|3355159_3355390_+	hypothetical protein	O03916	Lactobacillus_phage	2.1e-20	57.9
WP_103420680.1\|3356359_3356623_+	DUF3310 domain-containing protein	A0A2P0ZL48	Lactobacillus_phage	2.4e-28	74.7
WP_103420660.1\|3356946_3357276_+	hypothetical protein	NA	NA	NA	NA
WP_103420202.1\|3357288_3357690_+	hypothetical protein	O03921	Lactobacillus_phage	2.1e-36	62.1
WP_103420662.1\|3357754_3358177_+	DUF1642 domain-containing protein	A0A2P0ZLB8	Lactobacillus_phage	1.9e-51	65.8
WP_072534390.1\|3358294_3358462_+	hypothetical protein	E9LUP4	Lactobacillus_phage	4.4e-12	84.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP025992

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP025991

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection