CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP010674	Phaeobacter gallaeciensis strain P75 plasmid pP75_a, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP010678	Phaeobacter gallaeciensis strain P75 plasmid pP75_e, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP010675	Phaeobacter gallaeciensis strain P75 plasmid pP75_b, complete sequence	0 crisprs	NA	0	0	1	0
NZ_CP010673	Phaeobacter gallaeciensis strain P75 chromosome, complete genome	1 crisprs	csa3,WYL,casR,DEDDh,cas3	2	1	5	1
NZ_CP010677	Phaeobacter gallaeciensis strain P75 plasmid pP75_d, complete sequence	0 crisprs	csa3	0	0	0	0
NZ_CP010676	Phaeobacter gallaeciensis strain P75 plasmid pP75_c, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP010680	Phaeobacter gallaeciensis strain P75 plasmid pP75_g, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP010679	Phaeobacter gallaeciensis strain P75 plasmid pP75_f, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

111138 : 160097

Vibrio_phage(33.33%)

transposase,integrase

attL 112774:112833|attR 154177:154322

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024099411.1\|111138_112773_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
112774:112833	attL	NA	NA	NA	NA
WP_007803148.1\|112902_113565_-	3-hydroxyacyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_052440151.1\|113842_114832_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_096705159.1\|114910_115219_-	universal stress protein	NA	NA	NA	NA
WP_082032859.1\|115808_116069_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_040104548.1\|116232_116538_-\|transposase	transposase	NA	NA	NA	NA
WP_158524501.1\|116677_117619_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_096705141.1\|117681_118392_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_082032860.1\|118485_119037_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_040104532.1\|120425_121664_-	amidohydrolase	NA	NA	NA	NA
WP_040104531.1\|121684_121984_-	hypothetical protein	NA	NA	NA	NA
WP_040104533.1\|121970_122312_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_040104530.1\|122558_122903_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_096705142.1\|122899_123838_-	EamA family transporter	NA	NA	NA	NA
WP_096705143.1\|123865_124309_-	hypothetical protein	NA	NA	NA	NA
WP_040104538.1\|124322_125195_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_096705144.1\|125311_126448_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_096705145.1\|126488_127427_-	oxidoreductase	NA	NA	NA	NA
WP_096705146.1\|127567_128713_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_040104545.1\|128840_130121_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_096705147.1\|130432_131008_-	hypothetical protein	NA	NA	NA	NA
WP_096705148.1\|131208_133059_-	TRAP transporter fused permease subunit	NA	NA	NA	NA
WP_096705149.1\|133279_134269_-	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_040104543.1\|134580_135048_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_096705150.1\|135529_136564_-	dehydrogenase	A0A2R8FCS0	Cedratvirus	1.5e-20	31.2
WP_096705151.1\|136563_138333_-	acetolactate synthase	G8DDL3	Micromonas_pusilla_virus	8.6e-05	24.4
WP_096705152.1\|138466_139318_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_007803185.1\|139444_140923_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_040545992.1\|140979_141735_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_040104559.1\|141843_142563_+	3-oxoacid CoA-transferase subunit A	NA	NA	NA	NA
WP_008335453.1\|142580_143258_+	CoA transferase subunit B	NA	NA	NA	NA
WP_076626053.1\|143254_144454_+	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
WP_158524502.1\|144459_145377_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_096705153.1\|145452_146235_+	3-oxoadipate enol-lactonase	A0A023W7H4	Mycobacterium_phage	1.2e-06	34.6
WP_065818607.1\|146231_146612_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_096705154.1\|146611_147340_+	protocatechuate 3,4-dioxygenase subunit beta	NA	NA	NA	NA
WP_096705155.1\|147341_147947_+	protocatechuate 3,4-dioxygenase subunit alpha	NA	NA	NA	NA
WP_096705156.1\|148018_149083_+	3-carboxy-cis,cis-muconate cycloisomerase	NA	NA	NA	NA
WP_096705157.1\|149214_149940_-	HAD family hydrolase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	2.8e-10	29.7
WP_096705158.1\|150056_150878_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	3.6e-46	42.7
WP_007803196.1\|150870_151662_-	hypothetical protein	NA	NA	NA	NA
WP_024099410.1\|151658_152540_-	AAA family ATPase	NA	NA	NA	NA
WP_024099411.1\|152541_154176_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_007803209.1\|155082_156477_+	membrane protein	NA	NA	NA	NA
154177:154322	attR	NA	NA	NA	NA
WP_007803213.1\|157407_158199_-	hypothetical protein	NA	NA	NA	NA
WP_007803215.1\|158195_159074_-	AAA family ATPase	NA	NA	NA	NA
WP_007803217.1\|159164_160097_-\|transposase	IS5-like element ISRhba5 family transposase	A0A1V0E8E1	Vibrio_phage	2.5e-51	37.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP010673

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010673_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010673_1

2337746-2337918

Orphan

Consensus_repeat	Method
GCCGCACGGGACGCCGCATGGGCCGCCGC	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP010673_1

>merge|NZ_CP010673|1|2337746-2337918|CRISPRCasFinder
GACGCCACCGAAGCAGAACGGGCCGCCGCACGGGACGCCGCACGGGACGCCGCACGGGCCGCCGCACGGGACGCCGCATGGGCCGCCGCCGGAGCTGCCGCACGGGACGCCGCATGGGCCGCCGCCGGAGCTGCCACACGGGACGCCGCACGGGACGCCGCACGGGCCGCCGC

>NZ_CP010673|1|1|2337746-2337918|CRISPRCasFinder
GACGCCACCGAAGCAGAACGGGCCGCCGC	ACGGGACGCCGCACGGGAC
GCCGCACGGGCCGCCGCACGGGACGCCGC	ATGGGCCGCCGCCGGAGCT
GCCGCACGGGACGCCGCATGGGCCGCCGC	CGGAGCTGCCACACGGGAC
GCCGCACGGGACGCCGCACGGGCCGCCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010673.1\|WP_024097689.1\|2336072_2336261_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010673.1\|WP_024097699.1\|2339520_2339730_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010673.1\|WP_040104147.1\|2341334_2344778_+\|bifunctional-proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase-PutA	unknown	unknown	gnl\|CDD\|237018
NZ_CP010673.1\|WP_024097691.1\|2336564_2337020_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010673.1\|WP_024097704.1\|2345670_2346087_+\|GFA-family-protein	unknown	unknown	gnl\|CDD\|226314
NZ_CP010673.1\|WP_024097686.1\|2334284_2334614_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010673.1\|WP_024097698.1\|2339221_2339524_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010673.1\|WP_024097687.1\|2334710_2335379_+\|ERF-family-protein	unknown	unknown	gnl\|CDD\|377346
NZ_CP010673.1\|WP_096705125.1\|2335368_2336073_+\|3'-5'-exonuclease	unknown	unknown	gnl\|CDD\|99825
NZ_CP010673.1\|WP_024097694.1\|2337989_2338307_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010673.1\|WP_024097684.1\|2333641_2333986_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010673.1\|WP_024097685.1\|2333991_2334288_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010673.1\|WP_040104145.1\|2337088_2337394_+\|DUF1364-domain-containing-protein	unknown	unknown	gnl\|CDD\|377777
NZ_CP010673.1\|WP_102892809.1\|2338303_2338546_+\|DUF551-domain-containing-protein	unknown	unknown	gnl\|CDD\|367946
NZ_CP010673.1\|WP_024097696.1\|2338542_2339007_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010673.1\|WP_024097683.1\|2333151_2333436_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010673.1\|WP_024097700.1\|2339990_2340623_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP010673.1\|WP_024097701.1\|2340692_2341166_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|183009
NZ_CP010673.1\|WP_024097690.1\|2336260_2336551_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010673.1\|WP_024097703.1\|2344841_2345630_+\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|223777

Protein	Function_ID	Function_description	E-value
NZ_CP010673.1\|WP_024097701.1\|2340692_2341166_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|183009	PRK11169, PRK11169, leucine-responsive transcriptional regulator Lrp.	5.1118e-44
NZ_CP010673.1\|WP_040104147.1\|2341334_2344778_+\|bifunctional-proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase-PutA	gnl\|CDD\|237018	PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed.	0
NZ_CP010673.1\|WP_040104145.1\|2337088_2337394_+\|DUF1364-domain-containing-protein	gnl\|CDD\|377777	pfam07102, DUF1364, Protein of unknown function (DUF1364). This family consists of several bacterial and phage proteins of around 95 residues in length. The function of this family is unknown.	3.62655e-36
NZ_CP010673.1\|WP_024097704.1\|2345670_2346087_+\|GFA-family-protein	gnl\|CDD\|226314	COG3791, COG3791, Uncharacterized conserved protein [Function unknown].	2.17418e-20
NZ_CP010673.1\|WP_102892809.1\|2338303_2338546_+\|DUF551-domain-containing-protein	gnl\|CDD\|367946	pfam04448, DUF551, Protein of unknown function (DUF551). This family represents the carboxy terminus of a protein of unknown function, found in dsDNA viruses with no RNA stage, including bacteriophages lambda and P22, and also in some Escherichia coli prophages.	0.00237169
NZ_CP010673.1\|WP_096705125.1\|2335368_2336073_+\|3'-5'-exonuclease	gnl\|CDD\|99825	cd05782, DNA_polB_like1_exo, Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases. A subfamily of the 3'-5' exonuclease domain of family-B DNA polymerases. This subfamily is composed of uncharacterized bacterial family-B DNA polymerases. Family-B DNA polymerases contain an N-terminal DEDDy DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-A DNA polymerases. This exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are involved in metal binding and catalysis. The exonuclease domain of family-B DNA polymerases has a fundamental role in proofreading activity. It contains a beta hairpin structure that plays an important role in active site switching in the event of a nucleotide misincorporation. Family-B DNA polymerases are predominantly involved in DNA replication and DNA repair.	7.22219e-56
NZ_CP010673.1\|WP_024097703.1\|2344841_2345630_+\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|223777	COG0705, COG0705, Membrane associated serine protease [Amino acid transport and metabolism].	2.15402e-42
NZ_CP010673.1\|WP_024097687.1\|2334710_2335379_+\|ERF-family-protein	gnl\|CDD\|377346	pfam04404, ERF, ERF superfamily. The DNA single-strand annealing proteins (SSAPs), such as RecT, Red-beta, ERF and Rad52, function in RecA-dependent and RecA-independent DNA recombination pathways. This family includes proteins related to ERF.	1.43415e-22
NZ_CP010673.1\|WP_024097700.1\|2339990_2340623_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	8.56322e-12

>NZ_CP010673.1|WP_040104145.1|2337088_2337394_+|DUF1364-domain-containing-protein
MKASGPKTTKLRTAAKGQPCTLRLPCCNSNPETTSLSHIRAFGWAGTAEKPMDFLAVFACSDCHDALDRRRNGELWGWDDVTRALGETLIAQHRMGNLIVA
>NZ_CP010673.1|WP_024097691.1|2336564_2337020_+|hypothetical-protein
MATRVLNSKEGIGPLADFLGARDKFPLTITITKGAARRGRQNRLAQRWFTDVSRQKEDETHEEVRAYCKLHFGVPILRAENEAFRQSYDRTMRPLDYETKLAAMKNLDIPVTRLMTVKQMTAFMDEMQRHWSGLGFRLTDPEALKYEEEFA
>NZ_CP010673.1|WP_024097690.1|2336260_2336551_+|hypothetical-protein
MGRYELPVNYDRLHWMERREVREQYAQEQGGKCQHCGADLAGQPAKRILRKRINWGLFPKNFRKYPVHLHHSHETGMTIGAVHNYCNAVLWQYHGE
>NZ_CP010673.1|WP_024097689.1|2336072_2336261_+|hypothetical-protein
MATPKQIRKTYEQVEDEARRLVSFLCEDTVQTCLEETATRTGESLEQVKEVMAAEWSMAGSG
>NZ_CP010673.1|WP_096705125.1|2335368_2336073_+|3'-5'-exonuclease
MPLDMSIIQEAYAAQRFVYFDIETIPCQDESYLHDLERKVKPPANLKKPESIEKWLAENRKSAAIDALAKTSFDGGRGRVCTIAWAKNDSPISVRHAKTTADERDILADFFADLDPYHSETLVGHNIAGFDIGFLRKRAVYLGVRMPAPNSFPRDQKPWDRSIVDTMTAWAGGTGWISMDELCQILGIQGKDGFDGSQVAAAWAAGEHDKIAEYCRDDVHRTREIHKRFLQAGF
>NZ_CP010673.1|WP_024097687.1|2334710_2335379_+|ERF-family-protein
MTKHEAIPALDTAVGHKSIASALSAAQMEMGKALKQANNPHFRSKYADLGNVMDACLPALNKNGIAVVQPTTDDDTGRYVKTILIHGETGETLECRVPLIVSKNDMQGYGSAVTYARRYGLMAMAGIAPEDDDGNAAAKAAPQVQTVSAGQYTKLRDLAQAAGVTEQDICAKVGAPSLEQFPANRFDAVAKGLQSKIDAANPSPAEQITGDEIPHKEPPHAP
>NZ_CP010673.1|WP_024097686.1|2334284_2334614_+|hypothetical-protein
MNSACNVHRIGKTIEKLRTDYAAASTPAGPLPPDHSREPRRGLDTGNPGCVADACETLNSEADQERFRESLSDAFIWGVWFLAFLCAAGAYLAAGPILRLIAWMAGAAI
>NZ_CP010673.1|WP_024097685.1|2333991_2334288_+|hypothetical-protein
MTIHPIHVIPSDDGIYKTIGGDLDVTAPLGTGFSDISSLSDAVRNCFEDAHPALPDLIIKLFETEAAAMEKKAKGEITQFHKAQGLRFAAKTIAQSTP
>NZ_CP010673.1|WP_024097684.1|2333641_2333986_+|hypothetical-protein
MQDRVFKTIYLGDDIECMAQVFFTTDYDAPDASVGCAGGHGVYASIADAVVEDVLHSRDELAEIFGKADVTRAEQIIEAQLTEALNDGESIIDDDGAEFDPADYAAPIHQIAAE
>NZ_CP010673.1|WP_024097683.1|2333151_2333436_+|hypothetical-protein
MNSTVSDLADYKKTLKSSGGGGTYDPMEVRVAKLEAELHSIDRRLDGIDRRLDRIEDKIPSKWDMAQVIFYVVGALMAAAIFGPRLLGLISAAT
>NZ_CP010673.1|WP_024097694.1|2337989_2338307_+|hypothetical-protein
MTDAGKEAVAGGDRLTQIEQLMLCVESDLSEPCLDTLWEETKRLLSENETLRAQLQAGRADYGCPDDETALNYIESTYGDDMRCAVSCMFDAIRALKSTSTEGEG
>NZ_CP010673.1|WP_102892809.1|2338303_2338546_+|DUF551-domain-containing-protein
MMDWQPIETAPKDGTEILAVYVPSGKFSPDFSIVEWDGKSWVGKCDGYRSIEAQSDFHTNYHEPFLTHWMPLPEPPKDPQ
>NZ_CP010673.1|WP_024097696.1|2338542_2339007_+|hypothetical-protein
MTDLIKAADALAECQDAKDLLAACKVDLEKAVVGRTAQSQLMTIHRVLGYVEENLSVIHHTLTTYRQARESADGVKVKPLVWSEDEEHAMGYRENSLTLIGPYWVEDHENSGEWRTYFDSFAGDVFISGSDSEEDAKAAAQADYEARIKAALED
>NZ_CP010673.1|WP_024097698.1|2339221_2339524_+|hypothetical-protein
MELPDRIWVYCNGGEHGDWGVTDDPENAKFGDIEYIQFPRFYELLNEIEVNRSRHYEDCLELLRKAEKRRSEALRIMAFAGALIITAGIIFALDIMIGGT
>NZ_CP010673.1|WP_024097699.1|2339520_2339730_+|hypothetical-protein
MMADQIITDEVKYVTATQAINSPRWPFGRDKFYRMVQRGKITPSIPFEGSRKVYSVAQIDGLFQAPSEQ
>NZ_CP010673.1|WP_024097700.1|2339990_2340623_-|tetratricopeptide-repeat-protein
MRQFWIAPILGFGFATAASLAQAEGAGLPPPSGDIASCPAAPDHQGAVDQLIGRVQAARDEASAQQISNQFWQYWADAPNAQAQALLDRGMTRRSAFDFLGALEAFDRLVAYCPEYAEGYNQRAFVHYLRRDFAAALTDLDRALALSPRHVAAMSGRALSLYGLSRLGEARVALEQALSLNPWLPERHLVAPGGPLAPEGADPTTPEVEL
>NZ_CP010673.1|WP_024097701.1|2340692_2341166_-|Lrp/AsnC-family-transcriptional-regulator
MQMDFPGMDRFDQAILVALGEDGRMSIADLARRIGLSKTPTQARLRRLEAEGIITGYRALIDPIRLGLDHVAFVEVKLTDTREAALAKFNAALARVPEIEQAHLMASHFDYLLKVRTRSMSAYRAVLGEKISALPHVASTSTYVAMQAVIEDSALLP
>NZ_CP010673.1|WP_040104147.1|2341334_2344778_+|bifunctional-proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase-PutA
MPSAPTPAHSNALRYRIDAGTYADQAQMRDQLFALANLDATDRSTISANAAALVRDIRGHSSPGLMEVFLAEYGLSTDEGVALMCLAEALLRVPDADTIDALIEDKIAPSEWGKHLGKSTSSLVNASTWALMLTGKVLDEKRSPVSALRGAIKRLGEPVIRTAVSRAMKEMGRQFVLGETIESAMKRAASMEAKGYTYSYDMLGEAARTEADAARYHLAYSRAISAIAAACNSEDIRQNPGISVKLSALHPRYELAQETRVMEELVPRLQALALLAKAAGMGLNVDAEEADRLSLSLEVIEEVISDPALAGWDGFGVVVQAYGPRTRAALDALYDMADRYDRRLMVRLVKGAYWDTEVKRAQVEGVDGFPVYTHKSLTDVSYIANARKLLSMTDRIYPQFATHNAHTVSAILHMAKETDNGAYEFQRLHGMGETLHQMVLEQNRTHCRIYAPVGAHRDLLAYLVRRLLENGANSSFVNQIVDETVPPEVVAADPFAQVEDLTANLRKGPDLFQPERPNSMGFDLGHAPTLAAIDAARTPWKSNNWTAEPLLAEAPATTTTTDEPVRNPADLTTVGHVKTAGEAEIDAALSAATPWNAGAETRAEILNRAADLYEKNYGELFALLTREAGKSLPDCVAELREAVDFLRYYAARIPAEPPVGVFTCISPWNFPLAIFSGQIAAALAVGNAVLAKPAEQTPLIAHRAISLLHEAGVPRSALQLLPGGGSVGGALTSDARVGGVAFTGSTATALKIRAAMAEHLRPGAPLIAETGGLNAMIVDSTALPEQAVQSVIESAFQSAGQRCSALRCLYLQDDIADNVLKMLKGAMDALRLGDPWNLSTDSGPVIDETARKGILAHIDTARAEGRVLKEMTAPQGGTFVAPTLIEITGIQALEQEIFGPVLHVVRFKSQDLDQIISDINATGYGLTFGLHTRIDDRVQYICDRIHAGNLYVNRNQIGAIVGSQPFGGEGLSGTGPKAGGPFYMARFCAPDRQSAATDWPSETAPMTSLPAPTGQPMQEVTTSLPGPTGESNRLSQLSRPPLLCLGPGPEAVAAQARAVHALGGTAIEATGPLDMAFLQTMVDTGGVIWWGDEPTAREIEHQLAKHDGPILPLIPGLPDIARVQAERHVCVDTTAAGGNAALLGGMS
>NZ_CP010673.1|WP_024097703.1|2344841_2345630_+|rhomboid-family-intramembrane-serine-protease
MFPIRDHNPSGRTPYVTYALMVANIAIFALIYFGYDSPRRLTALYNAYALLPAEVTSGYDWKTLLTSTFLHGSWMHLGGNMLFLWIFGDNMEDEMGHFTFLAFYLVSGVGAGLIHVASAPYSLVPLVGASGAIAGVMGGYLLLFPRARVDILLILIIYFRVFSIPAFVMLGVWLGMQFLGGIGSDPQAGGVAYWAHAGGFGVGLVLTIPLWLRRGGPTYWGKTHGQPPHPKVSYSASRIPRVARKSPRDAHRNSRRDSPWGR
>NZ_CP010673.1|WP_024097704.1|2345670_2346087_+|GFA-family-protein
MTSGTPTATTTDGPTTCRASCHCGAVEISADLPRGLASASRCNCSFCIRRGAAAVTARTDSLRILKGAENLSLYTWGSHTAKHYFCKTCGIYVYHQRRSDPAECGINLGCIDGGNPRAHAETYGEIPWHDGVNHPSDQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP010673_1	1.1\|2337775\|19\|NZ_CP010673\|CRISPRCasFinder	2337775-2337793	19	NZ_CP010673.1	2337907-2337925	1	0.947
NZ_CP010673_1	1.2\|2337823\|19\|NZ_CP010673\|CRISPRCasFinder	2337823-2337841	19	NZ_CP010673.1	403244-403262	2	0.895

1. spacer 1.1|2337775|19|NZ_CP010673|CRISPRCasFinder matches to position: 2337907-2337925, mismatch: 1, identity: 0.947

acgggacgccgcacgggac	CRISPR spacer
acgggccgccgcacgggac	Protospacer
***** *************

2. spacer 1.2|2337823|19|NZ_CP010673|CRISPRCasFinder matches to position: 403244-403262, mismatch: 2, identity: 0.895

atgggccgccgccggagct	CRISPR spacer
atgggccgccgccagcgct	Protospacer
*************.* ***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP010673_1	1.1\|2337775\|19\|NZ_CP010673\|CRISPRCasFinder	2337775-2337793	19	NC_023549	Clavibacter phage CN1A, complete genome	5375-5393	0	1.0

1. spacer 1.1|2337775|19|NZ_CP010673|CRISPRCasFinder matches to NC_023549 (Clavibacter phage CN1A, complete genome) position: , mismatch: 0, identity: 1.0

acgggacgccgcacgggac	CRISPR spacer
acgggacgccgcacgggac	Protospacer
*******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1091124 : 1180666

115

Rhodovulum_phage(18.92%)

head,terminase,tail,transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024096545.1\|1091124_1092513_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_024096546.1\|1092704_1094207_-	hypothetical protein	NA	NA	NA	NA
WP_040103924.1\|1094208_1094658_-	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
WP_024096548.1\|1094661_1095612_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_024096549.1\|1095636_1096368_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_024096550.1\|1096448_1097228_+	amidohydrolase family protein	NA	NA	NA	NA
WP_158524442.1\|1097331_1098228_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_024096552.1\|1098404_1099307_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_040103925.1\|1099320_1099911_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_024096554.1\|1100003_1100549_+	redoxin family protein	NA	NA	NA	NA
WP_024096555.1\|1100545_1100950_+	hypothetical protein	NA	NA	NA	NA
WP_024096556.1\|1100973_1101429_+	DUF4440 domain-containing protein	NA	NA	NA	NA
WP_024096557.1\|1101442_1101877_+	DUF4440 domain-containing protein	NA	NA	NA	NA
WP_024096558.1\|1101918_1102305_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_024096559.1\|1102350_1103505_-	amidohydrolase	NA	NA	NA	NA
WP_024096560.1\|1103574_1104384_-	agmatinase	NA	NA	NA	NA
WP_040103927.1\|1104398_1105439_-	ornithine cyclodeaminase	A0A1V0SL93	Klosneuvirus	6.3e-88	47.3
WP_024096562.1\|1105450_1106374_-	DMT family transporter	NA	NA	NA	NA
WP_096705073.1\|1106370_1107792_-	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_158524499.1\|1107981_1108854_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_024096565.1\|1109056_1110424_+	YjiH family protein	NA	NA	NA	NA
WP_024096566.1\|1110506_1110914_-	DUF4440 domain-containing protein	NA	NA	NA	NA
WP_024096567.1\|1111386_1112385_-	type IV secretion system protein	NA	NA	NA	NA
WP_024096568.1\|1112406_1112583_-	DUF4177 domain-containing protein	NA	NA	NA	NA
WP_096705074.1\|1113792_1114233_-	hypothetical protein	NA	NA	NA	NA
WP_096705075.1\|1114282_1115080_-	hypothetical protein	A0A1B0T6H5	Thiobacimonas_phage	2.4e-47	45.5
WP_096705076.1\|1115418_1115868_+	hypothetical protein	NA	NA	NA	NA
WP_096705077.1\|1115867_1116110_+	hypothetical protein	NA	NA	NA	NA
WP_096705078.1\|1116099_1116969_+	ParB N-terminal domain-containing protein	A0A1B0T6M1	Pelagibaca_phage	1.0e-35	38.4
WP_096705079.1\|1116968_1119119_+\|transposase	transposase	A0A1B1P6Z4	Rhodovulum_phage	7.8e-242	57.2
WP_096705080.1\|1119195_1119939_+	ATP-binding protein	A0A1B1P6Z7	Rhodovulum_phage	2.2e-87	66.3
WP_096705081.1\|1119935_1120163_+	hypothetical protein	NA	NA	NA	NA
WP_096705082.1\|1120159_1120747_+	hypothetical protein	A0A1B1P6Z8	Rhodovulum_phage	3.2e-57	60.4
WP_096705083.1\|1120743_1121115_+	hypothetical protein	A0A1B0T6M5	Pelagibaca_phage	1.8e-37	59.2
WP_096705084.1\|1121111_1121762_+	DUF3164 family protein	M4STB6	Rhodobacter_phage	5.0e-75	62.1
WP_096705085.1\|1121920_1122424_+	hypothetical protein	NA	NA	NA	NA
WP_096705086.1\|1122420_1122873_+	regulatory protein GemA	A0A1B0T6H1	Thiobacimonas_phage	8.3e-37	54.4
WP_096705087.1\|1122869_1123118_+	hypothetical protein	A0A1B1P700	Rhodovulum_phage	5.2e-09	47.5
WP_096705088.1\|1123114_1123501_+	hypothetical protein	NA	NA	NA	NA
WP_096705089.1\|1123589_1124009_+	lysozyme	A0A1B1P706	Rhodovulum_phage	1.5e-37	53.1
WP_096705090.1\|1124005_1124536_+	hypothetical protein	A0A2I7R2S9	Vibrio_phage	9.5e-16	31.7
WP_096705091.1\|1124523_1124880_+	DUF2730 family protein	A0A1B1P705	Rhodovulum_phage	6.3e-24	60.6
WP_096705092.1\|1124876_1125176_+	hypothetical protein	A0A1B0T6F4	Thiobacimonas_phage	1.5e-23	52.6
WP_096705093.1\|1125177_1125642_+	DUF3310 domain-containing protein	A0A088FRG2	Mycobacterium_phage	5.9e-22	70.6
WP_096705094.1\|1125619_1126156_+	DUF3486 family protein	A0A1B0T6K5	Pelagibaca_phage	5.9e-50	56.2
WP_096705095.1\|1126481_1126691_+	hypothetical protein	NA	NA	NA	NA
WP_096705096.1\|1126687_1128082_+\|terminase	terminase	A0A1B1P714	Rhodovulum_phage	1.2e-198	76.1
WP_096705097.1\|1128081_1129626_+	DUF935 domain-containing protein	A0A2P9JZI9	Alteromonadaceae_phage	2.8e-132	47.4
WP_096705098.1\|1129618_1130827_+\|head	head morphogenesis protein	A0A219VH74	Ochrobactrum_phage	4.1e-75	41.8
WP_096705099.1\|1131172_1132162_+	hypothetical protein	A0A2P9JZJ0	Alteromonadaceae_phage	2.1e-72	47.0
WP_096705100.1\|1132167_1133079_+\|head	head protein	L7P7Y9	Pseudomonas_phage	2.4e-83	52.6
WP_096705101.1\|1133090_1133471_+	hypothetical protein	NA	NA	NA	NA
WP_158524547.1\|1133650_1134109_+	DUF1320 domain-containing protein	NA	NA	NA	NA
WP_096705103.1\|1134111_1134558_+	phage virion morphogenesis protein	R9U1C4	Rhizobium_phage	4.5e-11	34.4
WP_096705104.1\|1134554_1135100_+	hypothetical protein	NA	NA	NA	NA
WP_096705105.1\|1135099_1135525_+\|plate	phage baseplate assembly protein V	A0A2H4JFJ8	uncultured_Caudovirales_phage	7.3e-11	33.1
WP_096705106.1\|1135524_1135875_+	hypothetical protein	NA	NA	NA	NA
WP_096705107.1\|1135871_1136213_+\|plate	phage baseplate protein	R9TRM1	Vibrio_phage	6.5e-18	44.1
WP_096705108.1\|1136209_1137118_+\|plate	baseplate assembly protein	Q19UQ5	Mannheimia_phage	3.3e-69	49.0
WP_096705109.1\|1137110_1137806_+\|tail	phage tail protein I	A4PE44	Ralstonia_virus	2.3e-22	38.7
WP_096705110.1\|1137806_1138367_+	hypothetical protein	NA	NA	NA	NA
WP_096705111.1\|1138363_1140037_+	hypothetical protein	NA	NA	NA	NA
WP_096705112.1\|1140051_1140543_+	hypothetical protein	NA	NA	NA	NA
WP_096705113.1\|1140535_1141720_+\|tail	phage tail protein	A0A1W6JT53	Escherichia_phage	1.3e-92	43.3
WP_096705114.1\|1141730_1142228_+\|tail	phage major tail tube protein	K4I1G5	Acidithiobacillus_phage	2.8e-30	42.0
WP_096705135.1\|1142369_1142690_+\|tail	phage tail assembly protein	E5FFG6	Burkholderia_phage	4.2e-11	45.7
WP_096705115.1\|1142716_1142863_+\|tail	GpE family phage tail protein	A0A1S5NR79	Burkholderia_phage	4.9e-07	71.4
WP_096705116.1\|1142879_1145762_+\|tail	phage tail tape measure protein	A0A088FV68	Escherichia_phage	1.3e-47	32.8
WP_096705117.1\|1145758_1146193_+\|tail	phage tail protein	A0A1W6JT48	Escherichia_phage	4.0e-28	46.3
WP_096705118.1\|1146189_1146393_+\|tail	phage tail protein	F1BUQ5	Erwinia_phage	2.3e-10	54.2
WP_145958737.1\|1146396_1147377_+\|tail	phage tail protein	D4HTW7	Vibrio_phage	1.4e-49	40.8
WP_096705119.1\|1147373_1147748_+	DUF1353 domain-containing protein	NA	NA	NA	NA
WP_096705120.1\|1147883_1148714_+	DNA adenine methylase	A0A219VHB5	Ochrobactrum_phage	8.0e-86	58.6
WP_024096570.1\|1148991_1150305_-	type IV secretion pathway protein VirB10	NA	NA	NA	NA
WP_024096571.1\|1150297_1150993_-	TrbG/VirB9 family P-type conjugative transfer protein	NA	NA	NA	NA
WP_024096572.1\|1150996_1151647_-	type IV secretion system protein	NA	NA	NA	NA
WP_024096573.1\|1151651_1152431_-	type IV secretion system protein	NA	NA	NA	NA
WP_024096574.1\|1152427_1153576_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	7.5e-26	56.4
WP_024096575.1\|1153568_1153727_-	hypothetical protein	NA	NA	NA	NA
WP_024096576.1\|1153719_1156086_-	type IV secretion pathway protein VirB4	NA	NA	NA	NA
WP_024096577.1\|1156075_1156354_-	type IV secretion pathway protein VirB3	NA	NA	NA	NA
WP_024096578.1\|1156361_1156652_-	TrbC/VirB2 family protein	NA	NA	NA	NA
WP_024096579.1\|1156651_1157230_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	9.0e-20	53.3
WP_024096580.1\|1157294_1157621_-	hypothetical protein	NA	NA	NA	NA
WP_024096582.1\|1158456_1158936_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_096705122.1\|1159037_1160219_+	diaminopropionate ammonia-lyase	NA	NA	NA	NA
WP_155808116.1\|1160796_1160937_-	hypothetical protein	NA	NA	NA	NA
WP_024096585.1\|1161016_1161466_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_024096586.1\|1161589_1162543_+	catalase	NA	NA	NA	NA
WP_024096587.1\|1162737_1163175_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_052331584.1\|1163271_1164225_+	catalase	NA	NA	NA	NA
WP_024096589.1\|1164359_1164779_+	group III truncated hemoglobin	NA	NA	NA	NA
WP_024096590.1\|1164857_1165595_+	DUF2189 domain-containing protein	NA	NA	NA	NA
WP_024096591.1\|1165595_1165886_+	DUF1971 domain-containing protein	NA	NA	NA	NA
WP_024096592.1\|1165875_1167495_+	cytochrome-c oxidase, cbb3-type subunit I	NA	NA	NA	NA
WP_024096593.1\|1167500_1168232_+	cytochrome-c oxidase, cbb3-type subunit II	NA	NA	NA	NA
WP_024096594.1\|1168228_1168396_+	cbb3-type cytochrome c oxidase subunit 3	NA	NA	NA	NA
WP_024096595.1\|1168386_1169259_+	cytochrome-c oxidase, cbb3-type subunit III	NA	NA	NA	NA
WP_024096596.1\|1169245_1169410_+	hypothetical protein	NA	NA	NA	NA
WP_024096597.1\|1169455_1169911_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_024096598.1\|1170018_1170528_+	Heme/copper-type cytochrome/quinol oxidase subunit 2	NA	NA	NA	NA
WP_024096599.1\|1170528_1171989_+	Heme/copper-type cytochrome/quinol oxidase subunit 1	NA	NA	NA	NA
WP_024096600.1\|1171988_1172588_+	SCO family protein	NA	NA	NA	NA
WP_043939779.1\|1172590_1173145_+	hypothetical protein	NA	NA	NA	NA
WP_024096602.1\|1173151_1173982_+	formate/nitrite transporter	NA	NA	NA	NA
WP_145957939.1\|1173978_1174530_+	hypothetical protein	NA	NA	NA	NA
WP_040103928.1\|1174553_1174892_+	cytochrome c family protein	NA	NA	NA	NA
WP_024096605.1\|1175264_1175411_+	hypothetical protein	NA	NA	NA	NA
WP_052331586.1\|1175564_1175849_-	hypothetical protein	NA	NA	NA	NA
WP_052331587.1\|1175905_1177345_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_024096607.1\|1177481_1178258_+	aldolase	NA	NA	NA	NA
WP_024096608.1\|1178268_1179156_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_096753138.1\|1179236_1179494_+	hypothetical protein	NA	NA	NA	NA
WP_024096610.1\|1179571_1180408_+	formate/nitrite transporter	NA	NA	NA	NA
WP_040103929.1\|1180534_1180666_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

1544911 : 1612519

uncultured_Mediterranean_phage(22.22%)

protease,portal,head,tRNA,tail,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024096945.1\|1544911_1546204_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.6e-87	46.9
WP_024096946.1\|1546313_1547810_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_024096947.1\|1547989_1548274_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.0e-20	53.8
WP_024096948.1\|1548308_1549970_+	protein translocase subunit SecD	A0A1B1IVP7	uncultured_Mediterranean_phage	1.6e-05	24.0
WP_024096949.1\|1549972_1550941_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	4.7e-61	48.7
WP_024096950.1\|1551107_1551461_+	membrane protein	NA	NA	NA	NA
WP_024096951.1\|1551558_1552185_+	heme ABC exporter ATP-binding protein CcmA	G9BWD6	Planktothrix_phage	2.0e-09	29.2
WP_024096952.1\|1552181_1552838_+	heme exporter protein CcmB	NA	NA	NA	NA
WP_024096953.1\|1552883_1553615_+	heme ABC transporter permease	NA	NA	NA	NA
WP_040104006.1\|1553614_1553785_+	heme exporter protein CcmD	NA	NA	NA	NA
WP_024096955.1\|1553777_1554317_+	DsbE family thiol:disulfide interchange protein	NA	NA	NA	NA
WP_024096956.1\|1554392_1554692_-	hypothetical protein	NA	NA	NA	NA
WP_024096957.1\|1554967_1557655_-	aconitate hydratase AcnA	NA	NA	NA	NA
WP_024096958.1\|1557900_1558632_+	DUF1223 domain-containing protein	NA	NA	NA	NA
WP_024096959.1\|1558646_1559582_-	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_024096960.1\|1559952_1561149_-	flagellar motor switch protein	NA	NA	NA	NA
WP_024096961.1\|1561225_1561831_-	hypothetical protein	NA	NA	NA	NA
WP_024096962.1\|1562020_1563325_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	1.1e-17	30.2
WP_024096963.1\|1563604_1564861_-	OsmC family protein	NA	NA	NA	NA
WP_024096964.1\|1564956_1565517_+	NUDIX hydrolase	NA	NA	NA	NA
WP_024096965.1\|1565592_1566936_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_024096966.1\|1567123_1567882_+	DUF3445 domain-containing protein	NA	NA	NA	NA
WP_024096967.1\|1567919_1568945_-	hypothetical protein	NA	NA	NA	NA
WP_024096968.1\|1569486_1570893_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_014874894.1\|1570986_1571325_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_024096969.1\|1571517_1573209_+	bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase	NA	NA	NA	NA
WP_024096970.1\|1573583_1575788_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-13	29.1
WP_024096971.1\|1576197_1577328_+	porin	NA	NA	NA	NA
WP_024096972.1\|1577585_1578917_+	trigger factor	NA	NA	NA	NA
WP_024096973.1\|1579131_1580400_-	hemolysin-type calcium-binding protein	M4SNJ8	Pseudoalteromonas_phage	2.8e-05	25.9
WP_024096974.1\|1580698_1582657_-	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase	NA	NA	NA	NA
WP_024096975.1\|1582805_1583276_-	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_024096976.1\|1583588_1583771_-	hypothetical protein	NA	NA	NA	NA
WP_024096977.1\|1584003_1584618_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_005982441.1\|1584630_1584858_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_014874885.1\|1584886_1585240_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_040103985.1\|1585765_1586362_+	hypothetical protein	NA	NA	NA	NA
WP_014874883.1\|1586600_1587176_+	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_024096979.1\|1587300_1587600_-	hypothetical protein	NA	NA	NA	NA
WP_024096980.1\|1587871_1588663_+	FRG domain-containing protein	NA	NA	NA	NA
WP_024096981.1\|1588815_1590117_-	cytochrome b561	NA	NA	NA	NA
WP_024096982.1\|1590302_1591235_+	ACP S-malonyltransferase	NA	NA	NA	NA
WP_024096983.1\|1591319_1592057_+	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
WP_005982462.1\|1592691_1592925_+	acyl carrier protein	A0A2C9CX86	Yersinia_phage	7.3e-05	52.1
WP_024096984.1\|1593089_1593833_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	NA	NA	NA	NA
WP_024096985.1\|1594016_1595030_-	PilZ domain-containing protein	NA	NA	NA	NA
WP_024096986.1\|1595289_1596555_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_024096987.1\|1596554_1597709_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_024096988.1\|1598000_1598336_+	hypothetical protein	NA	NA	NA	NA
WP_024096989.1\|1598313_1599606_+	DNA-packaging protein	A0A0K1LMR9	Caulobacter_phage	3.9e-71	41.4
WP_024096990.1\|1599809_1601003_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	3.1e-59	35.9
WP_024096991.1\|1600995_1601214_+	hypothetical protein	NA	NA	NA	NA
WP_024096992.1\|1601249_1601867_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.8e-34	56.2
WP_024096993.1\|1601915_1603100_+\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	3.3e-61	41.7
WP_043939826.1\|1603289_1603934_+	hypothetical protein	NA	NA	NA	NA
WP_024096995.1\|1603930_1604302_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_024096996.1\|1604298_1604712_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_024096997.1\|1604816_1605230_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_024096998.1\|1605244_1605598_+	gene transfer agent family protein	NA	NA	NA	NA
WP_024096999.1\|1605594_1605852_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_024097000.1\|1605844_1606501_+\|tail	phage tail tape measure protein	D6PFD6	uncultured_phage	1.7e-14	36.6
WP_024097001.1\|1606516_1607149_+	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	2.0e-57	50.0
WP_024097002.1\|1607148_1608099_+	DUF2163 domain-containing protein	A0A0K0PVK1	Roseobacter_phage	2.5e-51	35.8
WP_024097003.1\|1608095_1608566_+	phage cell wall peptidase NlpC/P60 family	A0A1V0DYB6	Dinoroseobacter_phage	2.3e-29	47.1
WP_024097004.1\|1608565_1612519_+\|tail	phage tail protein	A0A0B5A7K5	Paracoccus_phage	6.4e-226	37.5

DBSCAN-SWA_3

1813258 : 1841222

Ruegeria_phage(23.53%)

protease,portal,head,terminase,tail,capsid,integrase

attL 1806452:1806466|attR 1828412:1828426

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1806452:1806466	attL	NA	NA	NA	NA
WP_096705123.1\|1813258_1814338_-\|integrase	tyrosine-type recombinase/integrase	A0A240F4W2	Ochrobactrum_phage	9.2e-50	33.0
WP_024097174.1\|1814631_1815285_-	recombinase family protein	A0A1S6L009	Salmonella_phage	6.4e-30	45.5
WP_024097175.1\|1815306_1815483_-	hypothetical protein	NA	NA	NA	NA
WP_096596809.1\|1815718_1816417_-	hypothetical protein	A0A0U1SZL2	Pseudomonas_phage	2.0e-29	45.0
WP_024097178.1\|1816490_1816637_-	hypothetical protein	NA	NA	NA	NA
WP_024097179.1\|1816693_1817083_-	hypothetical protein	NA	NA	NA	NA
WP_052440150.1\|1817112_1819200_-	hypothetical protein	A0A1X9HVK8	Ruegeria_phage	4.6e-215	59.7
WP_024097179.1\|1819256_1819646_-	hypothetical protein	NA	NA	NA	NA
WP_052331592.1\|1819670_1820417_-	site-specific DNA-methyltransferase	O03956	Myxococcus_phage	1.1e-57	52.9
WP_024097181.1\|1820447_1821221_-	hypothetical protein	A0A068CE44	Rhizobium_phage	3.6e-08	28.8
WP_024097182.1\|1821369_1821699_-	hypothetical protein	NA	NA	NA	NA
WP_024097183.1\|1821698_1821938_-	hypothetical protein	NA	NA	NA	NA
WP_024097184.1\|1821934_1822249_-	hypothetical protein	NA	NA	NA	NA
WP_024097185.1\|1822445_1822931_-	ABC-2 family transporter protein	NA	NA	NA	NA
WP_024097186.1\|1822940_1823870_-	hypothetical protein	NA	NA	NA	NA
WP_040104019.1\|1823942_1824593_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024097189.1\|1825018_1825459_+	hypothetical protein	NA	NA	NA	NA
WP_024097190.1\|1825455_1825623_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_043939781.1\|1825666_1825993_-	hypothetical protein	NA	NA	NA	NA
WP_024097192.1\|1826271_1826865_+	SAM-dependent methyltransferase	A0A218MLE3	uncultured_virus	1.3e-42	48.3
WP_024097193.1\|1826861_1827773_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024097194.1\|1827772_1828087_+	hypothetical protein	NA	NA	NA	NA
WP_024097195.1\|1828079_1828742_+	DUF2312 domain-containing protein	A0A1X9HX62	Ruegeria_phage	4.4e-55	60.5
1828412:1828426	attR	NA	NA	NA	NA
WP_024097196.1\|1828751_1829168_+	DUF1064 domain-containing protein	A0A0R6PIZ9	Moraxella_phage	2.6e-08	42.9
WP_024097197.1\|1829236_1829617_+	hypothetical protein	A0A1X9HVL1	Ruegeria_phage	1.5e-07	35.1
WP_024097198.1\|1829616_1831305_+	DEAD/DEAH box helicase	A0A1X9HX80	Ruegeria_phage	6.3e-138	47.6
WP_024097199.1\|1831294_1831873_+	transcription antiterminator	NA	NA	NA	NA
WP_081731415.1\|1832067_1832292_+	twin-arginine translocation signal domain-containing protein	NA	NA	NA	NA
WP_024097200.1\|1832294_1832486_+	hypothetical protein	NA	NA	NA	NA
WP_145957933.1\|1832482_1832809_+	hypothetical protein	NA	NA	NA	NA
WP_024097202.1\|1832984_1833392_+\|terminase	phage terminase small subunit	NA	NA	NA	NA
WP_024097203.1\|1833369_1835148_+\|terminase	phage terminase-like protein, large subunit	B0VK29	Azospirillum_phage	6.9e-119	40.5
WP_024097204.1\|1835155_1836406_+\|portal	phage portal protein	A0A141GEV9	Brucella_phage	3.4e-104	52.9
WP_024097205.1\|1836383_1837220_+\|protease	Clp protease ClpP	A0A141GEW1	Brucella_phage	8.5e-112	73.9
WP_024097206.1\|1837236_1838475_+\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	2.1e-127	55.6
WP_024097207.1\|1838535_1838676_+	hypothetical protein	NA	NA	NA	NA
WP_024097208.1\|1838682_1839252_+	hypothetical protein	A0A141GEW4	Brucella_phage	3.1e-33	43.1
WP_024097209.1\|1839251_1839578_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_024097210.1\|1839574_1840030_+	hypothetical protein	NA	NA	NA	NA
WP_024097211.1\|1840029_1840383_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_024097212.1\|1840427_1840715_+	hypothetical protein	NA	NA	NA	NA
WP_024097213.1\|1840775_1841222_+	hypothetical protein	A0A2I7RB20	Vibrio_phage	5.9e-11	32.0

DBSCAN-SWA_4

2321377 : 2330971

Vibrio_phage(25.0%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024097662.1\|2321377_2322220_-	hypothetical protein	I3PUX5	Vibrio_phage	3.7e-14	31.1
WP_024097663.1\|2322233_2324225_-	hypothetical protein	I3PUX6	Vibrio_phage	3.6e-124	39.6
WP_024097664.1\|2324221_2325559_-\|terminase	phage terminase large subunit	F8TUR5	EBPR_podovirus	6.2e-181	71.8
WP_024097665.1\|2325539_2325842_-	hypothetical protein	A0A088FAU1	Sulfitobacter_phage	1.5e-05	41.6
WP_024097666.1\|2326469_2327060_-	transcription antiterminator	NA	NA	NA	NA
WP_040104067.1\|2327328_2327715_-	hypothetical protein	NA	NA	NA	NA
WP_024097669.1\|2327726_2328080_-	HNH endonuclease	A0A0B4N249	Escherichia_phage	5.5e-20	49.0
WP_024097670.1\|2328148_2328619_-	single-stranded DNA-binding protein	A0A0U2C0X4	Paracoccus_phage	4.4e-49	81.7
WP_024097671.1\|2328618_2328987_-	ATPase involved in DNA replication initiation	NA	NA	NA	NA
WP_024097672.1\|2328983_2329352_-	hypothetical protein	NA	NA	NA	NA
WP_024097673.1\|2329338_2330136_-	hypothetical protein	NA	NA	NA	NA
WP_024097674.1\|2330132_2330666_-	T5domain protein	A0A088F856	Sulfitobacter_phage	2.6e-45	52.3
WP_024097675.1\|2330662_2330971_-	VRR-NUC domain protein	E2GLY0	Acinetobacter_phage	1.6e-20	55.7

DBSCAN-SWA_5

2334710 : 2337997

Pseudoalteromonas_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024097687.1\|2334710_2335379_+	ERF family protein	A0A0H4A6R9	Pseudoalteromonas_phage	9.1e-24	48.9
WP_096705125.1\|2335368_2336073_+	3'-5' exonuclease	X2CYL5	Brucella_phage	1.3e-41	45.3
WP_024097689.1\|2336072_2336261_+	hypothetical protein	NA	NA	NA	NA
WP_024097690.1\|2336260_2336551_+	hypothetical protein	A0A0B5HDX4	Vibrio_phage	6.5e-27	59.8
WP_024097691.1\|2336564_2337020_+	hypothetical protein	A0A2H4J106	uncultured_Caudovirales_phage	2.0e-06	29.2
WP_040104145.1\|2337088_2337394_+	DUF1364 domain-containing protein	A0A088F868	Sulfitobacter_phage	7.3e-29	60.4
WP_024097693.1\|2337415_2337997_+	hypothetical protein	K4NZ13	Pseudomonas_phage	2.7e-16	55.2

Anti-CRISPR protein detection

Acr_ID: NZ_CP010673.1|WP_024097689.1|2336072_2336261_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP010673.1|WP_024097689.1|2336072_2336261_+|hypothetical-protein

2336072_2336261_+

62 aa aa

2334710-2337997

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP010673_1	Orphan	1.1\|2337775\|19\|NZ_CP010673\|CRISPRCasFinder	2337775-2337793	19	2337907-2337925	1

1. spacer 1.1|2337775|19|NZ_CP010673|CRISPRCasFinder matches to NZ_CP010673 position: 2337907-2337925, mismatch: 1

acgggacgccgcacgggac	CRISPR spacer
acgggccgccgcacgggac	Protospacer
***** *************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP010675

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP010673

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information