CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP015293	Rhodobacter sphaeroides strain MBTLJ-20 plasmid e, complete sequence	0 crisprs	NA	0	0
NZ_CP015287	Rhodobacter sphaeroides strain MBTLJ-20 chromosome 1, complete sequence	1 crisprs	csa3,DEDDh,cas3,cas3HD	0	7
NZ_CP015290	Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence	1 crisprs	NA	1	1
NZ_CP015289	Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence	0 crisprs	csa3	0	0
NZ_CP015291	Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence	0 crisprs	NA	0	0
NZ_CP015292	Rhodobacter sphaeroides strain MBTLJ-20 plasmid d, complete sequence	0 crisprs	NA	0	0
NZ_CP015288	Rhodobacter sphaeroides strain MBTLJ-20 chromosome 2, complete sequence	0 crisprs	csa3	0	4

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015287_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015287_1

2605565-2605667

Orphan

Consensus_repeat	Method
CGCGCGCCGATCGGAGCGCGGAGCTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015287_1

>merge|NZ_CP015287|1|2605565-2605667|CRISPRCasFinder
CGCGCGCCGATCGGAGCGCGGAGCTTTCACCACGCCGCACAGTCGGACGGGGCAGCCCGGGGACACGGCGGCCACCCGCGCGCTGATCGGAGCGCGGAGCTTT

>NZ_CP015287|1|1|2605565-2605667|CRISPRCasFinder
CGCGCGCCGATCGGAGCGCGGAGCTTT	CACCACGCCGCACAGTCGGACGGGGCAGCCCGGGGACACGGCGGCCACC
CGCGCGCTGATCGGAGCGCGGAGCTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015287.1\|WP_002721051.1\|2608073_2609027_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP015287.1\|WP_002721056.1\|2613291_2613816_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225786
NZ_CP015287.1\|WP_002721040.1\|2599970_2600099_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015287.1\|WP_002721045.1\|2602545_2603376_+\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|131868
NZ_CP015287.1\|WP_011338542.1\|2603368_2603857_+\|YaiI/YqxD-family-protein	unknown	unknown	gnl\|CDD\|367134
NZ_CP015287.1\|WP_011338543.1\|2603853_2604765_+\|ornithine-cyclodeaminase	unknown	unknown	gnl\|CDD\|180421
NZ_CP015287.1\|WP_017139959.1\|2609391_2610501_-\|3-isopropylmalate-dehydrogenase	unknown	unknown	gnl\|CDD\|234832
NZ_CP015287.1\|WP_011338544.1\|2604769_2605414_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378238
NZ_CP015287.1\|WP_011338545.1\|2605788_2607039_+\|DUF3419-family-protein	unknown	unknown	gnl\|CDD\|378757
NZ_CP015287.1\|WP_002721055.1\|2612682_2613288_-\|3-isopropylmalate-dehydratase-small-subunit	unknown	unknown	gnl\|CDD\|179314
NZ_CP015287.1\|WP_011338549.1\|2611607_2612531_-\|membrane-protein	unknown	unknown	unknown
NZ_CP015287.1\|WP_002721044.1\|2601600_2602530_+\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
NZ_CP015287.1\|WP_011338548.1\|2610597_2611527_-\|endonuclease/exonuclease/phosphatase-family-protein	unknown	unknown	gnl\|CDD\|377028
NZ_CP015287.1\|WP_011338540.1\|2599295_2599919_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379522
NZ_CP015287.1\|WP_011338550.1\|2613879_2615307_-\|3-isopropylmalate-dehydratase-large-subunit	unknown	unknown	gnl\|CDD\|235490
NZ_CP015287.1\|WP_002721035.1\|2597441_2598128_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP015287.1\|WP_017139960.1\|2615368_2615455_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015287.1\|WP_011338541.1\|2600264_2601242_+\|membrane-protein	unknown	unknown	gnl\|CDD\|224548
NZ_CP015287.1\|WP_011338546.1\|2607035_2607668_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|225136
NZ_CP015287.1\|WP_002721037.1\|2598476_2599265_+\|exodeoxyribonuclease-III	unknown	unknown	gnl\|CDD\|197320

Protein	Function_ID	Function_description	E-value
NZ_CP015287.1\|WP_002721051.1\|2608073_2609027_-\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	7.08622e-18
NZ_CP015287.1\|WP_002721056.1\|2613291_2613816_-\|hypothetical-protein	gnl\|CDD\|225786	COG3247, HdeD, Uncharacterized conserved protein [Function unknown].	1.12913e-12
NZ_CP015287.1\|WP_002721045.1\|2602545_2603376_+\|S-formylglutathione-hydrolase	gnl\|CDD\|131868	TIGR02821, S-formylglutathione_hydrolase, S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well. [Cellular processes, Detoxification].	7.60765e-144
NZ_CP015287.1\|WP_011338542.1\|2603368_2603857_+\|YaiI/YqxD-family-protein	gnl\|CDD\|367134	pfam02639, DUF188, Uncharacterized BCR, YaiI/YqxD family COG1671.	1.39912e-56
NZ_CP015287.1\|WP_011338543.1\|2603853_2604765_+\|ornithine-cyclodeaminase	gnl\|CDD\|180421	PRK06141, PRK06141, ornithine cyclodeaminase family protein.	1.79506e-84
NZ_CP015287.1\|WP_017139959.1\|2609391_2610501_-\|3-isopropylmalate-dehydrogenase	gnl\|CDD\|234832	PRK00772, PRK00772, 3-isopropylmalate dehydrogenase; Provisional.	0
NZ_CP015287.1\|WP_011338544.1\|2604769_2605414_-\|hypothetical-protein	gnl\|CDD\|378238	pfam09678, Caa3_CtaG, Cytochrome c oxidase caa3 assembly factor (Caa3_CtaG). Members of this family are the CtaG protein required for assembly of active cytochrome c oxidase of the caa3 type, as found in Bacillus subtilis.	1.62038e-18
NZ_CP015287.1\|WP_011338545.1\|2605788_2607039_+\|DUF3419-family-protein	gnl\|CDD\|378757	pfam11899, DUF3419, Protein of unknown function (DUF3419). This family of proteins are functionally uncharacterized. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 398 to 802 amino acids in length.	8.65185e-145
NZ_CP015287.1\|WP_002721055.1\|2612682_2613288_-\|3-isopropylmalate-dehydratase-small-subunit	gnl\|CDD\|179314	PRK01641, leuD, 3-isopropylmalate dehydratase small subunit.	6.37864e-137
NZ_CP015287.1\|WP_002721044.1\|2601600_2602530_+\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.74447e-36
NZ_CP015287.1\|WP_011338548.1\|2610597_2611527_-\|endonuclease/exonuclease/phosphatase-family-protein	gnl\|CDD\|377028	pfam03372, Exo_endo_phos, Endonuclease/Exonuclease/phosphatase family. This large family of proteins includes magnesium dependent endonucleases and a large number of phosphatases involved in intracellular signalling. This family includes: AP endonuclease proteins EC:4.2.99.18, DNase I proteins EC:3.1.21.1, Synaptojanin an inositol-1,4,5-trisphosphate phosphatase EC:3.1.3.56, Sphingomyelinase EC:3.1.4.12, and Nocturnin.	8.44086e-09
NZ_CP015287.1\|WP_011338540.1\|2599295_2599919_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379522	pfam14246, TetR_C_7, AefR-like transcriptional repressor, C-terminal region. This family comprises the C-terminal domain of transcriptional regulators of the TetR family. It includes the AefR transcriptional regulator from P. syringae. It is found in association with pfam00440.	3.06401e-40
NZ_CP015287.1\|WP_011338550.1\|2613879_2615307_-\|3-isopropylmalate-dehydratase-large-subunit	gnl\|CDD\|235490	PRK05478, PRK05478, 3-isopropylmalate dehydratase large subunit.	0
NZ_CP015287.1\|WP_002721035.1\|2597441_2598128_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	7.26658e-70
NZ_CP015287.1\|WP_011338541.1\|2600264_2601242_+\|membrane-protein	gnl\|CDD\|224548	COG1633, COG1633, Uncharacterized conserved protein [Function unknown].	1.81823e-36
NZ_CP015287.1\|WP_011338546.1\|2607035_2607668_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|225136	COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism].	3.4864e-21
NZ_CP015287.1\|WP_002721037.1\|2598476_2599265_+\|exodeoxyribonuclease-III	gnl\|CDD\|197320	cd09086, ExoIII-like_AP-endo, Escherichia coli exonuclease III (ExoIII) and Neisseria meningitides NExo-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases. This subfamily includes Escherichia coli ExoIII, Neisseria meningitides NExo,and related proteins. These are ExoIII family AP endonucleases and they belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. AP endonucleases participate in the DNA base excision repair (BER) pathway. AP sites are one of the most common lesions in cellular DNA. During BER, the damaged DNA is first recognized by DNA glycosylase. AP endonucleases then catalyze the hydrolytic cleavage of the phosphodiester bond 5' to the AP site, and this is followed by the coordinated actions of DNA polymerase, deoxyribose phosphatase, and DNA ligase. If left unrepaired, AP sites block DNA replication, and have both mutagenic and cytotoxic effects. AP endonucleases can carry out a variety of excision and incision reactions on DNA, including 3'-5' exonuclease, 3'-deoxyribose phosphodiesterase, 3'-phosphatase, and occasionally, nonspecific DNase activities. Different AP endonuclease enzymes catalyze the different reactions with different efficiencies. Many organisms have two AP endonucleases, usually one is the dominant AP endonuclease, the other has weak AP endonuclease activity. For example, Neisseria meningitides Nape and NExo, and exonuclease III (ExoIII) and endonuclease IV (EndoIV) in Escherichia coli. NExo and ExoIII are found in this subfamily. NExo is the non-dominant AP endonuclease. It exhibits strong 3'-5' exonuclease and 3'-deoxyribose phosphodiesterase activities. Escherichia coli ExoIII is an active AP endonuclease, and in addition, it exhibits double strand (ds)-specific 3'-5' exonuclease, exonucleolytic RNase H, 3'-phosphomonoesterase and 3'-phosphodiesterase activities, all catalyzed by a single active site. Class II AP endonucleases have been classified into two families, designated ExoIII and EndoIV, based on their homology to the Escherichia coli enzymes ExoIII and endonuclease IV (EndoIV). This subfamily belongs to the ExoIII family; the EndoIV family belongs to a different superfamily.	7.73964e-104

>NZ_CP015287.1|WP_011338544.1|2604769_2605414_-|hypothetical-protein
MSGTQSETGRQLAPGLLSLGVGLAALAGLWGGPLPDLARVSFVWHMMLHLGVILGAAPLIALGLARLAPLRTAWPVLFAGAASLLELAVVWGWHAPRLHEAAALDPTLFRIQQATFLGAGVLVWLPGLAPGRAAAGAGLLAMLFSLMHMTMLGVLLTLSPRLLYAPEICGTAFGLAPLDTQRLGGAMMAVAGLGPYLVGAAVFTMRLTREGPED
>NZ_CP015287.1|WP_011338543.1|2603853_2604765_+|ornithine-cyclodeaminase
MSIEIIGPEAEAHLSWDGLTTALTQGHKLPRAEVADIFLYRGKDTVLSRAAWIDGLGQLVKTATIFPGNGAAGKPTVNGAVTLYSDRDGTLEALVDFHLVTKWKTAGDSLLAAKRLARRDSREILLVGAGNVARSMIEAYGSHFPDARFTVWNRSADKARAMEGPQVRATEDLEAAVRAADIICTATMSQEPVVKGEWLKPGTHLDLIGAYRPDMREVDDEALRRATVFVDSRKTTIGHIGEIQDPLDRGILTEADIRADYYDLASGLYARRSDEEITLAKNGGGAHLDLMTASYIAAMWRQR
>NZ_CP015287.1|WP_011338542.1|2603368_2603857_+|YaiI/YqxD-family-protein
MTDLYIDADACPVKAEAERVAVRHGVRMFLVSNGGIRPPAHPLVESIFVPEGPDVADMWIADRARTGDVVVTSDIPLAAKVVAAGALVVKPNGETLTQANIGNALATRDLMADLRSADPFRQGGGRPFSKADRSRFLDALERAMRKAQEAGRSASGGNEAGS
>NZ_CP015287.1|WP_002721045.1|2602545_2603376_+|S-formylglutathione-hydrolase
MKTLSESRCFGGTQGVYSHTSQVTGCDMTFGLFLPPEAENEAVPLVWYLSGLTCTHENAMVKAGAQKWAAQEGLALVFPDTSPRGEGVPDDENYALGQGAGFYVNATEAPWSTNFRMWDYITEDLPRVLFSAFPLDESRQSIMGHSMGGHGALTIAMSFPGRFRSVSAFAPITHPTASDWGRKQLTAYLGTDESKWAPHDSVLLMRKRGFDGPILIDQGASDQFLDALKPEALAEAMMARRQQGIIRMQPGYDHSYFFVSTFMEDHIQFHAEALYD
>NZ_CP015287.1|WP_002721044.1|2601600_2602530_+|AEC-family-transporter
MLPVLLETLPFFALIGTGYMAGRMGMFTPEATAWLTKFVFYFALSAMLFRFAANLSLAEIWSLPFVAAYLAGSGAVYLLATLVARMRGVGTEVAAMEAQCAVIGNTGFLGVPMLVLLLGAGAAGPVLMMLSIDLIFFSSLITLIITGKREGHMSLRVVKVLALGLLRNPMIVSMVAGLGWSATGAAVPEPVNEFLALLGGAATPGALFAIGASLAGKSAERLEIAAWLSFCKLVLHPLSVAVAALAIFPVERQAAGVMIAAAALPVAGNVYILAQHYGVAPQRVSASILISTAVSILTITGVIAWVTTF
>NZ_CP015287.1|WP_011338541.1|2600264_2601242_+|membrane-protein
MFSSFSSRRRFRDLSDAEILALAISSEEDDARIYRSYADRLRAPYPGTAALFEAMAEEEDSHRRRLIGTFRDRFGETIPLIRREHVEGYPSRKPVWLLETLPLERVRREAWEMENAARSFYETAARHVTDASTRKLLGDLAAAEAAHEHRAERLAEEHLTDEATAAEDETARRQFILTWVQPGLAGLMDGSVSTLAPIFATAFATQDPATTFQVALAASVGAGISMGFTEAAHDDGVLSGRGAPWKRGLASGVMTTAGGLGHALPYLIPDFAWATGIAIAVVFFELWAIAWIQNRYMETPFLRAALQVVLGGGLVLAAGILIGFG
>NZ_CP015287.1|WP_002721040.1|2599970_2600099_-|hypothetical-protein
MKRLTLTLATLTLALGLAAPSFALPLDIPHLTWPDSCTTCGR
>NZ_CP015287.1|WP_011338540.1|2599295_2599919_-|TetR/AcrR-family-transcriptional-regulator
MPAETPPARKGRKMPQVLEGARTIFLRDGFEGASVDDIARAAGVSKATLYSYFPDKRLLFLEVAKAECLRQSEEAVALITADLAPRAVLTLAATRIVAFVLSDFGIRTYRICVAEADRFPELGHEFYESGPALVRQRIVDYLAQAVGRGELAIDDLELAADQFAELCKADLFNRIVFGVGNSVSEAERQKVAQGAVEMFLARYAPRP
>NZ_CP015287.1|WP_002721037.1|2598476_2599265_+|exodeoxyribonuclease-III
MTFTLATWNINSVRLREALVSRLLTEEMPDILCLQECKSPVEKMPLEAFRALGYHWCVARGQKSYNGVAILSKLPLVDAGDHDFADLGHARHVSAALENGVTIHNCYVPAGGDIPDREQNVKFGQKLDYLTRMRDWCRADTPKKAILVGDLNIAPREDDVWNHKSLLKIVSHTPIEVDHLNALMEAGAWIDVTRKDLPEGRLYSWWSYRSPDWEAADKGRRLDHIWATPDIVNAAHGSRILKAARGWLQPSDHAPVFATFDL
>NZ_CP015287.1|WP_002721035.1|2597441_2598128_+|response-regulator-transcription-factor
MASLKKILLVDDDDDLREALSEQLVMTEDFDVFEAASGAEGMEKAKAGLYDLVILDVGLPDTDGRELCRRMRKAGVKCPVLMLTGHDSDSDTILGLDAGANDYVTKPFKFPVLLARIRAQLRAHEQSEDAVFQLGPYSFRPAQKMLVDEKERKIRLTEKETNILKFLYRASQGVVAREVLLHEVWGYNAGVTTHTLETHIYRLRQKIEPDPSNARLLVTESGGYRLVA
>NZ_CP015287.1|WP_011338545.1|2605788_2607039_+|DUF3419-family-protein
MTQFALTHLPAPPVARQIGAAVHRTSLLSAEGLMERMFSRLFHGLVYPQIWEDPAVDMAALAIRPGDRLVAIASGGCNVLSYLTQGPGSILAVDLSPAHVALGRLKLAAARTLPDHAAFFDLFGRADLPGNAALYDRHIAPALDGRSRRYWEARSPFGRRIQLFERGFYRHGALGRFIGAAHTLARAAGTDLRGFLDCPDIEAQRSFFYAHIGPLFEAPVVQALARRPAALFGLGIPPAQYALLAGDGDGDVLPVLRQRLHRLLCDFPLRENYFAFQAIARRYPRPGEGALPPYLEPTAFETLRENAGRVQIENRSLTEALAAEPEESIHGFTLLDAQDWMTDAQLTALWRQVTRTAAPGARVIFRTGGAADLLPGRVPEEILGHWRADRAAGQAGHAADRSAIYGGFHLYRRRDA
>NZ_CP015287.1|WP_011338546.1|2607035_2607668_+|methyltransferase-domain-containing-protein
MTDATHAALMDATYRHQRRIYDVTRRHFLLGRDRLIAELDPPPGARVLEIACGTGRNLDLIGRRWPGCRLSGLDISQEMLASARARLGRRATLALGDATRFEALPLFGTDRFERIVLSYALSMIPDWREALREAALHLVPGGRLHVVDFGDQAGLPGWARAGLRGWIGRFHVTPRDDLGTALGETALGIGGYAEYRSLGGGYAILGTLTR
>NZ_CP015287.1|WP_002721051.1|2608073_2609027_-|DMT-family-transporter
MAKSNTRGALLALLAFAIYATHDVVVKVLGRDYTAVQILFFATLLGFPLASMMLMRDRADGNLRPRHPWWVLLRTCCIVTTGLCAFYAFSVLPLAQTYAILFTMPLLVTLLAIPLLGETIGLHRGAAIATGLLGVLIVLRPGAEPLSLGHAAALLAAVTSSLGSVIVRKIGQDERSVVLLLYPMVANFFVLGAALPFVYRPMPVEHLGMMGIIAAFSFVAMLLTITAYRMAEAVIVAPMQYSQMVWAAIFGWLIFGERSDVWTWVGAGVIIASGLYIVGRESRRNVSENRPASQTRLRPEVGLMPRLLRRRETRDTP
>NZ_CP015287.1|WP_017139959.1|2609391_2610501_-|3-isopropylmalate-dehydrogenase
MANPSLLILAGDGIGPEVMAEVKRIIGWFGEKRGVSFDVSEDLVGGAAYDAHGTPLADETMARAQEVDAVLLGAVGGPKYDVLDFSVKPERGLLRLRKEMDLYANLRPAQCFDALADFSSLKRDIVAGLDIMIVRELTSGVYFGEPRGIFPDNEGGRFGVNTQRYTTEEIRRVARSAFELARRRNNRVCSMEKANVMESGILWREEVQWVHDNEYPDVELSHMYADNGAMQLVRWPRQFDVIVTDNLFGDILSDCAAMLTGSLGMLPSASLGAPMANGRPKALYEPVHGSAPDIAGQGKANPIACILSFAMALRYSFDMGEEATRLEKAVETVLADGVRTADLMGPEGGTPVSTSGMGDAVLAALDASL
>NZ_CP015287.1|WP_011338548.1|2610597_2611527_-|endonuclease/exonuclease/phosphatase-family-protein
MDLERAGPGLLLRDIRAGKDPQILAVRRMIEALRADVLFLTGVDYDADLLAARALAGDLYPHLLALRPNVGRPTGIDLDGDGRLGGPGDAQGWGRFGGQGGMVLLSRLPLGLPRDFSDLLWADLPEANLPPMPPEARAVQRLASVGAWEVPLPRTGGPALKLLLWSATPPVFDGPEDRNGRRAGDEALFWARLLDGRLPFPAPEGPVLLMGKANIDPLAGDGPRAAIAALLAHPALQDPAPRGPDGSRATADFRADDGPGLLRTDYILPARGLPVTASGVLWPPPGDPLAAVAAQASRHRPVWVELDLP
>NZ_CP015287.1|WP_011338549.1|2611607_2612531_-|membrane-protein
MGRHLRPCRNRREAIAPVEPAARGKGGVNVFSRLSGALLRASLVVLLLALPSVLLPGVGADGQQMVALAALFGGVLTLVEYNATYPGLVEFRDAPPFNRLRFALLLVMVLTLTLMQREASDPSALTALSARAAGAVGTAMDFAYSPVRLATLMLSDRATPEQTAVLRNAAGISYLIATAAVAMFVAVIRLNRWPSRNLAFNVWVNLPTFEATAGGDVVQRLLRDARFNLALGFLLPFLIPIAVKIGTSGLDPLTLASPQALVWITVAWAFLPASLLMRGVGMARIAEMIREKRRTGEVFGTRGLAPV
>NZ_CP015287.1|WP_002721055.1|2612682_2613288_-|3-isopropylmalate-dehydratase-small-subunit
MQEFTKVTGVAAPMPLVNIDTDMIIPKQFLKTIQRSGLGKNLFDEMRYNPDGSEIPEFVLNQPAYRDAQIIVAGDNFGCGSSREHAPWALLDFGIRCVISTSFADIFYNNCFKNGILPIVMPPEVVEVLMEDARRGANARMTVDLEAQTVTTSDGQSFPFQVDSFRRHCLMNGLDDIGLTLEKAASIDGFERDLATLRPWV
>NZ_CP015287.1|WP_002721056.1|2613291_2613816_-|hypothetical-protein
MKGTSSLIVSGILALLGGIAALAFPLPVSLAVTVLAGCVFVASGAFGLWAAFSDRGMPSRGAAAFFSLVSLVAGVWMLANPLAGMVSLTLMLGALFLVSGVVRLGLSLATWRGTVMFWLMALSGLISAGLGLFILLRLPEASLVLLGTLVAVELIVMGATLVAMGFALRKSGNP
>NZ_CP015287.1|WP_011338550.1|2613879_2615307_-|3-isopropylmalate-dehydratase-large-subunit
MTAPRTLYDKIWDDHVVHQSEDGTCLLYIDRHLVHEVTSPQAFEGLRMTGRKVRAPEKTIAVPDHNVPTTEGRDTKIDNEESRIQVEALDKNARDFGINYYPVSDIRQGIVHIVGPEQGWTLPGMTVVCGDSHTATHGAFGALAHGIGTSEVEHVLATQTLIQKKSKNMKVEITGSLRPGVTAKDITLSVIGLTGTAGGTGYVIEYCGQAIRELSMEGRMTVCNMAIEGGARAGLIAPDEKTFAYVMGRPHAPKGAAWEAALAYWKTLFTDEGAQFDKVVTIRGEDIAPVVTWGTSPEDVLPITATVPAPEDFTGGKVEAARRSLEYMGLTPGQKLTDIKIDTVFIGSCTNGRIEDLRAAAEILKGKKVAPGMRAMVVPGSGLVRAQAEEEGLAQIFIDAGFEWRLAGCSMCLAMNPDQLSPGERCASTSNRNFEGRQGRNGRTHLVSPGMAAAAAITGHLTDVRDLMMAPAEPA
>NZ_CP015287.1|WP_017139960.1|2615368_2615455_-|hypothetical-protein
MERIFDMDDRARLPWRFYGASLSILARL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

216395 : 245678

Paracoccus_phage(26.67%)

terminase,capsid,head,portal,tail,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080588209.1\|216395_216620_+\|transposase	transposase	NA	NA	NA	NA
WP_023003513.1\|217916_219380_+	dNTP triphosphohydrolase	NA	NA	NA	NA
WP_011336890.1\|219373_220210_+	hypothetical protein	NA	NA	NA	NA
WP_011336891.1\|220168_221227_-	ImmA/IrrE family metallo-endopeptidase	A0A0U4JD08	Gordonia_phage	1.0e-40	34.9
WP_011336892.1\|221248_221893_-	hypothetical protein	NA	NA	NA	NA
WP_011336893.1\|222106_222589_-	hypothetical protein	F8TVB7	EBPR_siphovirus	7.1e-10	47.0
WP_011336894.1\|222601_223411_-	hypothetical protein	A0A0B5A5A2	Paracoccus_phage	3.8e-64	50.2
WP_011336895.1\|223464_224271_-	DNA adenine methylase	A0A291AUP9	Sinorhizobium_phage	9.8e-81	56.6
WP_011336896.1\|224672_225671_+	PAS domain-containing protein	NA	NA	NA	NA
WP_011336897.1\|225683_226073_+	response regulator	NA	NA	NA	NA
WP_011336898.1\|226143_226461_-	hypothetical protein	I3UM16	Rhodobacter_phage	2.1e-23	58.9
WP_011336899.1\|226594_226933_-	hypothetical protein	NA	NA	NA	NA
WP_011336900.1\|226936_227254_-	hypothetical protein	NA	NA	NA	NA
WP_061350815.1\|227260_228745_-	hypothetical protein	A0A0S3UG21	Pseudomonas_phage	3.6e-12	30.2
WP_011336902.1\|228761_229652_-	hypothetical protein	NA	NA	NA	NA
WP_061350816.1\|229651_234658_-	hypothetical protein	A0A0U4JEA4	Pseudomonas_phage	9.5e-49	53.0
WP_011336904.1\|234720_234957_-	hypothetical protein	NA	NA	NA	NA
WP_011336905.1\|235040_235415_-	hypothetical protein	NA	NA	NA	NA
WP_011336906.1\|235417_235858_-	hypothetical protein	A0A2P1N076	Streptomyces_phage	2.5e-06	34.4
WP_011336907.1\|235867_236248_-	DUF3168 domain-containing protein	A0A0U2BX31	Paracoccus_phage	2.0e-28	55.6
WP_011336908.1\|236251_236419_-	hypothetical protein	NA	NA	NA	NA
WP_011336909.1\|236415_236889_-	hypothetical protein	A0A0U2C0P4	Paracoccus_phage	1.1e-26	51.9
WP_011336910.1\|236885_237218_-\|head,tail	head-tail adaptor protein	A0A0U2BXJ0	Paracoccus_phage	2.0e-16	44.5
WP_011336911.1\|237214_237721_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_011336912.1\|237725_238016_-	hypothetical protein	NA	NA	NA	NA
WP_011336913.1\|238148_239483_-\|capsid	phage major capsid protein	Q6UAX6	Klebsiella_phage	7.1e-52	37.4
WP_011336914.1\|239736_240480_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_011336915.1\|240490_241450_-	S49 family peptidase	I3ULZ8	Rhodobacter_phage	3.0e-20	36.2
WP_011336916.1\|241446_242715_-\|portal	phage portal protein	Q6DMU2	Streptococcus_phage	6.6e-23	25.8
WP_011336917.1\|242828_243701_-	EamA family transporter	NA	NA	NA	NA
WP_011336918.1\|244019_245678_-\|terminase	terminase	A0A2H4JB64	uncultured_Caudovirales_phage	1.7e-79	32.3

DBSCAN-SWA_2

376991 : 386038

uncultured_Mediterranean_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011336989.1\|376991_379214_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	8.3e-114	40.9
WP_011336990.1\|379337_379859_-	single-stranded DNA-binding protein	A0A0U2C0X4	Paracoccus_phage	4.6e-47	77.6
WP_011336991.1\|380072_380687_+	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	3.8e-24	45.3
WP_009563716.1\|380799_382092_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.5e-94	45.8
WP_011336992.1\|382198_382756_-	superoxide dismutase family protein	NA	NA	NA	NA
WP_002722646.1\|383047_383374_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	4.3e-19	54.4
WP_002722648.1\|383389_385054_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_002722650.1\|385063_386038_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.0e-52	42.3

DBSCAN-SWA_3

630637 : 667524

Paracoccus_phage(20.0%)

terminase,capsid,head,portal,tail,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011337174.1\|630637_631372_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_011337175.1\|631387_631684_+	hypothetical protein	NA	NA	NA	NA
WP_023003546.1\|631690_632368_-	hypothetical protein	NA	NA	NA	NA
WP_011337177.1\|632509_632707_+	hypothetical protein	NA	NA	NA	NA
WP_017140100.1\|632801_633455_+	hypothetical protein	NA	NA	NA	NA
WP_011337179.1\|633923_634376_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011337180.1\|634614_635367_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_011337182.1\|635725_636580_+	hypothetical protein	NA	NA	NA	NA
WP_023003548.1\|637619_639053_+	ATPase	NA	NA	NA	NA
WP_011337186.1\|639529_641044_+	SAVED domain-containing protein	NA	NA	NA	NA
WP_011337187.1\|641162_642374_+	hypothetical protein	NA	NA	NA	NA
WP_011337188.1\|642370_644176_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
WP_011337189.1\|644168_644687_+	hypothetical protein	NA	NA	NA	NA
WP_011337190.1\|644841_645339_-	hypothetical protein	F8TVB7	EBPR_siphovirus	5.6e-10	47.0
WP_011337191.1\|645351_646161_-	hypothetical protein	A0A0B5A5A2	Paracoccus_phage	4.9e-64	50.0
WP_011337192.1\|646215_647022_-	DNA adenine methylase	A0A291AUP9	Sinorhizobium_phage	1.6e-83	57.8
WP_011337193.1\|647325_648231_+	DMT family transporter	NA	NA	NA	NA
WP_011336898.1\|648301_648619_-	hypothetical protein	I3UM16	Rhodobacter_phage	2.1e-23	58.9
WP_017140105.1\|648755_649094_-	hypothetical protein	NA	NA	NA	NA
WP_011337195.1\|649097_649415_-	hypothetical protein	NA	NA	NA	NA
WP_011337196.1\|649421_650906_-	hypothetical protein	G8DH61	Emiliania_huxleyi_virus	1.6e-12	32.5
WP_011337197.1\|650921_651812_-	hypothetical protein	NA	NA	NA	NA
WP_011337198.1\|651811_656833_-\|tail	tail tape measure protein	A0A0U4JEA4	Pseudomonas_phage	3.1e-47	52.5
WP_023003549.1\|656956_657202_-	hypothetical protein	NA	NA	NA	NA
WP_011337200.1\|657276_657663_-	hypothetical protein	NA	NA	NA	NA
WP_011337201.1\|657659_658103_-	hypothetical protein	A0A2P1N076	Streptomyces_phage	1.8e-07	33.3
WP_011337202.1\|658112_658493_-	DUF3168 domain-containing protein	A0A0U2BX31	Paracoccus_phage	3.8e-27	53.2
WP_011337203.1\|658496_659054_-	hypothetical protein	A0A0U2C0P4	Paracoccus_phage	2.9e-15	37.3
WP_011337204.1\|659053_659386_-\|head	phage head closure protein	NA	NA	NA	NA
WP_011337205.1\|659382_659724_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_011337206.1\|659720_660155_-	hypothetical protein	NA	NA	NA	NA
WP_011337207.1\|660225_661527_-\|capsid	phage major capsid protein	Q6JIM7	Burkholderia_virus	1.3e-79	43.1
WP_011337208.1\|661539_662379_-\|protease	Clp protease ClpP	K7PH05	Enterobacteria_phage	1.4e-69	58.1
WP_011337209.1\|662375_663626_-\|portal	phage portal protein	M4QP41	Tetraselmis_viridis_virus	5.8e-80	40.3
WP_011337210.1\|663625_665335_-\|terminase	terminase large subunit	A0A2H4J559	uncultured_Caudovirales_phage	6.2e-133	41.9
WP_011337211.1\|665336_665813_-	hypothetical protein	NA	NA	NA	NA
WP_011337212.1\|665855_666755_-	AAA family ATPase	I3ULZ4	Rhodobacter_phage	3.9e-30	56.1
WP_011337213.1\|666861_667524_-	hypothetical protein	G8DGC1	Emiliania_huxleyi_virus	4.2e-37	40.6

DBSCAN-SWA_4

963734 : 985734

Azospirillum_phage(33.33%)

terminase,capsid,head,tail,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002719501.1\|963734_964466_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_002719502.1\|964540_964792_+	hypothetical protein	NA	NA	NA	NA
WP_002719503.1\|964877_965240_+	PRC-barrel domain-containing protein	NA	NA	NA	NA
WP_002719504.1\|965227_965806_-	hypothetical protein	NA	NA	NA	NA
WP_017140143.1\|965869_967237_-	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_011337410.1\|967340_968519_-	aminotransferase	NA	NA	NA	NA
WP_011337411.1\|968547_969051_-	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_002719508.1\|969060_969675_-	LysE family transporter	NA	NA	NA	NA
WP_002719509.1\|969676_970501_-	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_011337412.1\|970643_971246_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_002719511.1\|971362_971905_+	cold shock domain-containing protein	NA	NA	NA	NA
WP_011337413.1\|971919_972381_+	DUF192 domain-containing protein	NA	NA	NA	NA
WP_011337414.1\|973030_973825_-	hypothetical protein	A0A1C7A9N9	Freshwater_phage	1.3e-21	31.6
WP_011337415.1\|973951_974113_-	hypothetical protein	NA	NA	NA	NA
WP_011337416.1\|974242_974875_-	hypothetical protein	NA	NA	NA	NA
WP_011337417.1\|974949_975414_-	hypothetical protein	NA	NA	NA	NA
WP_011337418.1\|976130_978140_-	hypothetical protein	A0A291AUM6	Sinorhizobium_phage	2.7e-63	48.4
WP_017140144.1\|978152_979763_-\|terminase	terminase large subunit	B0VK29	Azospirillum_phage	2.1e-37	27.0
WP_011337420.1\|979762_980158_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_011337421.1\|980154_980469_-\|head	phage head closure protein	NA	NA	NA	NA
WP_011337422.1\|980471_980888_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_011337423.1\|980880_981303_-	HK97 gp10 family phage protein	A0A0U2C0P4	Paracoccus_phage	6.8e-09	40.5
WP_023003570.1\|981286_981598_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_023003572.1\|981816_983265_+	hypothetical protein	NA	NA	NA	NA
WP_011337425.1\|983249_983600_-	HNH endonuclease	Q38456	Bacillus_phage	5.5e-20	48.9
WP_011337426.1\|983602_984199_-	hypothetical protein	NA	NA	NA	NA
WP_017140147.1\|984198_985734_-\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	5.0e-41	36.0

DBSCAN-SWA_5

1049725 : 1113274

Bacillus_thuringiensis_phage(25.0%)

capsid,head,portal,tail,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002719573.1\|1049725_1050451_+\|protease	proteasome-type protease	NA	NA	NA	NA
WP_011337476.1\|1050440_1051394_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_002719575.1\|1051390_1051675_-	SCP2 sterol-binding domain-containing protein	NA	NA	NA	NA
WP_011337477.1\|1051750_1052323_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011337479.1\|1055206_1055503_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_002719579.1\|1055557_1055896_+	ferredoxin family protein	NA	NA	NA	NA
WP_002719580.1\|1056175_1056685_+	CarD family transcriptional regulator	NA	NA	NA	NA
WP_017140155.1\|1056872_1057622_-	adenosylcobinamide-GDP ribazoletransferase	NA	NA	NA	NA
WP_011337481.1\|1057703_1058720_+	nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase	NA	NA	NA	NA
WP_002719583.1\|1058775_1060644_-	potassium transporter	NA	NA	NA	NA
WP_011337483.1\|1060818_1063695_-	hypothetical protein	NA	NA	NA	NA
WP_002719585.1\|1063858_1064551_+	SIMPL domain-containing protein	NA	NA	NA	NA
WP_061350826.1\|1064596_1065889_-	O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase	NA	NA	NA	NA
WP_011337485.1\|1066131_1066479_-	hypothetical protein	NA	NA	NA	NA
WP_002719588.1\|1066475_1066862_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	2.6e-07	33.1
WP_011337486.1\|1066839_1067757_-	protein-glutamate O-methyltransferase	NA	NA	NA	NA
WP_011337487.1\|1067753_1068212_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_011337488.1\|1068213_1070274_-	chemotaxis protein CheA	NA	NA	NA	NA
WP_011337489.1\|1070281_1070650_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	9.8e-12	35.3
WP_011337490.1\|1070640_1070925_-	STAS domain-containing protein	NA	NA	NA	NA
WP_011337491.1\|1070921_1071521_-	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
WP_011337492.1\|1071643_1073956_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.8e-09	62.7
WP_023003583.1\|1074062_1075724_-	methyl-accepting chemotaxis sensory transducer	NA	NA	NA	NA
WP_011337494.1\|1075953_1077636_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.9e-07	31.4
WP_002719598.1\|1077724_1078093_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.5e-12	38.5
WP_011337495.1\|1078089_1078419_-	STAS domain-containing protein	NA	NA	NA	NA
WP_023003585.1\|1078697_1080704_+	alpha-1,4-glucan--maltose-1-phosphate maltosyltransferase	NA	NA	NA	NA
WP_061350827.1\|1080700_1084006_+	maltose alpha-D-glucosyltransferase	NA	NA	NA	NA
WP_011337498.1\|1084002_1086189_+	1,4-alpha-glucan branching protein GlgB	NA	NA	NA	NA
WP_011337499.1\|1086185_1088252_+	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_061350828.1\|1088248_1090027_+	malto-oligosyltrehalose trehalohydrolase	NA	NA	NA	NA
WP_011337501.1\|1090023_1091841_+	4-alpha-glucanotransferase	NA	NA	NA	NA
WP_011337502.1\|1091837_1094453_+	malto-oligosyltrehalose synthase	NA	NA	NA	NA
WP_011337503.1\|1094511_1095177_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_002719608.1\|1095296_1096760_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-47	32.0
WP_002719609.1\|1096844_1097459_-	CvpA family protein	NA	NA	NA	NA
WP_002719610.1\|1097477_1098836_-	DNA repair protein RadA	NA	NA	NA	NA
WP_002719611.1\|1098968_1099394_-	paraquat-inducible protein A	NA	NA	NA	NA
WP_002719612.1\|1099394_1100141_-	ATP-binding cassette domain-containing protein	F2Y1V5	Organic_Lake_phycodnavirus	8.7e-07	25.6
WP_002719613.1\|1100137_1100920_-	ABC transporter permease	NA	NA	NA	NA
WP_011337504.1\|1100916_1101966_-	alanine racemase	NA	NA	NA	NA
WP_002719615.1\|1102194_1102932_+	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
WP_002719616.1\|1103110_1103344_+	acyl carrier protein	I1TR04	Pseudomonas_phage	7.3e-05	43.9
WP_011337505.1\|1103840_1105103_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_017140158.1\|1105102_1106281_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_011337507.1\|1106390_1106795_+	hypothetical protein	NA	NA	NA	NA
WP_023003587.1\|1106787_1108086_+	DNA-packaging protein	A0A0K1LMR9	Caulobacter_phage	1.3e-71	41.7
WP_011337509.1\|1108158_1109334_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	1.5e-58	38.3
WP_002719622.1\|1109335_1109569_+	hypothetical protein	NA	NA	NA	NA
WP_011337510.1\|1109573_1110137_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.4e-30	49.3
WP_011337511.1\|1110202_1111399_+\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	3.6e-63	42.2
WP_011337512.1\|1111493_1112093_+	hypothetical protein	NA	NA	NA	NA
WP_011337513.1\|1112092_1112428_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_011337514.1\|1112424_1112823_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_002719628.1\|1112860_1113274_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA

DBSCAN-SWA_6

1655960 : 1694620

Paracoccus_phage(36.36%)

capsid,head,portal,tail,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011337883.1\|1655960_1657001_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_011337884.1\|1657086_1660371_-	hypothetical protein	NA	NA	NA	NA
WP_002720132.1\|1660461_1660923_+	peroxiredoxin	NA	NA	NA	NA
WP_011337885.1\|1661333_1662677_+	peptidoglycan DD-metalloendopeptidase family protein	A8ATH6	Listeria_phage	1.5e-20	46.7
WP_011337886.1\|1662666_1663185_+	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_011337887.1\|1663380_1664157_-	DUF2189 domain-containing protein	NA	NA	NA	NA
WP_002720136.1\|1664526_1665654_-	peptide chain release factor 2	NA	NA	NA	NA
WP_011337888.1\|1665762_1668312_-	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_011337889.1\|1668403_1669639_-	N-acetylmuramoyl-L-alanine amidase	C8CHK8	Thermus_virus	4.8e-10	37.9
WP_011337890.1\|1669687_1670839_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_011337891.1\|1671006_1671750_+	DsbA family protein	NA	NA	NA	NA
WP_011337892.1\|1672085_1673219_-	flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase	NA	NA	NA	NA
WP_017140227.1\|1673349_1674564_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011337894.1\|1674674_1675898_-	5-aminolevulinate synthase	V5LQ39	Emiliania_huxleyi_virus	3.6e-34	29.1
WP_011337895.1\|1676032_1676602_-	hypothetical protein	NA	NA	NA	NA
WP_017140228.1\|1676831_1678205_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_011337897.1\|1678201_1678645_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_023003635.1\|1680060_1680393_+	hypothetical protein	NA	NA	NA	NA
WP_023003637.1\|1680425_1684043_-	hypothetical protein	A0A0U2C146	Paracoccus_phage	1.3e-103	37.0
WP_023003639.1\|1684042_1684468_-	hypothetical protein	S4TR39	Salmonella_phage	1.3e-10	31.4
WP_023003640.1\|1684517_1685192_-	hypothetical protein	A0A0U2C133	Paracoccus_phage	7.1e-16	32.6
WP_011337903.1\|1685200_1685845_-	hypothetical protein	NA	NA	NA	NA
WP_023003642.1\|1685848_1688170_-	hypothetical protein	A0A2H4PI09	Pseudomonas_phage	8.6e-21	29.6
WP_023003644.1\|1688230_1688500_-	hypothetical protein	NA	NA	NA	NA
WP_023003646.1\|1688574_1688907_-	hypothetical protein	NA	NA	NA	NA
WP_011337905.1\|1689033_1689519_-	HNH endonuclease	Q6XQ94	Escherichia_phage	4.2e-18	39.5
WP_023003648.1\|1689684_1690104_-\|tail	phage major tail protein 2	NA	NA	NA	NA
WP_023003649.1\|1690167_1690536_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_023003651.1\|1690541_1691006_-	HK97 gp10 family phage protein	A0A0U2C0P4	Paracoccus_phage	4.1e-15	34.0
WP_011337908.1\|1691006_1691324_-\|head	phage head closure protein	NA	NA	NA	NA
WP_011337909.1\|1691325_1691667_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_011337910.1\|1691690_1692800_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_011337911.1\|1692872_1693397_-\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	3.0e-30	50.6
WP_011337912.1\|1693393_1694620_-\|portal	phage portal protein	Q6JIM9	Burkholderia_virus	7.5e-32	30.8

DBSCAN-SWA_7

1909197 : 1927037

Bacillus_phage(50.0%)

terminase,capsid,head,portal,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011338055.1\|1909197_1909842_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_002720338.1\|1909790_1910162_-	DUF2155 domain-containing protein	NA	NA	NA	NA
WP_002720339.1\|1910158_1910629_-	outer membrane lipid asymmetry maintenance protein MlaD	NA	NA	NA	NA
WP_002720340.1\|1910628_1911003_-	NADH:ubiquinone oxidoreductase subunit NDUFA12	NA	NA	NA	NA
WP_061350849.1\|1911127_1912393_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.0e-133	58.4
WP_002720342.1\|1912517_1913150_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	5.2e-61	61.0
WP_011338057.1\|1913316_1913925_-	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_011338058.1\|1914039_1915245_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011338059.1\|1915241_1916930_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_011338060.1\|1916926_1917571_+	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_002720349.1\|1917703_1918174_+	CAP domain-containing protein	A0A0E3T7R5	Bacillus_phage	4.3e-12	34.4
WP_011338061.1\|1918250_1919570_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_011338062.1\|1919610_1920522_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_017140245.1\|1920826_1921105_+	hypothetical protein	NA	NA	NA	NA
WP_011338064.1\|1921117_1921624_-	hypothetical protein	NA	NA	NA	NA
WP_011338065.1\|1921659_1922166_-	hypothetical protein	NA	NA	NA	NA
WP_011338066.1\|1922167_1923229_-\|portal	phage portal protein	NA	NA	NA	NA
WP_011338067.1\|1923230_1923785_-\|head,protease	HK97 family phage prohead protease	NA	NA	NA	NA
WP_017140247.1\|1923784_1925047_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_011338069.1\|1925031_1925373_-	HNH endonuclease	A0A0S2GLI5	Bacillus_phage	3.7e-05	32.5
WP_023003677.1\|1925363_1927037_-\|terminase	phage terminase-like protein large subunit	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP015290

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015290_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015290_1

3824-3902

Orphan

Consensus_repeat	Method
GATTTGTTTCGCGCGCGAAACAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015290_1

>merge|NZ_CP015290|1|3824-3902|CRISPRCasFinder
GATTTGTTTCGCGCGCGAAACAATTTGCCCCCGCCGTGCCGCCCTGCCGACCCCCCGATTTGTTTCGCGCGCGAAACAA

>NZ_CP015290|1|1|3824-3902|CRISPRCasFinder
GATTTGTTTCGCGCGCGAAACAA	TTTGCCCCCGCCGTGCCGCCCTGCCGACCCCCC
GATTTGTTTCGCGCGCGAAACAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015290.1\|WP_002724803.1\|6062_7025_+\|replication-initiator-protein-A	unknown	unknown	gnl\|CDD\|370826
NZ_CP015290.1\|WP_002724812.1\|10529_11420_+\|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl\|CDD\|130274
NZ_CP015290.1\|WP_002724800.1\|1557_2379_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213187
NZ_CP015290.1\|WP_011836182.1\|9681_10533_+\|dTDP-4-dehydrorhamnose-reductase	unknown	unknown	gnl\|CDD\|367904
NZ_CP015290.1\|WP_009565041.1\|8077_8641_+\|dTDP-4-dehydrorhamnose-3,5-epimerase	unknown	unknown	gnl\|CDD\|376414
NZ_CP015290.1\|WP_011836181.1\|8644_9685_+\|dTDP-glucose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|224013
NZ_CP015290.1\|WP_011836180.1\|3917_5372_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274585
NZ_CP015290.1\|WP_017140428.1\|401_1541_+\|sugar-transporter	unknown	unknown	gnl\|CDD\|226055
NZ_CP015290.1\|WP_011836179.1\|2677_3793_-\|ParB-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|274586
NZ_CP015290.1\|WP_011836183.1\|11394_12177_-\|deacetylase-sulfotransferase	unknown	unknown	gnl\|CDD\|366246
NZ_CP015290.1\|WP_011836184.1\|12543_13269_-\|sulfotransferase	unknown	unknown	gnl\|CDD\|379204
NZ_CP015290.1\|WP_002724637.1\|13470_14307_+\|3-deoxy-8-phosphooctulonate-synthase	unknown	unknown	gnl\|CDD\|235363
NZ_CP015290.1\|WP_002724804.1\|7075_8014_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133039

Protein	Function_ID	Function_description	E-value
NZ_CP015290.1\|WP_002724803.1\|6062_7025_+\|replication-initiator-protein-A	gnl\|CDD\|370826	pfam10134, RPA, Replication initiator protein A. Members of this family of bacterial proteins are single-stranded DNA binding proteins that are involved in DNA replication, repair and recombination.	2.32126e-121
NZ_CP015290.1\|WP_002724812.1\|10529_11420_+\|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl\|CDD\|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	2.32712e-162
NZ_CP015290.1\|WP_002724800.1\|1557_2379_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213187	cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.	1.78218e-89
NZ_CP015290.1\|WP_011836182.1\|9681_10533_+\|dTDP-4-dehydrorhamnose-reductase	gnl\|CDD\|367904	pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.	1.37587e-123
NZ_CP015290.1\|WP_009565041.1\|8077_8641_+\|dTDP-4-dehydrorhamnose-3,5-epimerase	gnl\|CDD\|376414	pfam00908, dTDP_sugar_isom, dTDP-4-dehydrorhamnose 3,5-epimerase. This family catalyze the isomerisation of dTDP-4-dehydro-6-deoxy -D-glucose with dTDP-4-dehydro-6-deoxy-L-mannose. The EC number of this enzyme is 5.1.3.13.	5.08975e-99
NZ_CP015290.1\|WP_011836181.1\|8644_9685_+\|dTDP-glucose-4,6-dehydratase	gnl\|CDD\|224013	COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane].	0
NZ_CP015290.1\|WP_011836180.1\|3917_5372_-\|AAA-family-ATPase	gnl\|CDD\|274585	TIGR03453, partition_RepA, plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error. [Mobile and extrachromosomal element functions, Plasmid functions].	9.92759e-59
NZ_CP015290.1\|WP_017140428.1\|401_1541_+\|sugar-transporter	gnl\|CDD\|226055	COG3524, KpsE, Capsule polysaccharide export protein [Cell envelope biogenesis, outer membrane].	1.37396e-72
NZ_CP015290.1\|WP_011836179.1\|2677_3793_-\|ParB-N-terminal-domain-containing-protein	gnl\|CDD\|274586	TIGR03454, partition_RepB, plasmid partitioning protein RepB. Members of this family are the RepB protein involved in replicon partitioning. RepB is found, in general, as part of a repABC operon in plasmids and small chromosomes, separate from the main chromosome, in various bacteria. This model describes a rather narrow clade of proteins; it should be noted that additional homologs scoring below the trusted cutoff have very similar functions, although they may be named differently. [Mobile and extrachromosomal element functions, Plasmid functions].	9.68349e-12
NZ_CP015290.1\|WP_011836183.1\|11394_12177_-\|deacetylase-sulfotransferase	gnl\|CDD\|366246	pfam00685, Sulfotransfer_1, Sulfotransferase domain.	7.28903e-11
NZ_CP015290.1\|WP_011836184.1\|12543_13269_-\|sulfotransferase	gnl\|CDD\|379204	pfam13469, Sulfotransfer_3, Sulfotransferase family.	2.53227e-11
NZ_CP015290.1\|WP_002724637.1\|13470_14307_+\|3-deoxy-8-phosphooctulonate-synthase	gnl\|CDD\|235363	PRK05198, PRK05198, 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional.	0
NZ_CP015290.1\|WP_002724804.1\|7075_8014_+\|glycosyltransferase	gnl\|CDD\|133039	cd04196, GT_2_like_d, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	3.06441e-72

>NZ_CP015290.1|WP_011836179.1|2677_3793_-|ParB-N-terminal-domain-containing-protein
MAKRKRLTLPPLGGFAPGPASASEASPAPASPPALGPGLAPAPISRVTGEAAATAALREVAEELGAARSEGRLVLRLELDRIEEGWLVRDRIGLEAEELASLMTSLSAHGQRSPIEVTDMGEGRFGLISGWRRVTALRRLHAETGEERFATVLALLRRPDTAAAAYVAMVEENEIRAGLSYFERARIAAKAVEAGVFATDKLALQQLYGSASRAKRSKIGSFLGIYRALEGALRYPSALPERLGLALARRLEEEPGVAAKITAALAAAAPDSAEAELALIADLLAPAAEAAPEQEPARPSAPDPAPDAPAPAPAPDPAPAQPRSTRPPAPAAELRPGLFLKAEGAGSLHLYGPAVDETFRARLRDWLASEG
>NZ_CP015290.1|WP_002724800.1|1557_2379_+|ABC-transporter-ATP-binding-protein
MIELRNVSKSYVLNGTRKVVARDLNFTFPSGESVGLLGRNGAGKSSLLRMLAGTMLPDTGEILSSGTISWPVGFSGSFHPELTGAQNVRFVARLYGVDTEAMIAFVRDFAEIGQHFHLPVRSYSSGMRSRLAFGISMAVPFDTYLIDEVTAVGDAAFSAKSNAILRARLEESGAVIVSHSMPLLKKLCRSGAVLHDGQLFYYERIEQAIRHHESMMRGALPRWMRGDLDEGEGEEAGAAAPGPRARARAGAARAGGGRAARPGPASGTSEPRG
>NZ_CP015290.1|WP_017140428.1|401_1541_+|sugar-transporter
MPAAAPRAAARLRHHGLLASFLGLVLAPILASGLYLFAIAEDQYTSTVGFSVRTEEMGSALDLLGGLSSFGLTGGGSASDSDILYQFIQSQELVQRINERIDLRAIYSKPGFDPVFSFDPDGGIEDLVDYWKDMVRISYDSTTGLIELRVHAFTPEDAQAVAQGILDESNRMINDLSAIARADATRYAREELDNAVERLRVQRVAMTEFRSRTQIVDPSADIQAQMGLLNTLQQQLASASIDLNLLRQTTQPSDPRIAQNERRIGVIEELIQREREKFGLGGGTGTGASTYSTMIAEFERLTVDLDFAEKAYIAALTNHDAAIAEAQRMSRYLATYVRPTLAQQSLYPQRGLLTLMIGGFALMLWAIGMLIYYSVRDRR
>NZ_CP015290.1|WP_011836180.1|3917_5372_-|AAA-family-ATPase
MAETRGRKTAGRGRVEMRKSPPAREPQVPLPPYFNISPDAALAELEAPLTTAGFAEIARSCAQGRDDLAARGLDAEGRRSLRLFSTWEITRYLIPVATAHFRRVLKANPDLPQGISETEGGAKWFTLDEVLRLRAHFAAEGSKAKEYRPYRPAGLPAKLVAVANFKGGVGKTSTAAHLAMSAALDGYRVLVIDLDSQGSMTSIFGGRVADEWGTVFPLLARHYAAHLQAENRARVARGDPPVPMDETLTEAQKIRAGDLIAKTHWPNIDLIGAQLNLYWAEFQIPVWRMQGRSWKLWDALTDVLAEDGVLDRYDVIFLDTPPALGYLTINGLAAADILLVPLGASFLEFDSTGRFFDMLHSTFRSIEEGENIAARALGREELAFEWDAVRAVLTRYDGAQQAEMAALMQAYMGRTMAPERQDFTALIGQAGEQVNGIYEADYRDFNRDTYIRGRETFDATYAAFKRLLVGIWRREELAAADAAE
>NZ_CP015290.1|WP_002724803.1|6062_7025_+|replication-initiator-protein-A
MADFFICDILDALPKDDMASMEHPVFSLATRPDLRVLDYAHNGVRITVTPSVRGLATLFDKDILIYCVSQLMAALNAGRAISRTLHLTAHDLMTATHRETSGDGYQRLREAFERLAGTRITTNMEVGGREITTGFGLIESWQIVRRSRGGRMVQVMVTLSEWLFQAVLTKSVLTLSRDYFRLRKPLERRIYELARKHCGQQPEWRVSIATLAKKSGSASPLRVFRKMIRDMIAADSLPGYSLAEEPGDLLCVTRRAAVLAPGLAPALRDTTLERVRARMPGWDVHALVAEWHAFWHSSGQPRLRSADAAFLGWIERRVPG
>NZ_CP015290.1|WP_002724804.1|7075_8014_+|glycosyltransferase
MTDAPPPRIALLLATYNGAANLEAQLESFAAQTLRPTWLVVSDDGSTDATRALLAAFAARHPWLALRLVEGPCRGSAQNFLHLLGQVPPEADMAALSDQDDVWLPEKLARGAAAMADLPADLPVLYGGSSWICDAELGNRRPYPLPVRPPGFRHALVQNIAGGNTMMLNRGAIALLAAASREPERIVVHDWWIYQIVSGAGGRVIFDPVPLLLYRQHGGNLIGANDGFRAKYRRLRMLLSGGFRQWNAINIRALSASAHRFTPENRRLLAEFEALRRAGPWGRLRQLKRIGLYRQGLPGRLSLWLAAVLGRI
>NZ_CP015290.1|WP_009565041.1|8077_8641_+|dTDP-4-dehydrorhamnose-3,5-epimerase
MQIEETELPGVLILTPRVFGDARGSFCEAWNRATLQGLGIDLDFVQDNQSISAPVGTVRGLHYQAPPHAQDKLVRVGHGAILDVAVDVRVGSPTYGRWVGVELTAGNARQLLVPKGFLHGFVTREPDTVVLYKTTDVYAPDCDGAVHFADPDLGIDWGIDPASAVLSDKDARAPRFADWTSPFSIEV
>NZ_CP015290.1|WP_011836181.1|8644_9685_+|dTDP-glucose-4,6-dehydratase
MKLIVTGGAGFIGSAVVRKAVADGHHVVNLDCLTYAACLDNLASVAGAPNYVFEKADIRDAEAMARIFATHRPDAVMHLAAESHVDRSIDGPGAFIDTNVRGTYVLLEAARAYWVGQGKPQGFRFHHISTDEVFGTLGETGQFTEETPYAPNSPYSASKAASDHLVRAWGETYGLPYVLTNCSNNYGPFHFPEKLIPVVILKALAGAPIPVYGKGENVRDWLYVEDHADALLTVLARGENHRSYNIGGENEAKNIDIVRKICAILDARRPKATPYADQIAFVTDRPGHDLRYAIDPTRIRTELGWRPSVTLDEGLERTVDWYLANEPWWRALQDRAGVGERLGVKA
>NZ_CP015290.1|WP_011836182.1|9681_10533_+|dTDP-4-dehydrorhamnose-reductase
MILVFGRTGQVARELARQAPDARFLGRDEADLADPEACARAIREAKPDAVINAAAWTAVDRAEEEEAPATVVNGEAPGAMARACAELGIPFVQISTDYVFDGSGTRPWQPGDPVGPLGAYGRSKLAGEEAVRAAGGPHAILRTSWVFSAHGANFVKTMLRLGATRDRLTVVCDQVGGPTPAADIAAACLAMARGLAARPDLSGTYHLSGGPDVSWADFAREIFRQAELDCLVADIASADYPQKAHRPANSRMDCSDLARFGLSRPDWRQGLARVLADLQEVSE
>NZ_CP015290.1|WP_002724812.1|10529_11420_+|glucose-1-phosphate-thymidylyltransferase-RfbA
MSVRKGIILAGGSGTRLYPLTIGVSKQLMPVYDKPMIYYPLSVLMLAGIREIAIITTPQDQEQFRRALGTGAQWGISLTYLVQPRPEGLAQAYTIAEEFLAGSPSCMVLGDNIFFGHGLPDLLALADAKTEGGTVFGYHVADPERYGVVAMDERGRVTQIVEKPKVAPSNYAVTGIYFLDARAPDLVHGIRPSERGELEIVSLLEIYLEEGLLDVQRMGRGFAWLDTGTHASLLDAGNFVRTLQLRQGMQTGCPEEIAFARGWVDAEALTGMAAQLSKNDYGRYLQGLLTDRMMEG
>NZ_CP015290.1|WP_011836183.1|11394_12177_-|deacetylase-sulfotransferase
MRAASPRVRFLVAGAQKCGTTALHRFLSAHPGLFLPAGKELHFFDRPLPDDWSGPEGPLYETAFAQARPDQLCGEATPVYLFHTPSLQRIRAYNPAMRLILLLRDPVLRAYSHWRMERTRGAETLPFPEAIRAGRARVAEDWRTFSYVERGFYGAQLTELERLFPREQRLVLWTDEMQRDHAGTLARIWRFLGCAAPPVPPPPAEIRPLDPAPGLAPLAEEDARYLRSLYAPDIALTEALTGRDLSLWREGALSPPSSGR
>NZ_CP015290.1|WP_011836184.1|12543_13269_-|sulfotransferase
MDRDLPETPALVLGASGGSGTRVAGQLLRAAGGYLGGARNEAGDSLALVAAIEALAARGARLLEGGRPEEADLALWRAALTEHLALHAGEPFWGWKNPRSMFLLPFSVALVPGLRFIHMVRDGRDMALSGNRRQYERHVPEGPGTPADRARFWAESNLRVKRHAEAVLGDRYAILRFEDLCRDPEGCMARLGRQFGLRLEPAGTGIEVRPPDGVGRHRALPAADRAAVEAAAAPAMEAFGY
>NZ_CP015290.1|WP_002724637.1|13470_14307_+|3-deoxy-8-phosphooctulonate-synthase
MTETPTIVTIGDIAIGGGHPIALITGPCQLESLDHARMMAERIAEACAPTGTKFIFKASYDKANRSSLSTARGLGMEKGLEILGRIREEFGVPVLTDVHEPGHCATAAEVCDVLQIPAFLCRQTDLLLAAGETGRAVNVKKGQFLAPWDMKNVADKVASTGNRRILLCERGTSFGYNTLVTDFRGLPTMAATGWPVVFDATHSVQQPGGLGGSSGGQREFAPVLARAACAVGVSALFIETHEDPDRAPSDGPNMIPVDRMGRLIADLCAFDALAKSLA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	NZ_CP030273	Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence	67220-67252	0	1.0
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	CP047033	Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence	60898-60930	0	1.0
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	21550-21582	0	1.0
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	NZ_CP047039	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence	60874-60906	0	1.0
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	NZ_CP015213	Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence	104690-104722	0	1.0
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	NZ_CP051470	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence	19476-19508	0	1.0
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	NZ_CP015290	Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence	3847-3879	0	1.0
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	NC_011960	Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence	72598-72630	2	0.939
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	28105-28137	2	0.939
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	291403-291435	7	0.788
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1573927-1573959	7	0.788
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	558458-558490	7	0.788
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MK864266	Gordonia phage Arri, complete genome	8692-8724	9	0.727
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MN284907	Gordonia phage Fireball, complete genome	8624-8656	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MK864264	Gordonia phage VanDeWege, complete genome	8812-8844	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MH479910	Gordonia phage Danyall, complete genome	8520-8552	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MT639651	Gordonia phage Portcullis, complete genome	8580-8612	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MH479917	Gordonia phage KimmyK, complete genome	8648-8680	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MH669015	Gordonia phage TillyBobJoe, complete genome	8335-8367	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MK814761	Gordonia phage SmokingBunny, complete genome	8499-8531	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	KX557286	Gordonia phage Twister6, complete genome	8431-8463	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MK864267	Gordonia phage Valary, complete genome	8884-8916	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MK967381	Gordonia phage RogerDodger, complete genome	8884-8916	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MT310872	Gordonia phage Evamon, complete genome	8501-8533	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MT521998	Gordonia phage Jambalaya, complete genome	8332-8364	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MK864265	Gordonia phage Barb, complete genome	8648-8680	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	NC_030913	Gordonia phage Wizard, complete genome	8624-8656	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MK305889	Gordonia phage Mutzi, complete genome	8520-8552	10	0.697
NZ_CP015290_1	1.1\|3847\|33\|NZ_CP015290\|CRISPRCasFinder	3847-3879	33	MN010760	Gordonia phage Nubi, complete genome	8521-8553	10	0.697

1. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to NZ_CP030273 (Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
tttgcccccgccgtgccgccctgccgacccccc	Protospacer
*********************************

2. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to CP047033 (Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
tttgcccccgccgtgccgccctgccgacccccc	Protospacer
*********************************

3. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
tttgcccccgccgtgccgccctgccgacccccc	Protospacer
*********************************

4. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to NZ_CP047039 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
tttgcccccgccgtgccgccctgccgacccccc	Protospacer
*********************************

5. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to NZ_CP015213 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
tttgcccccgccgtgccgccctgccgacccccc	Protospacer
*********************************

6. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to NZ_CP051470 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
tttgcccccgccgtgccgccctgccgacccccc	Protospacer
*********************************

7. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to NZ_CP015290 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence) position: , mismatch: 0, identity: 1.0

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
tttgcccccgccgtgccgccctgccgacccccc	Protospacer
*********************************

8. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to NC_011960 (Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence) position: , mismatch: 2, identity: 0.939

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
tttgcccccgccgtgccgccctgccggcccccg	Protospacer
**************************.*****

9. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.939

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
tttgcccccgccgtgccgccctgccggcccccg	Protospacer
**************************.*****

10. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.788

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
tgttcgcccgccttgccgccctggcgacccggc	Protospacer
* * * ****** ********** ******  *

11. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 7, identity: 0.788

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
tgttcgcccgccttgccgccctggcgacccggc	Protospacer
* * * ****** ********** ******  *

12. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.788

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
tgttcgcccgccttgccgccctggcgacccggc	Protospacer
* * * ****** ********** ******  *

13. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MK864266 (Gordonia phage Arri, complete genome) position: , mismatch: 9, identity: 0.727

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaaggatct	Protospacer
 ************ .**********.*   .*.

14. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MN284907 (Gordonia phage Fireball, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

15. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MK864264 (Gordonia phage VanDeWege, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

16. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MH479910 (Gordonia phage Danyall, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

17. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MT639651 (Gordonia phage Portcullis, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

18. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MH479917 (Gordonia phage KimmyK, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

19. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MH669015 (Gordonia phage TillyBobJoe, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

20. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MK814761 (Gordonia phage SmokingBunny, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

21. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to KX557286 (Gordonia phage Twister6, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

22. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MK864267 (Gordonia phage Valary, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

23. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MK967381 (Gordonia phage RogerDodger, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

24. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MT310872 (Gordonia phage Evamon, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

25. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MT521998 (Gordonia phage Jambalaya, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

26. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MK864265 (Gordonia phage Barb, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

27. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to NC_030913 (Gordonia phage Wizard, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

28. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MK305889 (Gordonia phage Mutzi, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

29. spacer 1.1|3847|33|NZ_CP015290|CRISPRCasFinder matches to MN010760 (Gordonia phage Nubi, complete genome) position: , mismatch: 10, identity: 0.697

tttgcccccgccgtgccgccctgccgacccccc	CRISPR spacer
gttgcccccgccggaccgccctgccaggagtct	Protospacer
 ************ .**********..   .*.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3917 : 14307

Enterobacteria_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011836180.1\|3917_5372_-	AAA family ATPase	A0A0K2FLP4	Brevibacillus_phage	2.2e-06	26.6
WP_002724803.1\|6062_7025_+	replication initiator protein A	A0A0K1Y6J9	Rhodobacter_phage	1.3e-58	39.1
WP_002724804.1\|7075_8014_+	glycosyltransferase	NA	NA	NA	NA
WP_009565041.1\|8077_8641_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	7.7e-32	43.5
WP_011836181.1\|8644_9685_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.2e-91	52.1
WP_011836182.1\|9681_10533_+	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	3.1e-32	38.5
WP_002724812.1\|10529_11420_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	7.7e-87	54.9
WP_011836183.1\|11394_12177_-	deacetylase sulfotransferase	NA	NA	NA	NA
WP_011836184.1\|12543_13269_-	sulfotransferase	NA	NA	NA	NA
WP_002724637.1\|13470_14307_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	6.0e-49	41.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP015288

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

371627 : 428773

Vibrio_phage(17.65%)

protease,tail,integrase,transposase

attL 371774:371792|attR 398506:398524

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011339201.1\|371627_373004_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
371774:371792	attL	NA	NA	NA	NA
WP_011339202.1\|373520_374813_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011339203.1\|374809_375511_-	hypothetical protein	NA	NA	NA	NA
WP_017140353.1\|375507_375723_-	hypothetical protein	NA	NA	NA	NA
WP_017140354.1\|375719_375929_-	DUF4031 domain-containing protein	A0A0A8IK97	Aurantimonas_phage	7.7e-14	59.1
WP_017140355.1\|376085_376355_-	hypothetical protein	A0A1X9HWB1	Ruegeria_phage	6.9e-07	36.7
WP_017140356.1\|376351_376579_-	hypothetical protein	NA	NA	NA	NA
WP_017140357.1\|376673_377111_+	hypothetical protein	Q8W6P3	Burkholderia_virus	1.6e-13	36.6
WP_011339204.1\|377107_377614_+	hypothetical protein	M4SPS7	Rhodobacter_phage	3.3e-10	39.2
WP_002723970.1\|377935_378580_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_061350878.1\|378604_381724_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_011339206.1\|381740_382904_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_011339207.1\|383000_384836_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_011339208.1\|385071_386874_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_002723978.1\|387398_388226_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011339210.1\|388408_389914_+	lipopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_011339211.1\|389927_390401_-	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_011339212.1\|390544_391204_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_011339213.1\|391351_392263_-	porin	NA	NA	NA	NA
WP_002723983.1\|392503_392677_-	YdcH family protein	NA	NA	NA	NA
WP_011339214.1\|393162_393891_+	DUF2306 domain-containing protein	NA	NA	NA	NA
WP_011339215.1\|394398_396177_+	SLC13 family permease	NA	NA	NA	NA
WP_011339216.1\|396310_396775_-	cupin domain-containing protein	NA	NA	NA	NA
WP_011339217.1\|396833_397550_-	LrgB family protein	NA	NA	NA	NA
WP_011339218.1\|397542_397896_-	CidA/LrgA family protein	NA	NA	NA	NA
WP_017140360.1\|398004_398661_-	HyuE hydantoin racemase	NA	NA	NA	NA
398506:398524	attR	NA	NA	NA	NA
WP_011339220.1\|398661_399498_-	ABC transporter permease	NA	NA	NA	NA
WP_009561538.1\|399499_400363_-	ABC transporter permease	NA	NA	NA	NA
WP_011339221.1\|400595_401861_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_011339222.1\|401886_402864_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.8e-21	32.2
WP_011339223.1\|403075_403789_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011339224.1\|403936_404374_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_011339225.1\|404370_405270_-	EamA family transporter RarD	NA	NA	NA	NA
WP_009561543.1\|405764_406262_+	bacterioferritin	NA	NA	NA	NA
WP_011339226.1\|406941_408048_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_011339227.1\|408054_409527_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	3.7e-09	32.1
WP_023004202.1\|409924_411088_+	AI-2E family transporter	NA	NA	NA	NA
WP_011339229.1\|411097_413824_-	methionine synthase	NA	NA	NA	NA
WP_011339230.1\|413820_414900_-	5-methyltetrahydrofolate--homocysteine methyltransferase	A0A140XBC7	Dickeya_phage	1.3e-14	54.0
WP_011339231.1\|415175_416054_+	hypothetical protein	NA	NA	NA	NA
WP_017140362.1\|416050_417094_+	lipocalin	NA	NA	NA	NA
WP_002724021.1\|417446_417680_+	hypothetical protein	NA	NA	NA	NA
WP_011339233.1\|418099_418294_+	hypothetical protein	A0A0U4JEJ6	Pseudomonas_phage	8.8e-12	58.2
WP_011339235.1\|418574_419072_+\|tail	phage major tail tube protein	A0A2H4JBU0	uncultured_Caudovirales_phage	6.8e-24	37.7
WP_011339236.1\|419086_419383_+\|tail	phage tail assembly protein	E5E3Q0	Burkholderia_phage	8.4e-14	51.2
WP_017140364.1\|419409_419538_+\|tail	GpE family phage tail protein	NA	NA	NA	NA
WP_011339237.1\|419547_421875_+	tape measure protein	A0A2I7S9D9	Vibrio_phage	7.0e-55	37.9
WP_017140365.1\|421867_422278_+\|tail	phage tail protein	A0A193GYE0	Enterobacter_phage	8.6e-33	50.4
WP_011339239.1\|422274_422487_+\|tail	phage tail protein	R9TR63	Vibrio_phage	9.9e-09	47.8
WP_011339240.1\|422483_423458_+\|tail	phage tail protein	D4HTW7	Vibrio_phage	1.0e-44	38.6
WP_017140366.1\|423601_424429_+	DNA adenine methylase	A0A219VHB5	Ochrobactrum_phage	3.9e-93	62.3
WP_011339242.1\|424757_425825_+	restriction endonuclease or methylase	A0A1S5SAB0	Streptococcus_phage	3.3e-60	38.8
WP_011339243.1\|425992_427009_-	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_011339244.1\|427402_427924_+	YbjN domain-containing protein	NA	NA	NA	NA
WP_017140370.1\|427951_428773_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	4.4e-20	31.7

DBSCAN-SWA_2

739351 : 746522

Rhizobium_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011339479.1\|739351_740698_+	S49 family peptidase	A0A068CE01	Rhizobium_phage	6.7e-58	47.0
WP_011339480.1\|740706_741018_+	hypothetical protein	NA	NA	NA	NA
WP_011339481.1\|741014_741434_+	hypothetical protein	NA	NA	NA	NA
WP_011339482.1\|741645_742461_+	hypothetical protein	A0A1S5R1J5	Pseudomonas_phage	4.2e-15	29.8
WP_017140410.1\|742467_742785_+	hypothetical protein	NA	NA	NA	NA
WP_011339484.1\|742788_743115_+	hypothetical protein	NA	NA	NA	NA
WP_011339485.1\|743248_743566_+	hypothetical protein	I3UM16	Rhodobacter_phage	2.8e-23	57.9
WP_011339486.1\|743618_743840_-	hypothetical protein	NA	NA	NA	NA
WP_017140411.1\|743832_744105_-	BrnT family toxin	K4NX81	Burkholderia_phage	2.4e-15	48.2
WP_011339488.1\|744332_745139_+	DNA adenine methylase	A0A291AUP9	Sinorhizobium_phage	2.5e-84	58.6
WP_011339489.1\|745193_746003_+	M15 family metallopeptidase	A0A0B5A5A2	Paracoccus_phage	7.1e-63	49.1
WP_011339490.1\|746015_746522_+	hypothetical protein	F8TVB7	EBPR_siphovirus	3.9e-11	48.2

DBSCAN-SWA_3

885705 : 909372

Acidithiobacillus_phage(18.75%)

capsid,terminase,head,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011339591.1\|885705_887037_-	DNA cytosine methyltransferase	A0A191SB20	Nostoc_phage	6.4e-53	36.2
WP_011339592.1\|887088_887517_-	DNA mismatch endonuclease Vsr	I6NSG0	Burkholderia_phage	8.7e-36	50.4
WP_011339593.1\|887769_888252_-	hypothetical protein	F8TVB7	EBPR_siphovirus	1.2e-12	51.8
WP_061350891.1\|888264_889074_-	hypothetical protein	A0A0B5A5A2	Paracoccus_phage	3.2e-63	49.4
WP_011339595.1\|889128_889935_-	DNA adenine methylase	A0A291AUP9	Sinorhizobium_phage	3.4e-81	57.0
WP_023004243.1\|890303_890663_-	hypothetical protein	NA	NA	NA	NA
WP_011339597.1\|890917_891235_-	hypothetical protein	I3UM16	Rhodobacter_phage	3.7e-23	57.9
WP_011339598.1\|891453_891780_-	hypothetical protein	NA	NA	NA	NA
WP_011339599.1\|891783_892101_-	hypothetical protein	NA	NA	NA	NA
WP_011339600.1\|892107_893592_-	hypothetical protein	A0A1S5R1J5	Pseudomonas_phage	1.7e-14	30.8
WP_011339601.1\|893607_894498_-	hypothetical protein	A0A2H4J8C7	uncultured_Caudovirales_phage	8.1e-28	31.0
WP_061350892.1\|894497_899672_-	hypothetical protein	F1C5E9	Cronobacter_phage	2.4e-07	28.5
WP_011339603.1\|899927_900272_+	YbjQ family protein	M4STD1	Rhodobacter_phage	5.9e-19	48.1
WP_017140288.1\|900234_900597_-	hypothetical protein	NA	NA	NA	NA
WP_011339605.1\|900659_901106_-	hypothetical protein	NA	NA	NA	NA
WP_011339606.1\|901203_901674_-	hypothetical protein	M4QQ74	Salicola_phage	1.2e-17	38.9
WP_011339607.1\|901785_902208_-	hypothetical protein	NA	NA	NA	NA
WP_011339608.1\|902204_902531_-	hypothetical protein	NA	NA	NA	NA
WP_011339609.1\|902541_903564_-\|capsid	major capsid protein	K4I3Z3	Acidithiobacillus_phage	1.1e-105	56.3
WP_011339610.1\|903645_904035_-\|head	head decoration protein	K4ICP8	Acidithiobacillus_phage	3.6e-20	45.7
WP_011339611.1\|904170_905517_-	S49 family peptidase	A0A068CE01	Rhizobium_phage	8.7e-58	48.2
WP_011339612.1\|905513_907004_-\|portal	phage portal protein	K4I1F2	Acidithiobacillus_phage	1.9e-178	67.4
WP_002723266.1\|907003_907213_-	hypothetical protein	NA	NA	NA	NA
WP_011339613.1\|907209_909372_-\|terminase	phage terminase large subunit family protein	A0A291AUS9	Sinorhizobium_phage	1.9e-102	35.4

DBSCAN-SWA_4

914020 : 923706

Rhodobacter_phage(44.44%)

integrase

attL 908943:908958|attR 924793:924808

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
908943:908958	attL	NA	NA	NA	NA
WP_011339620.1\|914020_914542_-	DUF1937 family protein	I3UM60	Rhodobacter_phage	2.7e-23	42.3
WP_011339621.1\|914678_914939_-	hypothetical protein	NA	NA	NA	NA
WP_011339622.1\|914935_915277_-	hypothetical protein	A0A1X9HW32	Ruegeria_phage	1.8e-07	41.6
WP_023004247.1\|915276_915522_-	hypothetical protein	NA	NA	NA	NA
WP_023004248.1\|915580_916267_+	helix-turn-helix domain-containing protein	H6WBQ3	Rhodobacter_phage	1.5e-13	40.0
WP_023004250.1\|916525_916627_+	hypothetical protein	NA	NA	NA	NA
WP_011339624.1\|916623_916821_+	hypothetical protein	NA	NA	NA	NA
WP_011339625.1\|916817_917150_+	hypothetical protein	NA	NA	NA	NA
WP_011339626.1\|917152_917272_+	hypothetical protein	NA	NA	NA	NA
WP_011339627.1\|917331_917742_+	hypothetical protein	I3UM32	Rhodobacter_phage	3.5e-18	44.0
WP_011339628.1\|917760_918747_+	DUF2303 family protein	H6WBP5	Rhodobacter_phage	7.5e-75	46.9
WP_017140296.1\|918843_918996_+	hypothetical protein	NA	NA	NA	NA
WP_023004252.1\|918997_919192_+	hypothetical protein	NA	NA	NA	NA
WP_023004254.1\|919194_919398_+	hypothetical protein	NA	NA	NA	NA
WP_011339629.1\|919390_920500_+	phage Gp37/Gp68 family protein	A0A0A8ILD3	Aurantimonas_phage	1.4e-85	50.1
WP_017140299.1\|920483_920744_+	hypothetical protein	NA	NA	NA	NA
WP_011339630.1\|920730_920985_+	hypothetical protein	NA	NA	NA	NA
WP_023004256.1\|921016_921442_+	DUF4326 domain-containing protein	A0A2H4PFT6	Mycobacterium_phage	1.1e-19	37.7
WP_011339632.1\|921747_922464_+	hypothetical protein	A0A0U2BXK1	Paracoccus_phage	3.5e-82	64.3
WP_080517723.1\|922552_922831_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011339633.1\|922707_923706_+\|integrase	site-specific integrase	U5P434	Shigella_phage	5.0e-10	26.3
924793:924808	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015287

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP015290

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP015288

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection