CRISPRimmunity

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP008840	Lactobacillus gasseri DSM 14869 plasmid pEB01-2, complete sequence	0 crisprs	csa3	0	0	0	0
NZ_CP006803	Lactobacillus gasseri DSM 14869, complete genome	4 crisprs	cas1,cas2,csn2,cas3,cas8e,cse2gr11,cas7,cas5,cas6e,DEDDh,DinG,csa3	0	49	1	0
NZ_CP008839	Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence	2 crisprs	NA	0	2	0	0

1. NZ_CP006803

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP006803_1

• CRISPR_ID: NZ_CP006803_1
• CRISPR_location: 420689-420988
• CRISPR_type: TypeI-E
• Repeat_type: NA
• Spacer_info: 4 spacers
• Cas_protein_info: csn2,cas2,cas1,cas3,cas8e,cse2gr11,cas7,cas5,cas6e,DEDDh

Consensus repeat of NZ_CP006803_1

Consensus_repeat	Method
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATC	PILER-CR
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATC	CRT

spacers of NZ_CP006803_1

>1.1|420725|30|NZ_CP006803|PILER-CR,CRT
AAACCATCTCATCGTTGCTCATCATCCTAT
>1.2|420791|30|NZ_CP006803|PILER-CR,CRT
CCAGAACTAGCACCACCGTACCAGACTTCT
>1.3|420857|30|NZ_CP006803|PILER-CR,CRT
TGACTGTAGATGAAAATGTAGTTACTAGTG
>1.4|420923|30|NZ_CP006803|CRT
CTGGAAGACCATGAAAGCATTCCACACAAG

CRISPR arrays and Neighbor proteins around NZ_CP006803_1

CRISPR arrays

The CRISPR arrays of NZ_CP006803_1

>merge|NZ_CP006803|1|420689-420988|PILER-CR,CRT
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATCAAACCATCTCATCGTTGCTCATCATCCTATGTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATCCCAGAACTAGCACCACCGTACCAGACTTCTGTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATCTGACTGTAGATGAAAATGTAGTTACTAGTGGTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATCCTGGAAGACCATGAAAGCATTCCACACAAGGTTTTAGATGGTTGTTAGATCAATAAAGTTTAATTT

>NZ_CP006803|1|1|420689-420922|PILER-CR
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATC	AAACCATCTCATCGTTGCTCATCATCCTAT
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATC	CCAGAACTAGCACCACCGTACCAGACTTCT
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATC	TGACTGTAGATGAAAATGTAGTTACTAGTG
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATC

>NZ_CP006803|1|1|420689-420988|CRT
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATC	AAACCATCTCATCGTTGCTCATCATCCTAT
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATC	CCAGAACTAGCACCACCGTACCAGACTTCT
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATC	TGACTGTAGATGAAAATGTAGTTACTAGTG
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATC	CTGGAAGACCATGAAAGCATTCCACACAAG
GTTTTAGATGGTTGTTAGATCAATAAAGTTTAATTT

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	gnl|CDD|378191
NZ_CP006803.1|WP_095669561.1|421660_422086_+|restriction-endonuclease	unknown	unknown	gnl|CDD|214906
NZ_CP006803.1|WP_095669554.1|409894_410932_+|dTDP-glucose-4,6-dehydratase	unknown	unknown	gnl|CDD|224013
NZ_CP006803.1|WP_095669555.1|410938_411823_+|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl|CDD|130274
NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl|CDD|378050
NZ_CP006803.1|WP_095669559.1|419987_420656_+|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl|CDD|213411
NZ_CP006803.1|WP_003647168.1|411855_412464_+|dTDP-4-dehydrorhamnose-3,5-epimerase	unknown	unknown	gnl|CDD|376414
NZ_CP006803.1|WP_095669557.1|418799_419708_+|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl|CDD|187851
NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	gnl|CDD|176648
NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl|CDD|378153
NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl|CDD|274693
NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl|CDD|378189
NZ_CP006803.1|WP_095669553.1|408637_409813_+|methyltransferase-domain-containing-protein	unknown	unknown	gnl|CDD|133381
NZ_CP006803.1|WP_095669560.1|421207_421423_+|hypothetical-protein	unknown	unknown	gnl|CDD|99906
NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl|CDD|182031
NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl|CDD|187776
NZ_CP006803.1|WP_095669551.1|406403_406640_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP006803.1|WP_095669556.1|412480_413467_+|dTDP-4-dehydrorhamnose-reductase	unknown	unknown	gnl|CDD|367904
NZ_CP006803.1|WP_095669552.1|406694_407318_+|hypothetical-protein	unknown	unknown	gnl|CDD|369204
NZ_CP006803.1|WP_095669558.1|419685_419991_+|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl|CDD|226043

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	1.8e-60	198.7	0.7
NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	1.5e-105	348.4	1.5
NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	2.7e-48	159.6	0.0
NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	2.4e-106	349.4	0.6
NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	4.3e-101	334.0	2.6
NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	4.8e-72	237.6	0.1
NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	1.1e-47	156.8	0.0
NZ_CP006803.1|WP_095669558.1|419685_419991_+|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	2.6e-55	179.6	0.9
NZ_CP006803.1|WP_095669557.1|418799_419708_+|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	3.9e-89	293.2	5.4
NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	5.7e-35	115.5	0.0
NZ_CP006803.1|WP_095669559.1|419987_420656_+|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	8.6e-68	222.9	11.4

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl|CDD|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	1.03558e-20
NZ_CP006803.1|WP_095669561.1|421660_422086_+|restriction-endonuclease	gnl|CDD|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	4.61388e-18
NZ_CP006803.1|WP_095669554.1|409894_410932_+|dTDP-glucose-4,6-dehydratase	gnl|CDD|224013	COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane].	0
NZ_CP006803.1|WP_095669555.1|410938_411823_+|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl|CDD|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	7.65183e-175
NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl|CDD|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	4.75478e-69
NZ_CP006803.1|WP_095669559.1|419987_420656_+|type-II-A-CRISPR-associated-protein-Csn2	gnl|CDD|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	4.42519e-69
NZ_CP006803.1|WP_003647168.1|411855_412464_+|dTDP-4-dehydrorhamnose-3,5-epimerase	gnl|CDD|376414	pfam00908, dTDP_sugar_isom, dTDP-4-dehydrorhamnose 3,5-epimerase. This family catalyze the isomerisation of dTDP-4-dehydro-6-deoxy -D-glucose with dTDP-4-dehydro-6-deoxy-L-mannose. The EC number of this enzyme is 5.1.3.13.	1.94051e-98
NZ_CP006803.1|WP_095669557.1|418799_419708_+|type-II-CRISPR-associated-endonuclease-Cas1	gnl|CDD|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	2.35046e-104
NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl|CDD|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	2.3796e-39
NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl|CDD|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.18406e-146
NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl|CDD|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	4.58034e-132
NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl|CDD|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	8.31162e-76
NZ_CP006803.1|WP_095669553.1|408637_409813_+|methyltransferase-domain-containing-protein	gnl|CDD|133381	cd01106, HTH_TipAL-Mta, Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA. Helix-turn-helix (HTH) TipAL, Mta, and SkgA transcription regulators, and related proteins, N-terminal domain. TipAL regulates resistance to and activation by numerous cyclic thiopeptide antibiotics, such as thiostrepton. Mta is a global transcriptional regulator; the N-terminal DNA-binding domain of Mta interacts directly with the promoters of mta, bmr, blt, and ydfK, and induces transcription of these multidrug-efflux transport genes. SkgA has been shown to control stationary-phase expression of catalase-peroxidase in Caulobacter crescentus. These proteins are comprised of distinct domains that harbor an N-terminal active (DNA-binding) site and a regulatory (effector-binding) site. The conserved N-terminal domain of these transcription regulators contains winged HTH motifs that mediate DNA binding. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Unique to this family, is a TipAL-like, lineage specific Bacilli subgroup, which has five conserved cysteines in the C-terminus of the protein.	1.37201e-38
NZ_CP006803.1|WP_095669560.1|421207_421423_+|hypothetical-protein	gnl|CDD|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	1.74157e-12
NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3	gnl|CDD|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	2.88825e-83
NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl|CDD|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	4.8378e-56
NZ_CP006803.1|WP_095669556.1|412480_413467_+|dTDP-4-dehydrorhamnose-reductase	gnl|CDD|367904	pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.	1.44852e-100
NZ_CP006803.1|WP_095669552.1|406694_407318_+|hypothetical-protein	gnl|CDD|369204	pfam07093, SGT1, SGT1 protein. This family consists of several eukaryotic SGT1 proteins. Human SGT1 or hSGT1 is known to suppress GCR2 and is highly expressed in the muscle and heart. The function of this family is unknown although it has been speculated that SGT1 may be functionally analogous to the Gcr2p protein of Saccharomyces cerevisiae which is known to be a regulatory factor of glycolytic gene expression.	1.63458e-05
NZ_CP006803.1|WP_095669558.1|419685_419991_+|CRISPR-associated-endonuclease-Cas2	gnl|CDD|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.98568e-26

Protein sequences

>NZ_CP006803.1|WP_095669559.1|419987_420656_+|type-II-A-CRISPR-associated-protein-Csn2
MILSYLSHKKMVMKNSGIKVIATSSPIVYRDVVQCFQGKKDMLLSSDDDYNQLDIIKDFDFIGDPVLNQNIFDKYMPVIIKGYIEGLNEADRNEILKTYHKLEGIIQDSLLLEDLPLELEFNEDLKKFLKIENLHLDTKFLEEPYAIIESILKIHQNYNLHSIPVACNVAHYLNLTQLGMLNDLLKEMRLKLILIEFTSADFLVFPKDVDYFYIDQDLVDWY
>NZ_CP006803.1|WP_095669558.1|419685_419991_+|CRISPR-associated-endonuclease-Cas2
MRLMIMFDLPVDTASERKEYRQFRKRLINEGFLMIQYSIYERVCVSRKTAIILENRIKSFLPTSGVVQSLMVTEKQYNDMHFLVGNPVDDVRNSSDRTVIL
>NZ_CP006803.1|WP_095669557.1|418799_419708_+|type-II-CRISPR-associated-endonuclease-Cas1
MGWRSVIITQHAKLTYSMNMMIVQTRDGINQIPISDINLLLVSTSQAVITSALISKLAENQSKIIFVDDKYQPVSETIDYYPNSRSLAKLKSQFNWDEKRKELLWTKVVARKIQNQIKVLQNYNLVWDDVQNELDQMELNDSTNRETAAARKYFISMFGKDFIRRNSGVINAALDYGYAILLSAFNREIAVNGYLSYLGIHHHSQENQFNLGSDLMEPFRPFVDYWVKAHENIDEFTPDIKFGLVELLSLEIKFNGRKTLLSNAITVYVRDCLRFLSGEIDKIKIEMELTDEVPNDAINDNV
>NZ_CP006803.1|WP_095669556.1|412480_413467_+|dTDP-4-dehydrorhamnose-reductase
MKVFVTGVNGQLGHDVMNELAKRGYEGVGSDLAPEYAGVADGSSVTKAPYVSLDITDAEAVDRVISEVNPDVIVHCAAWTAVDMAEDDDKVAAVRKVNVDGTQNIANVAKKLDAPMVYLSTDYVFDGQGTTPWEPYFKGYKPLNVYGETKLGGEEAVANTLDKYFIVRIAWVFGVNGSNFIKTMLKVGSNHDEVKVVSDQIGTPTYTFDLARLLVDMIETDKYGYYHATNSEIPATESGYDENGTKTGYISWYDFTKEIYRQAGYKTKVTPVTTEEYGLSKAVRPFNSRLDKSKLEENGFKPLPTWTDAISRYLDILKDDGFFDELKK
>NZ_CP006803.1|WP_003647168.1|411855_412464_+|dTDP-4-dehydrorhamnose-3,5-epimerase
MGQIKVEKNVGGIEGLAVITPTVHGDDRGYFMETFNQRDMMDAGFSINFVQDNQSSSTKGVLRGLHFQKKYPQIKLVRAVRGSVFDVAVDLRSESKTYGKWYGVELTAENKKQFLIPQGFAHGFLVLSDVAEFCYKVNDFWHPNDEGGMAWNDPEIGIEWPHLKGDYPGSPDASGYTLDDGTKLNMAERDQEWKGLKDTFKF
>NZ_CP006803.1|WP_095669555.1|410938_411823_+|glucose-1-phosphate-thymidylyltransferase-RfbA
MKGIILAGGSGTRLYPLTLVTSKQLLPVYDKPMIYYPLSTLMLAGIKDILVISTPADTPRFKELLGDGSQFGINLSYKVQPTPDGLAQAFTLGEDFINGEPCAMVLGDNIFYGNGFTDLLKNAAEDAQKGKATVFGYYVNDPERFGVVDFDENGKAVSIEEKPEHPKSNYAVTGLYFYPAGVSEKAAQVKPSARGEVEITSLNDMYLQDDNLGVQLLGRGYAWLDTGTMQSLVDASNYVKMIEERQGVSVSAPEEIAYVHGWIDKDQLLEAAKRYGKSPYGKHLKSVAEGKVRY
>NZ_CP006803.1|WP_095669554.1|409894_410932_+|dTDP-glucose-4,6-dehydratase
MKVIVTGGAGFIGSNFIFYMLKKHPDYEIICLDSLTYAGNLSTLKDVMDNPKFKFVKLDIRDREGVYKLFEEEKPDVVVNFAAESHVDRSIENPEIFLETNIIGTSVLMDACRKYGIKRFHQVSTDEVYGDLPLDRPDLFFHEDTPLHTSSPYSSSKASADLLVGAYGRTFHLPVTISRCSNNYGPYQFPEKLIPLMIQRALNNEKLPVYGDGKNVRDWLYVEDHCKAIDLILEKGTPGEVYNIGGHNEMHNIDIVKLICDYLDKPYSLIEHVTDRKGHDRRYAIDPEKIHNELGWLPETMFKDGIKKTIQWYLDNKEWWENIISGDYQNYYDKMYGKKQVLDKD
>NZ_CP006803.1|WP_095669553.1|408637_409813_+|methyltransferase-domain-containing-protein
MSKYYTSGEFAKKAHVSIRTIRYYDPKNLLKPSTHTAGGARRYTDADFAKLQQILLLKYLGFSLSDIREMTLGSGDRQLLLDSLQIQKRLVEERLKEMQNVATAIDSTSSTLKAGQEVDWSKMLDLIHLTSMNQSLSTQYQNASNISARIRLHRDYSLNKEGWFHWLFKQLDLKPGMKILELGAGNGALWSQNLDKLPKGLTLVLSDISEGILADAKNEIGDNSEFQYAVFDAQKIPFADNTFDLVIANHMLFYCDDIPKTLKEVRRVMKKGASFACATYSKRHMHEITDLVQEFNPEIVLSSTNLYDRFGLDNGAEILSKDFTDVSCHKYQDAIELSESTPVISYILSCHGNQNAILLDHYNEFKNYVDEKVSGGFHITKDVGYFICKKT
>NZ_CP006803.1|WP_095669552.1|406694_407318_+|hypothetical-protein
MQLDTNNSTKEEIEKGLKIKVKIVAVEKYSTAFKDYYLTKKVRKIMAKEIDPVTLTVDSKLADYYIDDEDDSDETDDSDSDDSDSNSADTEDEKADAKSEDKSGTKAEDKETSKSDNSDASSENDKSQSNDGSSSKNADNTEGTTDTSSQTQDGKVYTGNSNKIIGNARTRKYHVPGQAGYNMNSENAVYFDSEEEAQAAGFVRSKR
>NZ_CP006803.1|WP_095669551.1|406403_406640_+|hypothetical-protein
MKNSNKLGCITIIVILMVILTRCSACGHSNSHKHSEGIYDVEITKVQSKDGDFILKGKTDAPDGSKILAQGTYDKEEN
>NZ_CP006803.1|WP_095669560.1|421207_421423_+|hypothetical-protein
MASNMRKAAKRTGLDYKIQARGGVKLGDNVNQINALMVGPHLKSEFDAIKTQVPDKIKVILIKPNYYSISI
>NZ_CP006803.1|WP_095669561.1|421660_422086_+|restriction-endonuclease
MSIYRNDDVLITDLMDRIDKLENQVTDLKKIYYKQSGESHSTFLYGCEVRGSDYLHLEDKVVPRLKENDPVLLIREADNKYDKNAISVATPAGLKLGYIPCEHNLIFSRLIDSGNLLFGRVKNFHWDGKNLELIIKVYLAN
>NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3
MVELTSAAKALWGKKTVHNDQELWLPLVAHLVDTKNVMQWLYEEWIGEGTKAIVRQNMTDEDAKKLVGFLGFFHDFGKATPAFQYKQSFPRHKDLDADIVENLTRAGFSLIRTDNRFFQRSPHPIAGEALLEFFGLNQSLGSIIGGHHGIPPQKDLSEIQFESYTSNIWGKDRDLKIQNEWKNVQKNIFQFGMSLCEYHDVKEMPDVNLNQAVILEGMLIMSDWLASSEYLNDSANIPLFPLISLDDDFDNLNMKDRYQKAINNWDLSDQWFPEEIMSVDKQYRLRFEFKPRPLQKEMSELISNAHDPGLIIIEAPTGIGKTELALTAAEQLAFKQGKTGLYMGLPTQATTNAMFTRVEKWLKNIAKEQQINPDIKLLQGKASFNKEYTSLQSTEHIYDNYYDDQEGNVVVNSWFSGKKSILSHFAVGTIDNLLLTALKQKHLFLRHLGFSNKVVIIDELHAYDSYMNSYLVKTIKWLGAYHVPVIALSATLPKVRRNDLLKAYLEGKYGCTKIEAYHDWKNNEGYPLISILDGNKLEQSNKFSTSNDEKRNINIIRFKGNEEEIINKALLEIENGGVAGIIVNTVKRAQDLARLVPEDTEALLLHSSFLSSDRENLEQELQKNVGKGAKRPKKMIVIGTQVLEQSLDIDFDVLFTDIAPIDLLIQRIGRLHRHNISRPPKLSTPTAYITGINSYGDYGKGNEYIYEKYLLMKTDHFLNGQLKVPEDVSHLVQDVYSTDTDSKIKDISEAKGKFNNHLLKSKQKAEIFQICDPKSPAQKNLFGWLNDIKTNVENDIYASACVRDIKETLEVVLLKKIDEEYFLLNGENIKEVTSEKIAGQAIRLPFAIIENASGHDKIDSTIRDLERGMQQLHTKWKNNIWLRGVLVLELDEQNTANLNGFLLKYSSKLGLIYEKE
>NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MQKESFNLITDPWIQVLNQTGELKEVSLLEVFKNAAKYQRLAGEMQSQDLAILRLLVAILTTVYSRINENDKIYDGLELDERLHLVKVNRAPSYEQLKDTWHGLYKKKHFSNALFQYLKANSDKFDFFGDQPFYQVTKEVYDQVVPANKKVNIKNPKGTVDVKQINRTISESNNSPAIFSPRTSRMKNELNLSQLIRWIITYQSFTGVTDKTKITSKEKFSVSSGWLYGLNPVFAQGENLFQTLMLNLVFLDQYQEEKPVWEFDSSVDYIEFIKNQTESSKLSISFLYTVWSRILHLEWVDNKPIIFTAGLPKLDSTNLFQEPMTTWKHNDKEDDFYPATKHLNDLNKAMWRNFGQYVLTVSESNSQKAVETHEPELIKWLREIKRNEFLATDMSLTLKTVTLVSDGNATSQSPVAEINDNFKIRANVLFDESGKNYWPAIIEDMINMTQQAGKDFWIFANNISKLRGIDGSEFANNLTAEFYDTLNVPFLTWLASLRNDQERRDKVYEWETELKRIALGRAEEVLQNASPRDIIGRENSDQDEVNGLKNIFTIFNRYKLNVLIHING
>NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MKIDVKKDTARIIKKLHERDGNDKAILAAIRRSNSILSRQATIVWPMLFGFIKDKEFFSKTGMPNRQEKAVFTALRCYAVFEQGNDNERDREYINESSSSLFENLSFLRKDERLREALDRRVQAVLSSTNFESVSRSVVGLTKLVKANNAQASLNYPDLANDLYNFQFGYESSRKVAIKWGREYFSFNDQVNKESNED
>NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTQENLYVDIHVLQTVPSSNINRDDTGAPKTAIYGGATRSRVSSQSWKKAVRDKFKEDRKRHDWLAGFRTKRSATLLAKELMKKDPSLSFDDAREKAKKVLSDMGLKFDKAKKNDKNKDKDYETKVLLFFSPGQLEKLAAYVLENDNFDKKEVKKILNDTQSLDLALFGRMVADDPELNVEAASQVAHAVSTHEVVSEFDFFTAVDDAKKSDESGSAMLSTLEYNSSTLYRYANVNMNELIHNLGKDLALIGLKEFIKDFVLSMPTGHQNSYANGTLPQYVLVTIRKDTPVNLVSAFEVPVQSNNGYVEKSVERLEEEFDNANIWVGEPVESFVNANSEIKTKDGERVKNINELLDSVSTVIAKRVEDEDANA
>NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKTLTLKLKAPLQAYGNEATFGRRTSNPYPTKSAVIGMIAAALGYDRRNSKIIDLNKLSFATRVDQPGKIMSDFQIVEYAKNANKKDKKLTYRDYLQDAIFMVAIGSENSDLINEIHYALRHPKFPLFLGRRSCPPAGPLEIEVFDNQNPLMVLQTMGWQAAEWYQKKHSNFKAEIVYDASLGSNDNFKFQLRDEVGSFDQRNRYHNYREVVSTYIPMKNETKWHAETMHDIMANI
>NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLSRVEIDLKNRRKTYDLSHLGAYHNWVESCFPRYQDENNRPRNLWRIDVLNGRSYLLLLSTQKPNLEELSKYGVSGTAVTKEYDDFLNKLYLGEILRFRLTANPSRKISVPGQRQGRIMPHITIAQQKKWFLDRTDVNGFKVLEDQENYPQFDIVNREWKLLRHKGSGTARLSCVTFEGVLKITDLEKFKKAMIKGIGREKAYGMGLLTVIPM
>NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MQKKFGAKKPEIGELSKISDRVTFLYLEHAKLNRVDSAISVVDSQGTVYIPAAIISVLFLGPGVDVTHRAMELMGEAGMSVVWVGEEGVRQYAHGRALNHSSTLLQAQAKLVSNNRSRLKVARKMYQMRFPGIDVSNLTMQQLRGKEGARVRKVYQEQSQKTGVSWSRREYKVDDFEASTPINQALTAAHQALYGLSYSVIVALGASAGLGFVHTGHDLSFVYDFSDLYKAEYSIPIAFEVVKEYGKEDISTHTRYAMRDAFKDGRLIERMVKDLKYLLDVEDQTEVKAVMNLWDDKKGLQKFGVQYHELGE
>NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MIVITLSKTPNSLRGDLTKWCQEIQTGVYVGNLNAKVRELLWERIEKNIGGGEATMVYNTNNELGYTFRTNRKDKRVVDFDGIPFLMHINKPSDVVLGFSNAAKFHKVHRVSSSAKKIENQNELQNFVAIDLETTGLNSEKDRIISIAAVKYIKKNDPEVFYRLIKDIPEVPEHISKLTGLTTKKLRDSGVSLRDALIEFKKFVGSRLIVGYNLPFDMSFLENSIKKESLNSLENRAKDILPIVKRKNKFLEDYHLDTVLKKYDIENENPHHADSDAKSTWYLTKKLIEIKSLII

Crispr_ID: NZ_CP006803_2

• CRISPR_ID: NZ_CP006803_2
• CRISPR_location: 422204-422660
• CRISPR_type: TypeI-E
• Repeat_type: I-B,III-A,III-B
• Spacer_info: 7 spacers
• Cas_protein_info: csn2,cas2,cas1,cas3,cas8e,cse2gr11,cas7,cas5,cas6e,DEDDh

Consensus repeat of NZ_CP006803_2

Consensus_repeat	Method
AGGATCATCTCCACATACGTGGAGAATACT	PILER-CR
AGGATCATCTCCACATACGTGGAGAATAC	CRISPRCasFinder
AGGATCATCTCCACATACGTGGAGAATACT	CRT

spacers of NZ_CP006803_2

>2.1|422234|31|NZ_CP006803|PILER-CR,CRT
TTGAAATGGCTCCCTCAACTTCTGCTGCTAC
>2.2|422295|31|NZ_CP006803|PILER-CR,CRT
TAAGCATTTCGCCTTCATAGGTTGCAATAGC
>2.3|422356|31|NZ_CP006803|PILER-CR,CRT
AGTGTTGTACCTGAATTAATGGCATATTCTA
>2.4|422417|31|NZ_CP006803|PILER-CR,CRT
CGATATCTAGTCGAAAGAAATATGGGTTACC
>2.5|422478|31|NZ_CP006803|PILER-CR,CRT
CAAGCATCTGCTGAAGCTCCATTTTAGGACT
>2.6|422233|32|NZ_CP006803|CRISPRCasFinder
TTTGAAATGGCTCCCTCAACTTCTGCTGCTAC
>2.7|422294|32|NZ_CP006803|CRISPRCasFinder
TTAAGCATTTCGCCTTCATAGGTTGCAATAGC
>2.8|422355|32|NZ_CP006803|CRISPRCasFinder
TAGTGTTGTACCTGAATTAATGGCATATTCTA
>2.9|422416|32|NZ_CP006803|CRISPRCasFinder
GCGATATCTAGTCGAAAGAAATATGGGTTACC
>2.10|422477|32|NZ_CP006803|CRISPRCasFinder
TCAAGCATCTGCTGAAGCTCCATTTTAGGACT
>2.11|422538|32|NZ_CP006803|CRISPRCasFinder
TCATTGTGAACGCCATTTGCTGTGTAGGACCA
>2.12|422599|32|NZ_CP006803|CRISPRCasFinder
TAAGCCCCTGCTGTAAAATCAATGACTAACTT
>2.13|422539|31|NZ_CP006803|CRT
CATTGTGAACGCCATTTGCTGTGTAGGACCA
>2.14|422600|31|NZ_CP006803|CRT
AAGCCCCTGCTGTAAAATCAATGACTAACTT

CRISPR arrays and Neighbor proteins around NZ_CP006803_2

CRISPR arrays

The CRISPR arrays of NZ_CP006803_2

>merge|NZ_CP006803|2|422204-422660|PILER-CR,CRISPRCasFinder,CRT
AGGATCATCTCCACATACGTGGAGAATACTTTGAAATGGCTCCCTCAACTTCTGCTGCTACAGGATCATCTCCACATACATGGAGAATACTTAAGCATTTCGCCTTCATAGGTTGCAATAGCGGGATCATCTCCACATACGTGGAGAATACTAGTGTTGTACCTGAATTAATGGCATATTCTAAGGATCATCTCCACATACGTGGAGAATACGCGATATCTAGTCGAAAGAAATATGGGTTACCAGGATTATCTCCACATACGTGGAGAATACTCAAGCATCTGCTGAAGCTCCATTTTAGGACTAGGATCACCTCCACATACGTGGAGAATACTCATTGTGAACGCCATTTGCTGTGTAGGACCAGGGATCATCTCCACACACGTAGAGAACACTAAGCCCCTGCTGTAAAATCAATGACTAACTTAGGATCATCTCCACTTACGTGAAGAACACA

>NZ_CP006803|2|2|422204-422538|PILER-CR
AGGATCATCTCCACATACGTGGAGAATACT	TTGAAATGGCTCCCTCAACTTCTGCTGCTAC
AGGATCATCTCCACATACATGGAGAATACT	TAAGCATTTCGCCTTCATAGGTTGCAATAGC
GGGATCATCTCCACATACGTGGAGAATACT	AGTGTTGTACCTGAATTAATGGCATATTCTA
AGGATCATCTCCACATACGTGGAGAATACG	CGATATCTAGTCGAAAGAAATATGGGTTACC
AGGATTATCTCCACATACGTGGAGAATACT	CAAGCATCTGCTGAAGCTCCATTTTAGGACT
AGGATCACCTCCACATACGTGGAGAATACT

>NZ_CP006803|2|1|422204-422659|CRISPRCasFinder
AGGATCATCTCCACATACGTGGAGAATAC	TTTGAAATGGCTCCCTCAACTTCTGCTGCTAC
AGGATCATCTCCACATACATGGAGAATAC	TTAAGCATTTCGCCTTCATAGGTTGCAATAGC
GGGATCATCTCCACATACGTGGAGAATAC	TAGTGTTGTACCTGAATTAATGGCATATTCTA
AGGATCATCTCCACATACGTGGAGAATAC	GCGATATCTAGTCGAAAGAAATATGGGTTACC
AGGATTATCTCCACATACGTGGAGAATAC	TCAAGCATCTGCTGAAGCTCCATTTTAGGACT
AGGATCACCTCCACATACGTGGAGAATAC	TCATTGTGAACGCCATTTGCTGTGTAGGACCA
GGGATCATCTCCACACACGTAGAGAACAC	TAAGCCCCTGCTGTAAAATCAATGACTAACTT
AGGATCATCTCCACTTACGTGAAGAACAC

>NZ_CP006803|2|2|422204-422660|CRT
AGGATCATCTCCACATACGTGGAGAATACT	TTGAAATGGCTCCCTCAACTTCTGCTGCTAC
AGGATCATCTCCACATACATGGAGAATACT	TAAGCATTTCGCCTTCATAGGTTGCAATAGC
GGGATCATCTCCACATACGTGGAGAATACT	AGTGTTGTACCTGAATTAATGGCATATTCTA
AGGATCATCTCCACATACGTGGAGAATACG	CGATATCTAGTCGAAAGAAATATGGGTTACC
AGGATTATCTCCACATACGTGGAGAATACT	CAAGCATCTGCTGAAGCTCCATTTTAGGACT
AGGATCACCTCCACATACGTGGAGAATACT	CATTGTGAACGCCATTTGCTGTGTAGGACCA
GGGATCATCTCCACACACGTAGAGAACACT	AAGCCCCTGCTGTAAAATCAATGACTAACTT
AGGATCATCTCCACTTACGTGAAGAACACA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	gnl|CDD|378191
NZ_CP006803.1|WP_095669561.1|421660_422086_+|restriction-endonuclease	unknown	unknown	gnl|CDD|214906
NZ_CP006803.1|WP_095669555.1|410938_411823_+|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl|CDD|130274
NZ_CP006803.1|WP_095669554.1|409894_410932_+|dTDP-glucose-4,6-dehydratase	unknown	unknown	gnl|CDD|224013
NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl|CDD|378153
NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl|CDD|378050
NZ_CP006803.1|WP_095669570.1|436060_436261_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP006803.1|WP_003647168.1|411855_412464_+|dTDP-4-dehydrorhamnose-3,5-epimerase	unknown	unknown	gnl|CDD|376414
NZ_CP006803.1|WP_095669557.1|418799_419708_+|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl|CDD|187851
NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	gnl|CDD|176648
NZ_CP006803.1|WP_095669571.1|436327_437512_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl|CDD|235985
NZ_CP006803.1|WP_095669558.1|419685_419991_+|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl|CDD|226043
NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl|CDD|274693
NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl|CDD|378189
NZ_CP006803.1|WP_095669553.1|408637_409813_+|methyltransferase-domain-containing-protein	unknown	unknown	gnl|CDD|133381
NZ_CP006803.1|WP_095669560.1|421207_421423_+|hypothetical-protein	unknown	unknown	gnl|CDD|99906
NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl|CDD|182031
NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl|CDD|187776
NZ_CP006803.1|WP_095669556.1|412480_413467_+|dTDP-4-dehydrorhamnose-reductase	unknown	unknown	gnl|CDD|367904
NZ_CP006803.1|WP_095669559.1|419987_420656_+|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl|CDD|213411

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	1.8e-60	198.7	0.7
NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	1.5e-105	348.4	1.5
NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	2.7e-48	159.6	0.0
NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	2.4e-106	349.4	0.6
NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	4.3e-101	334.0	2.6
NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	4.8e-72	237.6	0.1
NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	1.1e-47	156.8	0.0
NZ_CP006803.1|WP_095669558.1|419685_419991_+|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	2.6e-55	179.6	0.9
NZ_CP006803.1|WP_095669557.1|418799_419708_+|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	3.9e-89	293.2	5.4
NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	5.7e-35	115.5	0.0
NZ_CP006803.1|WP_095669559.1|419987_420656_+|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	8.6e-68	222.9	11.4

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl|CDD|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	1.03558e-20
NZ_CP006803.1|WP_095669561.1|421660_422086_+|restriction-endonuclease	gnl|CDD|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	4.61388e-18
NZ_CP006803.1|WP_095669555.1|410938_411823_+|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl|CDD|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	7.65183e-175
NZ_CP006803.1|WP_095669554.1|409894_410932_+|dTDP-glucose-4,6-dehydratase	gnl|CDD|224013	COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane].	0
NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl|CDD|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.18406e-146
NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl|CDD|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	4.75478e-69
NZ_CP006803.1|WP_003647168.1|411855_412464_+|dTDP-4-dehydrorhamnose-3,5-epimerase	gnl|CDD|376414	pfam00908, dTDP_sugar_isom, dTDP-4-dehydrorhamnose 3,5-epimerase. This family catalyze the isomerisation of dTDP-4-dehydro-6-deoxy -D-glucose with dTDP-4-dehydro-6-deoxy-L-mannose. The EC number of this enzyme is 5.1.3.13.	1.94051e-98
NZ_CP006803.1|WP_095669557.1|418799_419708_+|type-II-CRISPR-associated-endonuclease-Cas1	gnl|CDD|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	2.35046e-104
NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl|CDD|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	2.3796e-39
NZ_CP006803.1|WP_095669571.1|436327_437512_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl|CDD|235985	PRK07309, PRK07309, pyridoxal phosphate-dependent aminotransferase.	2.49821e-154
NZ_CP006803.1|WP_095669558.1|419685_419991_+|CRISPR-associated-endonuclease-Cas2	gnl|CDD|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.98568e-26
NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl|CDD|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	4.58034e-132
NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl|CDD|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	8.31162e-76
NZ_CP006803.1|WP_095669553.1|408637_409813_+|methyltransferase-domain-containing-protein	gnl|CDD|133381	cd01106, HTH_TipAL-Mta, Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA. Helix-turn-helix (HTH) TipAL, Mta, and SkgA transcription regulators, and related proteins, N-terminal domain. TipAL regulates resistance to and activation by numerous cyclic thiopeptide antibiotics, such as thiostrepton. Mta is a global transcriptional regulator; the N-terminal DNA-binding domain of Mta interacts directly with the promoters of mta, bmr, blt, and ydfK, and induces transcription of these multidrug-efflux transport genes. SkgA has been shown to control stationary-phase expression of catalase-peroxidase in Caulobacter crescentus. These proteins are comprised of distinct domains that harbor an N-terminal active (DNA-binding) site and a regulatory (effector-binding) site. The conserved N-terminal domain of these transcription regulators contains winged HTH motifs that mediate DNA binding. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Unique to this family, is a TipAL-like, lineage specific Bacilli subgroup, which has five conserved cysteines in the C-terminus of the protein.	1.37201e-38
NZ_CP006803.1|WP_095669560.1|421207_421423_+|hypothetical-protein	gnl|CDD|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	1.74157e-12
NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3	gnl|CDD|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	2.88825e-83
NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl|CDD|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	4.8378e-56
NZ_CP006803.1|WP_095669556.1|412480_413467_+|dTDP-4-dehydrorhamnose-reductase	gnl|CDD|367904	pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.	1.44852e-100
NZ_CP006803.1|WP_095669559.1|419987_420656_+|type-II-A-CRISPR-associated-protein-Csn2	gnl|CDD|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	4.42519e-69

Protein sequences

>NZ_CP006803.1|WP_095669561.1|421660_422086_+|restriction-endonuclease
MSIYRNDDVLITDLMDRIDKLENQVTDLKKIYYKQSGESHSTFLYGCEVRGSDYLHLEDKVVPRLKENDPVLLIREADNKYDKNAISVATPAGLKLGYIPCEHNLIFSRLIDSGNLLFGRVKNFHWDGKNLELIIKVYLAN
>NZ_CP006803.1|WP_095669560.1|421207_421423_+|hypothetical-protein
MASNMRKAAKRTGLDYKIQARGGVKLGDNVNQINALMVGPHLKSEFDAIKTQVPDKIKVILIKPNYYSISI
>NZ_CP006803.1|WP_095669559.1|419987_420656_+|type-II-A-CRISPR-associated-protein-Csn2
MILSYLSHKKMVMKNSGIKVIATSSPIVYRDVVQCFQGKKDMLLSSDDDYNQLDIIKDFDFIGDPVLNQNIFDKYMPVIIKGYIEGLNEADRNEILKTYHKLEGIIQDSLLLEDLPLELEFNEDLKKFLKIENLHLDTKFLEEPYAIIESILKIHQNYNLHSIPVACNVAHYLNLTQLGMLNDLLKEMRLKLILIEFTSADFLVFPKDVDYFYIDQDLVDWY
>NZ_CP006803.1|WP_095669558.1|419685_419991_+|CRISPR-associated-endonuclease-Cas2
MRLMIMFDLPVDTASERKEYRQFRKRLINEGFLMIQYSIYERVCVSRKTAIILENRIKSFLPTSGVVQSLMVTEKQYNDMHFLVGNPVDDVRNSSDRTVIL
>NZ_CP006803.1|WP_095669557.1|418799_419708_+|type-II-CRISPR-associated-endonuclease-Cas1
MGWRSVIITQHAKLTYSMNMMIVQTRDGINQIPISDINLLLVSTSQAVITSALISKLAENQSKIIFVDDKYQPVSETIDYYPNSRSLAKLKSQFNWDEKRKELLWTKVVARKIQNQIKVLQNYNLVWDDVQNELDQMELNDSTNRETAAARKYFISMFGKDFIRRNSGVINAALDYGYAILLSAFNREIAVNGYLSYLGIHHHSQENQFNLGSDLMEPFRPFVDYWVKAHENIDEFTPDIKFGLVELLSLEIKFNGRKTLLSNAITVYVRDCLRFLSGEIDKIKIEMELTDEVPNDAINDNV
>NZ_CP006803.1|WP_095669556.1|412480_413467_+|dTDP-4-dehydrorhamnose-reductase
MKVFVTGVNGQLGHDVMNELAKRGYEGVGSDLAPEYAGVADGSSVTKAPYVSLDITDAEAVDRVISEVNPDVIVHCAAWTAVDMAEDDDKVAAVRKVNVDGTQNIANVAKKLDAPMVYLSTDYVFDGQGTTPWEPYFKGYKPLNVYGETKLGGEEAVANTLDKYFIVRIAWVFGVNGSNFIKTMLKVGSNHDEVKVVSDQIGTPTYTFDLARLLVDMIETDKYGYYHATNSEIPATESGYDENGTKTGYISWYDFTKEIYRQAGYKTKVTPVTTEEYGLSKAVRPFNSRLDKSKLEENGFKPLPTWTDAISRYLDILKDDGFFDELKK
>NZ_CP006803.1|WP_003647168.1|411855_412464_+|dTDP-4-dehydrorhamnose-3,5-epimerase
MGQIKVEKNVGGIEGLAVITPTVHGDDRGYFMETFNQRDMMDAGFSINFVQDNQSSSTKGVLRGLHFQKKYPQIKLVRAVRGSVFDVAVDLRSESKTYGKWYGVELTAENKKQFLIPQGFAHGFLVLSDVAEFCYKVNDFWHPNDEGGMAWNDPEIGIEWPHLKGDYPGSPDASGYTLDDGTKLNMAERDQEWKGLKDTFKF
>NZ_CP006803.1|WP_095669555.1|410938_411823_+|glucose-1-phosphate-thymidylyltransferase-RfbA
MKGIILAGGSGTRLYPLTLVTSKQLLPVYDKPMIYYPLSTLMLAGIKDILVISTPADTPRFKELLGDGSQFGINLSYKVQPTPDGLAQAFTLGEDFINGEPCAMVLGDNIFYGNGFTDLLKNAAEDAQKGKATVFGYYVNDPERFGVVDFDENGKAVSIEEKPEHPKSNYAVTGLYFYPAGVSEKAAQVKPSARGEVEITSLNDMYLQDDNLGVQLLGRGYAWLDTGTMQSLVDASNYVKMIEERQGVSVSAPEEIAYVHGWIDKDQLLEAAKRYGKSPYGKHLKSVAEGKVRY
>NZ_CP006803.1|WP_095669554.1|409894_410932_+|dTDP-glucose-4,6-dehydratase
MKVIVTGGAGFIGSNFIFYMLKKHPDYEIICLDSLTYAGNLSTLKDVMDNPKFKFVKLDIRDREGVYKLFEEEKPDVVVNFAAESHVDRSIENPEIFLETNIIGTSVLMDACRKYGIKRFHQVSTDEVYGDLPLDRPDLFFHEDTPLHTSSPYSSSKASADLLVGAYGRTFHLPVTISRCSNNYGPYQFPEKLIPLMIQRALNNEKLPVYGDGKNVRDWLYVEDHCKAIDLILEKGTPGEVYNIGGHNEMHNIDIVKLICDYLDKPYSLIEHVTDRKGHDRRYAIDPEKIHNELGWLPETMFKDGIKKTIQWYLDNKEWWENIISGDYQNYYDKMYGKKQVLDKD
>NZ_CP006803.1|WP_095669553.1|408637_409813_+|methyltransferase-domain-containing-protein
MSKYYTSGEFAKKAHVSIRTIRYYDPKNLLKPSTHTAGGARRYTDADFAKLQQILLLKYLGFSLSDIREMTLGSGDRQLLLDSLQIQKRLVEERLKEMQNVATAIDSTSSTLKAGQEVDWSKMLDLIHLTSMNQSLSTQYQNASNISARIRLHRDYSLNKEGWFHWLFKQLDLKPGMKILELGAGNGALWSQNLDKLPKGLTLVLSDISEGILADAKNEIGDNSEFQYAVFDAQKIPFADNTFDLVIANHMLFYCDDIPKTLKEVRRVMKKGASFACATYSKRHMHEITDLVQEFNPEIVLSSTNLYDRFGLDNGAEILSKDFTDVSCHKYQDAIELSESTPVISYILSCHGNQNAILLDHYNEFKNYVDEKVSGGFHITKDVGYFICKKT
>NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3
MVELTSAAKALWGKKTVHNDQELWLPLVAHLVDTKNVMQWLYEEWIGEGTKAIVRQNMTDEDAKKLVGFLGFFHDFGKATPAFQYKQSFPRHKDLDADIVENLTRAGFSLIRTDNRFFQRSPHPIAGEALLEFFGLNQSLGSIIGGHHGIPPQKDLSEIQFESYTSNIWGKDRDLKIQNEWKNVQKNIFQFGMSLCEYHDVKEMPDVNLNQAVILEGMLIMSDWLASSEYLNDSANIPLFPLISLDDDFDNLNMKDRYQKAINNWDLSDQWFPEEIMSVDKQYRLRFEFKPRPLQKEMSELISNAHDPGLIIIEAPTGIGKTELALTAAEQLAFKQGKTGLYMGLPTQATTNAMFTRVEKWLKNIAKEQQINPDIKLLQGKASFNKEYTSLQSTEHIYDNYYDDQEGNVVVNSWFSGKKSILSHFAVGTIDNLLLTALKQKHLFLRHLGFSNKVVIIDELHAYDSYMNSYLVKTIKWLGAYHVPVIALSATLPKVRRNDLLKAYLEGKYGCTKIEAYHDWKNNEGYPLISILDGNKLEQSNKFSTSNDEKRNINIIRFKGNEEEIINKALLEIENGGVAGIIVNTVKRAQDLARLVPEDTEALLLHSSFLSSDRENLEQELQKNVGKGAKRPKKMIVIGTQVLEQSLDIDFDVLFTDIAPIDLLIQRIGRLHRHNISRPPKLSTPTAYITGINSYGDYGKGNEYIYEKYLLMKTDHFLNGQLKVPEDVSHLVQDVYSTDTDSKIKDISEAKGKFNNHLLKSKQKAEIFQICDPKSPAQKNLFGWLNDIKTNVENDIYASACVRDIKETLEVVLLKKIDEEYFLLNGENIKEVTSEKIAGQAIRLPFAIIENASGHDKIDSTIRDLERGMQQLHTKWKNNIWLRGVLVLELDEQNTANLNGFLLKYSSKLGLIYEKE
>NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MQKESFNLITDPWIQVLNQTGELKEVSLLEVFKNAAKYQRLAGEMQSQDLAILRLLVAILTTVYSRINENDKIYDGLELDERLHLVKVNRAPSYEQLKDTWHGLYKKKHFSNALFQYLKANSDKFDFFGDQPFYQVTKEVYDQVVPANKKVNIKNPKGTVDVKQINRTISESNNSPAIFSPRTSRMKNELNLSQLIRWIITYQSFTGVTDKTKITSKEKFSVSSGWLYGLNPVFAQGENLFQTLMLNLVFLDQYQEEKPVWEFDSSVDYIEFIKNQTESSKLSISFLYTVWSRILHLEWVDNKPIIFTAGLPKLDSTNLFQEPMTTWKHNDKEDDFYPATKHLNDLNKAMWRNFGQYVLTVSESNSQKAVETHEPELIKWLREIKRNEFLATDMSLTLKTVTLVSDGNATSQSPVAEINDNFKIRANVLFDESGKNYWPAIIEDMINMTQQAGKDFWIFANNISKLRGIDGSEFANNLTAEFYDTLNVPFLTWLASLRNDQERRDKVYEWETELKRIALGRAEEVLQNASPRDIIGRENSDQDEVNGLKNIFTIFNRYKLNVLIHING
>NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MKIDVKKDTARIIKKLHERDGNDKAILAAIRRSNSILSRQATIVWPMLFGFIKDKEFFSKTGMPNRQEKAVFTALRCYAVFEQGNDNERDREYINESSSSLFENLSFLRKDERLREALDRRVQAVLSSTNFESVSRSVVGLTKLVKANNAQASLNYPDLANDLYNFQFGYESSRKVAIKWGREYFSFNDQVNKESNED
>NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTQENLYVDIHVLQTVPSSNINRDDTGAPKTAIYGGATRSRVSSQSWKKAVRDKFKEDRKRHDWLAGFRTKRSATLLAKELMKKDPSLSFDDAREKAKKVLSDMGLKFDKAKKNDKNKDKDYETKVLLFFSPGQLEKLAAYVLENDNFDKKEVKKILNDTQSLDLALFGRMVADDPELNVEAASQVAHAVSTHEVVSEFDFFTAVDDAKKSDESGSAMLSTLEYNSSTLYRYANVNMNELIHNLGKDLALIGLKEFIKDFVLSMPTGHQNSYANGTLPQYVLVTIRKDTPVNLVSAFEVPVQSNNGYVEKSVERLEEEFDNANIWVGEPVESFVNANSEIKTKDGERVKNINELLDSVSTVIAKRVEDEDANA
>NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKTLTLKLKAPLQAYGNEATFGRRTSNPYPTKSAVIGMIAAALGYDRRNSKIIDLNKLSFATRVDQPGKIMSDFQIVEYAKNANKKDKKLTYRDYLQDAIFMVAIGSENSDLINEIHYALRHPKFPLFLGRRSCPPAGPLEIEVFDNQNPLMVLQTMGWQAAEWYQKKHSNFKAEIVYDASLGSNDNFKFQLRDEVGSFDQRNRYHNYREVVSTYIPMKNETKWHAETMHDIMANI
>NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLSRVEIDLKNRRKTYDLSHLGAYHNWVESCFPRYQDENNRPRNLWRIDVLNGRSYLLLLSTQKPNLEELSKYGVSGTAVTKEYDDFLNKLYLGEILRFRLTANPSRKISVPGQRQGRIMPHITIAQQKKWFLDRTDVNGFKVLEDQENYPQFDIVNREWKLLRHKGSGTARLSCVTFEGVLKITDLEKFKKAMIKGIGREKAYGMGLLTVIPM
>NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MQKKFGAKKPEIGELSKISDRVTFLYLEHAKLNRVDSAISVVDSQGTVYIPAAIISVLFLGPGVDVTHRAMELMGEAGMSVVWVGEEGVRQYAHGRALNHSSTLLQAQAKLVSNNRSRLKVARKMYQMRFPGIDVSNLTMQQLRGKEGARVRKVYQEQSQKTGVSWSRREYKVDDFEASTPINQALTAAHQALYGLSYSVIVALGASAGLGFVHTGHDLSFVYDFSDLYKAEYSIPIAFEVVKEYGKEDISTHTRYAMRDAFKDGRLIERMVKDLKYLLDVEDQTEVKAVMNLWDDKKGLQKFGVQYHELGE
>NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MIVITLSKTPNSLRGDLTKWCQEIQTGVYVGNLNAKVRELLWERIEKNIGGGEATMVYNTNNELGYTFRTNRKDKRVVDFDGIPFLMHINKPSDVVLGFSNAAKFHKVHRVSSSAKKIENQNELQNFVAIDLETTGLNSEKDRIISIAAVKYIKKNDPEVFYRLIKDIPEVPEHISKLTGLTTKKLRDSGVSLRDALIEFKKFVGSRLIVGYNLPFDMSFLENSIKKESLNSLENRAKDILPIVKRKNKFLEDYHLDTVLKKYDIENENPHHADSDAKSTWYLTKKLIEIKSLII
>NZ_CP006803.1|WP_095669570.1|436060_436261_+|hypothetical-protein
MKVRYAGESFYSGLGLANGKVYVVLDKKGPFYRIIDDSGEDYLYSKTNPAPLDGNSKGGYWNIVEY
>NZ_CP006803.1|WP_095669571.1|436327_437512_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MPKLANDLSLTKNTRLNSLGPSKIRAFDAKASQIPGIIKLTIGEPDLNTPDHVKDAAIADIKANDSHYAPQAGKPELQDAISKYLNRSLNVKYDPTTEICVTVGATGALNDVFMSILNPGDKILVPTPVWALYFQLIKLTGAIPVQMDTSKDGFILTPEHLEKVLQNEGKGAKAIILTDPSNPTGRVYPEETLKALAEIITKYHLFSVTDEIYGELVYDNNVHHSLSQYIPERNILISGLSKAYAMTGWRLGYIAAPADIMKTIQKVNAFLVTSVTDNVQAAAIEALNNGQADPLESRKIYEDRLKFMKAGLEKLGFEMSAPQGAFYIFAKIPDAFGTDDEAFANELATKAKVGVTPGRYFGQGGQGYVRMSYASSTEQLKEALKRIAEFVKNI

Crispr_ID: NZ_CP006803_3

• CRISPR_ID: NZ_CP006803_3
• CRISPR_location: 423833-424654
• CRISPR_type: TypeI-E
• Repeat_type: NA
• Spacer_info: 13 spacers
• Cas_protein_info: csn2,cas2,cas1,cas3,cas8e,cse2gr11,cas7,cas5,cas6e,DEDDh

Consensus repeat of NZ_CP006803_3

Consensus_repeat	Method
GGATCATCTCCACACTCGTAGAGAACAC	PILER-CR
GTGTTCTCTACGAGTGTGGAGATGATCC	CRT

spacers of NZ_CP006803_3

>3.1|423861|33|NZ_CP006803|PILER-CR,CRT
TCTGCCTTTGCAGATCTGCTTTTCCAGCGTCGA
>3.2|423922|33|NZ_CP006803|PILER-CR,CRT
CACGACCATAGATAACATCGGAATACTCAGAGT
>3.3|423983|33|NZ_CP006803|PILER-CR,CRT
TTTCTTTTTCTTCTACTGGACTACCAACATTTT
>3.4|424044|33|NZ_CP006803|PILER-CR,CRT
CTTTTTTAGCTGCTTGATAATCTTTATCGCATT
>3.5|424105|33|NZ_CP006803|PILER-CR,CRT
TGGACGGAGTAGCGATCTGGCAATTTACTGACA
>3.6|424166|33|NZ_CP006803|PILER-CR,CRT
TTGCTTCCGCCGTCTTTATATTGATCTGGAAAG
>3.7|424227|34|NZ_CP006803|PILER-CR,CRT
CGTTTTTATGCTCATGTGGAACTTTGGTAATGTA
>3.8|424289|33|NZ_CP006803|PILER-CR,CRT
TAAGATTTAGCATTCGTGTTGTAATCAGCATCG
>3.9|424350|33|NZ_CP006803|PILER-CR,CRT
CCTTCCCTGTTACCGCAAAACTTAGTTCTACTG
>3.10|424411|33|NZ_CP006803|PILER-CR,CRT
TTAGGTTGGTCACCGCTAGGTGTTCCGCTTGCT
>3.11|424472|33|NZ_CP006803|PILER-CR,CRT
TCTGGACCAGCAGCACCCCATACATACGGTTTA
>3.12|424533|33|NZ_CP006803|PILER-CR,CRT
CTTGACGATATTATTACAGCACTTCAAGTTGAA
>3.13|424594|33|NZ_CP006803|CRT
TTGCCAAATTGCTACTCCGTCCATTGACGGGAA

CRISPR arrays and Neighbor proteins around NZ_CP006803_3

CRISPR arrays

The CRISPR arrays of NZ_CP006803_3

>merge|NZ_CP006803|3|423833-424654|PILER-CR,CRT
GTGTTCTCTACGAGTGTGGAGATGATCCTCTGCCTTTGCAGATCTGCTTTTCCAGCGTCGAGTGTTCTCTACGAGTGTGGAGATGATCCCACGACCATAGATAACATCGGAATACTCAGAGTGTGTTCTCTACGAGTGTGGAGATGATCCTTTCTTTTTCTTCTACTGGACTACCAACATTTTGTGTTCTCTACGAGTGTGGAGATGATCCCTTTTTTAGCTGCTTGATAATCTTTATCGCATTGTGTTCTCTACGAGTGTGGAGATGATCCTGGACGGAGTAGCGATCTGGCAATTTACTGACAGTGTTCTCTACGAGTGTGGAGATGATCCTTGCTTCCGCCGTCTTTATATTGATCTGGAAAGGTGTTCTCTACGAGTGTGGAGATGATCCCGTTTTTATGCTCATGTGGAACTTTGGTAATGTAGTGTTCTCTACGAGTGTGGAGATGATCCTAAGATTTAGCATTCGTGTTGTAATCAGCATCGGTGTTCTCTACGAGTGTGGAGATGATCCCCTTCCCTGTTACCGCAAAACTTAGTTCTACTGGTGTTCTCTACGAGTGTGGAGATGATCCTTAGGTTGGTCACCGCTAGGTGTTCCGCTTGCTGTGTTCTCTACGAGTGTGGAGATGATCCTCTGGACCAGCAGCACCCCATACATACGGTTTAGTGTTCTCTACGAGTGTGGAGATGATCCCTTGACGATATTATTACAGCACTTCAAGTTGAAGTGTTCTCTACGAGAGTGGAGATGATCCTTGCCAAATTGCTACTCCGTCCATTGACGGGAAGTGTTCTCTACGAGAGTGGAGGTCGATA

>NZ_CP006803|3|3|423833-424593|PILER-CR
GTGTTCTCTACGAGTGTGGAGATGATCC	TCTGCCTTTGCAGATCTGCTTTTCCAGCGTCGA
GTGTTCTCTACGAGTGTGGAGATGATCC	CACGACCATAGATAACATCGGAATACTCAGAGT
GTGTTCTCTACGAGTGTGGAGATGATCC	TTTCTTTTTCTTCTACTGGACTACCAACATTTT
GTGTTCTCTACGAGTGTGGAGATGATCC	CTTTTTTAGCTGCTTGATAATCTTTATCGCATT
GTGTTCTCTACGAGTGTGGAGATGATCC	TGGACGGAGTAGCGATCTGGCAATTTACTGACA
GTGTTCTCTACGAGTGTGGAGATGATCC	TTGCTTCCGCCGTCTTTATATTGATCTGGAAAG
GTGTTCTCTACGAGTGTGGAGATGATCC	CGTTTTTATGCTCATGTGGAACTTTGGTAATGTA
GTGTTCTCTACGAGTGTGGAGATGATCC	TAAGATTTAGCATTCGTGTTGTAATCAGCATCG
GTGTTCTCTACGAGTGTGGAGATGATCC	CCTTCCCTGTTACCGCAAAACTTAGTTCTACTG
GTGTTCTCTACGAGTGTGGAGATGATCC	TTAGGTTGGTCACCGCTAGGTGTTCCGCTTGCT
GTGTTCTCTACGAGTGTGGAGATGATCC	TCTGGACCAGCAGCACCCCATACATACGGTTTA
GTGTTCTCTACGAGTGTGGAGATGATCC	CTTGACGATATTATTACAGCACTTCAAGTTGAA
GTGTTCTCTACGAGAGTGGAGATGATCC

>NZ_CP006803|3|3|423833-424654|CRT
GTGTTCTCTACGAGTGTGGAGATGATCC	TCTGCCTTTGCAGATCTGCTTTTCCAGCGTCGA
GTGTTCTCTACGAGTGTGGAGATGATCC	CACGACCATAGATAACATCGGAATACTCAGAGT
GTGTTCTCTACGAGTGTGGAGATGATCC	TTTCTTTTTCTTCTACTGGACTACCAACATTTT
GTGTTCTCTACGAGTGTGGAGATGATCC	CTTTTTTAGCTGCTTGATAATCTTTATCGCATT
GTGTTCTCTACGAGTGTGGAGATGATCC	TGGACGGAGTAGCGATCTGGCAATTTACTGACA
GTGTTCTCTACGAGTGTGGAGATGATCC	TTGCTTCCGCCGTCTTTATATTGATCTGGAAAG
GTGTTCTCTACGAGTGTGGAGATGATCC	CGTTTTTATGCTCATGTGGAACTTTGGTAATGTA
GTGTTCTCTACGAGTGTGGAGATGATCC	TAAGATTTAGCATTCGTGTTGTAATCAGCATCG
GTGTTCTCTACGAGTGTGGAGATGATCC	CCTTCCCTGTTACCGCAAAACTTAGTTCTACTG
GTGTTCTCTACGAGTGTGGAGATGATCC	TTAGGTTGGTCACCGCTAGGTGTTCCGCTTGCT
GTGTTCTCTACGAGTGTGGAGATGATCC	TCTGGACCAGCAGCACCCCATACATACGGTTTA
GTGTTCTCTACGAGTGTGGAGATGATCC	CTTGACGATATTATTACAGCACTTCAAGTTGAA
GTGTTCTCTACGAGAGTGGAGATGATCC	TTGCCAAATTGCTACTCCGTCCATTGACGGGAA
GTGTTCTCTACGAGAGTGGAGGTCGATA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	gnl|CDD|378191
NZ_CP006803.1|WP_095669561.1|421660_422086_+|restriction-endonuclease	unknown	unknown	gnl|CDD|214906
NZ_CP006803.1|WP_095669555.1|410938_411823_+|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl|CDD|130274
NZ_CP006803.1|WP_095669554.1|409894_410932_+|dTDP-glucose-4,6-dehydratase	unknown	unknown	gnl|CDD|224013
NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl|CDD|378153
NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl|CDD|378050
NZ_CP006803.1|WP_095669570.1|436060_436261_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP006803.1|WP_003647168.1|411855_412464_+|dTDP-4-dehydrorhamnose-3,5-epimerase	unknown	unknown	gnl|CDD|376414
NZ_CP006803.1|WP_095669557.1|418799_419708_+|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl|CDD|187851
NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	gnl|CDD|176648
NZ_CP006803.1|WP_095669571.1|436327_437512_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl|CDD|235985
NZ_CP006803.1|WP_095669558.1|419685_419991_+|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl|CDD|226043
NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl|CDD|274693
NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl|CDD|378189
NZ_CP006803.1|WP_095669553.1|408637_409813_+|methyltransferase-domain-containing-protein	unknown	unknown	gnl|CDD|133381
NZ_CP006803.1|WP_095669560.1|421207_421423_+|hypothetical-protein	unknown	unknown	gnl|CDD|99906
NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl|CDD|182031
NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl|CDD|187776
NZ_CP006803.1|WP_095669556.1|412480_413467_+|dTDP-4-dehydrorhamnose-reductase	unknown	unknown	gnl|CDD|367904
NZ_CP006803.1|WP_095669559.1|419987_420656_+|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl|CDD|213411

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	1.8e-60	198.7	0.7
NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	1.5e-105	348.4	1.5
NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	2.7e-48	159.6	0.0
NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	2.4e-106	349.4	0.6
NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	4.3e-101	334.0	2.6
NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	4.8e-72	237.6	0.1
NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	1.1e-47	156.8	0.0
NZ_CP006803.1|WP_095669558.1|419685_419991_+|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	2.6e-55	179.6	0.9
NZ_CP006803.1|WP_095669557.1|418799_419708_+|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	3.9e-89	293.2	5.4
NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	5.7e-35	115.5	0.0
NZ_CP006803.1|WP_095669559.1|419987_420656_+|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	8.6e-68	222.9	11.4

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl|CDD|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	1.03558e-20
NZ_CP006803.1|WP_095669561.1|421660_422086_+|restriction-endonuclease	gnl|CDD|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	4.61388e-18
NZ_CP006803.1|WP_095669555.1|410938_411823_+|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl|CDD|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	7.65183e-175
NZ_CP006803.1|WP_095669554.1|409894_410932_+|dTDP-glucose-4,6-dehydratase	gnl|CDD|224013	COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane].	0
NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl|CDD|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.18406e-146
NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl|CDD|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	4.75478e-69
NZ_CP006803.1|WP_003647168.1|411855_412464_+|dTDP-4-dehydrorhamnose-3,5-epimerase	gnl|CDD|376414	pfam00908, dTDP_sugar_isom, dTDP-4-dehydrorhamnose 3,5-epimerase. This family catalyze the isomerisation of dTDP-4-dehydro-6-deoxy -D-glucose with dTDP-4-dehydro-6-deoxy-L-mannose. The EC number of this enzyme is 5.1.3.13.	1.94051e-98
NZ_CP006803.1|WP_095669557.1|418799_419708_+|type-II-CRISPR-associated-endonuclease-Cas1	gnl|CDD|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	2.35046e-104
NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl|CDD|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	2.3796e-39
NZ_CP006803.1|WP_095669571.1|436327_437512_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl|CDD|235985	PRK07309, PRK07309, pyridoxal phosphate-dependent aminotransferase.	2.49821e-154
NZ_CP006803.1|WP_095669558.1|419685_419991_+|CRISPR-associated-endonuclease-Cas2	gnl|CDD|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.98568e-26
NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl|CDD|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	4.58034e-132
NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl|CDD|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	8.31162e-76
NZ_CP006803.1|WP_095669553.1|408637_409813_+|methyltransferase-domain-containing-protein	gnl|CDD|133381	cd01106, HTH_TipAL-Mta, Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA. Helix-turn-helix (HTH) TipAL, Mta, and SkgA transcription regulators, and related proteins, N-terminal domain. TipAL regulates resistance to and activation by numerous cyclic thiopeptide antibiotics, such as thiostrepton. Mta is a global transcriptional regulator; the N-terminal DNA-binding domain of Mta interacts directly with the promoters of mta, bmr, blt, and ydfK, and induces transcription of these multidrug-efflux transport genes. SkgA has been shown to control stationary-phase expression of catalase-peroxidase in Caulobacter crescentus. These proteins are comprised of distinct domains that harbor an N-terminal active (DNA-binding) site and a regulatory (effector-binding) site. The conserved N-terminal domain of these transcription regulators contains winged HTH motifs that mediate DNA binding. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Unique to this family, is a TipAL-like, lineage specific Bacilli subgroup, which has five conserved cysteines in the C-terminus of the protein.	1.37201e-38
NZ_CP006803.1|WP_095669560.1|421207_421423_+|hypothetical-protein	gnl|CDD|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	1.74157e-12
NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3	gnl|CDD|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	2.88825e-83
NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl|CDD|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	4.8378e-56
NZ_CP006803.1|WP_095669556.1|412480_413467_+|dTDP-4-dehydrorhamnose-reductase	gnl|CDD|367904	pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.	1.44852e-100
NZ_CP006803.1|WP_095669559.1|419987_420656_+|type-II-A-CRISPR-associated-protein-Csn2	gnl|CDD|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	4.42519e-69

Protein sequences

>NZ_CP006803.1|WP_095669561.1|421660_422086_+|restriction-endonuclease
MSIYRNDDVLITDLMDRIDKLENQVTDLKKIYYKQSGESHSTFLYGCEVRGSDYLHLEDKVVPRLKENDPVLLIREADNKYDKNAISVATPAGLKLGYIPCEHNLIFSRLIDSGNLLFGRVKNFHWDGKNLELIIKVYLAN
>NZ_CP006803.1|WP_095669560.1|421207_421423_+|hypothetical-protein
MASNMRKAAKRTGLDYKIQARGGVKLGDNVNQINALMVGPHLKSEFDAIKTQVPDKIKVILIKPNYYSISI
>NZ_CP006803.1|WP_095669559.1|419987_420656_+|type-II-A-CRISPR-associated-protein-Csn2
MILSYLSHKKMVMKNSGIKVIATSSPIVYRDVVQCFQGKKDMLLSSDDDYNQLDIIKDFDFIGDPVLNQNIFDKYMPVIIKGYIEGLNEADRNEILKTYHKLEGIIQDSLLLEDLPLELEFNEDLKKFLKIENLHLDTKFLEEPYAIIESILKIHQNYNLHSIPVACNVAHYLNLTQLGMLNDLLKEMRLKLILIEFTSADFLVFPKDVDYFYIDQDLVDWY
>NZ_CP006803.1|WP_095669558.1|419685_419991_+|CRISPR-associated-endonuclease-Cas2
MRLMIMFDLPVDTASERKEYRQFRKRLINEGFLMIQYSIYERVCVSRKTAIILENRIKSFLPTSGVVQSLMVTEKQYNDMHFLVGNPVDDVRNSSDRTVIL
>NZ_CP006803.1|WP_095669557.1|418799_419708_+|type-II-CRISPR-associated-endonuclease-Cas1
MGWRSVIITQHAKLTYSMNMMIVQTRDGINQIPISDINLLLVSTSQAVITSALISKLAENQSKIIFVDDKYQPVSETIDYYPNSRSLAKLKSQFNWDEKRKELLWTKVVARKIQNQIKVLQNYNLVWDDVQNELDQMELNDSTNRETAAARKYFISMFGKDFIRRNSGVINAALDYGYAILLSAFNREIAVNGYLSYLGIHHHSQENQFNLGSDLMEPFRPFVDYWVKAHENIDEFTPDIKFGLVELLSLEIKFNGRKTLLSNAITVYVRDCLRFLSGEIDKIKIEMELTDEVPNDAINDNV
>NZ_CP006803.1|WP_095669556.1|412480_413467_+|dTDP-4-dehydrorhamnose-reductase
MKVFVTGVNGQLGHDVMNELAKRGYEGVGSDLAPEYAGVADGSSVTKAPYVSLDITDAEAVDRVISEVNPDVIVHCAAWTAVDMAEDDDKVAAVRKVNVDGTQNIANVAKKLDAPMVYLSTDYVFDGQGTTPWEPYFKGYKPLNVYGETKLGGEEAVANTLDKYFIVRIAWVFGVNGSNFIKTMLKVGSNHDEVKVVSDQIGTPTYTFDLARLLVDMIETDKYGYYHATNSEIPATESGYDENGTKTGYISWYDFTKEIYRQAGYKTKVTPVTTEEYGLSKAVRPFNSRLDKSKLEENGFKPLPTWTDAISRYLDILKDDGFFDELKK
>NZ_CP006803.1|WP_003647168.1|411855_412464_+|dTDP-4-dehydrorhamnose-3,5-epimerase
MGQIKVEKNVGGIEGLAVITPTVHGDDRGYFMETFNQRDMMDAGFSINFVQDNQSSSTKGVLRGLHFQKKYPQIKLVRAVRGSVFDVAVDLRSESKTYGKWYGVELTAENKKQFLIPQGFAHGFLVLSDVAEFCYKVNDFWHPNDEGGMAWNDPEIGIEWPHLKGDYPGSPDASGYTLDDGTKLNMAERDQEWKGLKDTFKF
>NZ_CP006803.1|WP_095669555.1|410938_411823_+|glucose-1-phosphate-thymidylyltransferase-RfbA
MKGIILAGGSGTRLYPLTLVTSKQLLPVYDKPMIYYPLSTLMLAGIKDILVISTPADTPRFKELLGDGSQFGINLSYKVQPTPDGLAQAFTLGEDFINGEPCAMVLGDNIFYGNGFTDLLKNAAEDAQKGKATVFGYYVNDPERFGVVDFDENGKAVSIEEKPEHPKSNYAVTGLYFYPAGVSEKAAQVKPSARGEVEITSLNDMYLQDDNLGVQLLGRGYAWLDTGTMQSLVDASNYVKMIEERQGVSVSAPEEIAYVHGWIDKDQLLEAAKRYGKSPYGKHLKSVAEGKVRY
>NZ_CP006803.1|WP_095669554.1|409894_410932_+|dTDP-glucose-4,6-dehydratase
MKVIVTGGAGFIGSNFIFYMLKKHPDYEIICLDSLTYAGNLSTLKDVMDNPKFKFVKLDIRDREGVYKLFEEEKPDVVVNFAAESHVDRSIENPEIFLETNIIGTSVLMDACRKYGIKRFHQVSTDEVYGDLPLDRPDLFFHEDTPLHTSSPYSSSKASADLLVGAYGRTFHLPVTISRCSNNYGPYQFPEKLIPLMIQRALNNEKLPVYGDGKNVRDWLYVEDHCKAIDLILEKGTPGEVYNIGGHNEMHNIDIVKLICDYLDKPYSLIEHVTDRKGHDRRYAIDPEKIHNELGWLPETMFKDGIKKTIQWYLDNKEWWENIISGDYQNYYDKMYGKKQVLDKD
>NZ_CP006803.1|WP_095669553.1|408637_409813_+|methyltransferase-domain-containing-protein
MSKYYTSGEFAKKAHVSIRTIRYYDPKNLLKPSTHTAGGARRYTDADFAKLQQILLLKYLGFSLSDIREMTLGSGDRQLLLDSLQIQKRLVEERLKEMQNVATAIDSTSSTLKAGQEVDWSKMLDLIHLTSMNQSLSTQYQNASNISARIRLHRDYSLNKEGWFHWLFKQLDLKPGMKILELGAGNGALWSQNLDKLPKGLTLVLSDISEGILADAKNEIGDNSEFQYAVFDAQKIPFADNTFDLVIANHMLFYCDDIPKTLKEVRRVMKKGASFACATYSKRHMHEITDLVQEFNPEIVLSSTNLYDRFGLDNGAEILSKDFTDVSCHKYQDAIELSESTPVISYILSCHGNQNAILLDHYNEFKNYVDEKVSGGFHITKDVGYFICKKT
>NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3
MVELTSAAKALWGKKTVHNDQELWLPLVAHLVDTKNVMQWLYEEWIGEGTKAIVRQNMTDEDAKKLVGFLGFFHDFGKATPAFQYKQSFPRHKDLDADIVENLTRAGFSLIRTDNRFFQRSPHPIAGEALLEFFGLNQSLGSIIGGHHGIPPQKDLSEIQFESYTSNIWGKDRDLKIQNEWKNVQKNIFQFGMSLCEYHDVKEMPDVNLNQAVILEGMLIMSDWLASSEYLNDSANIPLFPLISLDDDFDNLNMKDRYQKAINNWDLSDQWFPEEIMSVDKQYRLRFEFKPRPLQKEMSELISNAHDPGLIIIEAPTGIGKTELALTAAEQLAFKQGKTGLYMGLPTQATTNAMFTRVEKWLKNIAKEQQINPDIKLLQGKASFNKEYTSLQSTEHIYDNYYDDQEGNVVVNSWFSGKKSILSHFAVGTIDNLLLTALKQKHLFLRHLGFSNKVVIIDELHAYDSYMNSYLVKTIKWLGAYHVPVIALSATLPKVRRNDLLKAYLEGKYGCTKIEAYHDWKNNEGYPLISILDGNKLEQSNKFSTSNDEKRNINIIRFKGNEEEIINKALLEIENGGVAGIIVNTVKRAQDLARLVPEDTEALLLHSSFLSSDRENLEQELQKNVGKGAKRPKKMIVIGTQVLEQSLDIDFDVLFTDIAPIDLLIQRIGRLHRHNISRPPKLSTPTAYITGINSYGDYGKGNEYIYEKYLLMKTDHFLNGQLKVPEDVSHLVQDVYSTDTDSKIKDISEAKGKFNNHLLKSKQKAEIFQICDPKSPAQKNLFGWLNDIKTNVENDIYASACVRDIKETLEVVLLKKIDEEYFLLNGENIKEVTSEKIAGQAIRLPFAIIENASGHDKIDSTIRDLERGMQQLHTKWKNNIWLRGVLVLELDEQNTANLNGFLLKYSSKLGLIYEKE
>NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MQKESFNLITDPWIQVLNQTGELKEVSLLEVFKNAAKYQRLAGEMQSQDLAILRLLVAILTTVYSRINENDKIYDGLELDERLHLVKVNRAPSYEQLKDTWHGLYKKKHFSNALFQYLKANSDKFDFFGDQPFYQVTKEVYDQVVPANKKVNIKNPKGTVDVKQINRTISESNNSPAIFSPRTSRMKNELNLSQLIRWIITYQSFTGVTDKTKITSKEKFSVSSGWLYGLNPVFAQGENLFQTLMLNLVFLDQYQEEKPVWEFDSSVDYIEFIKNQTESSKLSISFLYTVWSRILHLEWVDNKPIIFTAGLPKLDSTNLFQEPMTTWKHNDKEDDFYPATKHLNDLNKAMWRNFGQYVLTVSESNSQKAVETHEPELIKWLREIKRNEFLATDMSLTLKTVTLVSDGNATSQSPVAEINDNFKIRANVLFDESGKNYWPAIIEDMINMTQQAGKDFWIFANNISKLRGIDGSEFANNLTAEFYDTLNVPFLTWLASLRNDQERRDKVYEWETELKRIALGRAEEVLQNASPRDIIGRENSDQDEVNGLKNIFTIFNRYKLNVLIHING
>NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MKIDVKKDTARIIKKLHERDGNDKAILAAIRRSNSILSRQATIVWPMLFGFIKDKEFFSKTGMPNRQEKAVFTALRCYAVFEQGNDNERDREYINESSSSLFENLSFLRKDERLREALDRRVQAVLSSTNFESVSRSVVGLTKLVKANNAQASLNYPDLANDLYNFQFGYESSRKVAIKWGREYFSFNDQVNKESNED
>NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTQENLYVDIHVLQTVPSSNINRDDTGAPKTAIYGGATRSRVSSQSWKKAVRDKFKEDRKRHDWLAGFRTKRSATLLAKELMKKDPSLSFDDAREKAKKVLSDMGLKFDKAKKNDKNKDKDYETKVLLFFSPGQLEKLAAYVLENDNFDKKEVKKILNDTQSLDLALFGRMVADDPELNVEAASQVAHAVSTHEVVSEFDFFTAVDDAKKSDESGSAMLSTLEYNSSTLYRYANVNMNELIHNLGKDLALIGLKEFIKDFVLSMPTGHQNSYANGTLPQYVLVTIRKDTPVNLVSAFEVPVQSNNGYVEKSVERLEEEFDNANIWVGEPVESFVNANSEIKTKDGERVKNINELLDSVSTVIAKRVEDEDANA
>NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKTLTLKLKAPLQAYGNEATFGRRTSNPYPTKSAVIGMIAAALGYDRRNSKIIDLNKLSFATRVDQPGKIMSDFQIVEYAKNANKKDKKLTYRDYLQDAIFMVAIGSENSDLINEIHYALRHPKFPLFLGRRSCPPAGPLEIEVFDNQNPLMVLQTMGWQAAEWYQKKHSNFKAEIVYDASLGSNDNFKFQLRDEVGSFDQRNRYHNYREVVSTYIPMKNETKWHAETMHDIMANI
>NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLSRVEIDLKNRRKTYDLSHLGAYHNWVESCFPRYQDENNRPRNLWRIDVLNGRSYLLLLSTQKPNLEELSKYGVSGTAVTKEYDDFLNKLYLGEILRFRLTANPSRKISVPGQRQGRIMPHITIAQQKKWFLDRTDVNGFKVLEDQENYPQFDIVNREWKLLRHKGSGTARLSCVTFEGVLKITDLEKFKKAMIKGIGREKAYGMGLLTVIPM
>NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MQKKFGAKKPEIGELSKISDRVTFLYLEHAKLNRVDSAISVVDSQGTVYIPAAIISVLFLGPGVDVTHRAMELMGEAGMSVVWVGEEGVRQYAHGRALNHSSTLLQAQAKLVSNNRSRLKVARKMYQMRFPGIDVSNLTMQQLRGKEGARVRKVYQEQSQKTGVSWSRREYKVDDFEASTPINQALTAAHQALYGLSYSVIVALGASAGLGFVHTGHDLSFVYDFSDLYKAEYSIPIAFEVVKEYGKEDISTHTRYAMRDAFKDGRLIERMVKDLKYLLDVEDQTEVKAVMNLWDDKKGLQKFGVQYHELGE
>NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MIVITLSKTPNSLRGDLTKWCQEIQTGVYVGNLNAKVRELLWERIEKNIGGGEATMVYNTNNELGYTFRTNRKDKRVVDFDGIPFLMHINKPSDVVLGFSNAAKFHKVHRVSSSAKKIENQNELQNFVAIDLETTGLNSEKDRIISIAAVKYIKKNDPEVFYRLIKDIPEVPEHISKLTGLTTKKLRDSGVSLRDALIEFKKFVGSRLIVGYNLPFDMSFLENSIKKESLNSLENRAKDILPIVKRKNKFLEDYHLDTVLKKYDIENENPHHADSDAKSTWYLTKKLIEIKSLII
>NZ_CP006803.1|WP_095669570.1|436060_436261_+|hypothetical-protein
MKVRYAGESFYSGLGLANGKVYVVLDKKGPFYRIIDDSGEDYLYSKTNPAPLDGNSKGGYWNIVEY
>NZ_CP006803.1|WP_095669571.1|436327_437512_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MPKLANDLSLTKNTRLNSLGPSKIRAFDAKASQIPGIIKLTIGEPDLNTPDHVKDAAIADIKANDSHYAPQAGKPELQDAISKYLNRSLNVKYDPTTEICVTVGATGALNDVFMSILNPGDKILVPTPVWALYFQLIKLTGAIPVQMDTSKDGFILTPEHLEKVLQNEGKGAKAIILTDPSNPTGRVYPEETLKALAEIITKYHLFSVTDEIYGELVYDNNVHHSLSQYIPERNILISGLSKAYAMTGWRLGYIAAPADIMKTIQKVNAFLVTSVTDNVQAAAIEALNNGQADPLESRKIYEDRLKFMKAGLEKLGFEMSAPQGAFYIFAKIPDAFGTDDEAFANELATKAKVGVTPGRYFGQGGQGYVRMSYASSTEQLKEALKRIAEFVKNI

Crispr_ID: NZ_CP006803_4

• CRISPR_ID: NZ_CP006803_4
• CRISPR_location: 434446-436005
• CRISPR_type: TypeI-E
• Repeat_type: I-B,III-A,III-B
• Spacer_info: 25 spacers
• Cas_protein_info: DEDDh,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3

Consensus repeat of NZ_CP006803_4

Consensus_repeat	Method
TAGGATCATCTCCACATACGTGGAGAATACGCTAA	PILER-CR
GTATTCTCCACGTATGTGGAGATGATCCT	CRISPRCasFinder
GTATTCTCCACGTATGTGGAGATGATCCT	CRT
GGATCATCTCCACATACGTGGAGAATAC	PILER-CR

spacers of NZ_CP006803_4

>4.1|434481|30|NZ_CP006803|PILER-CR
CCGTATTCCCAATTAGCATAGGTTGAAAGT
>4.2|434546|26|NZ_CP006803|PILER-CR
TTGTCGAACCCTTACGAATACCTAGG
>4.3|434480|32|NZ_CP006803|CRISPRCasFinder,CRT
ACCGTATTCCCAATTAGCATAGGTTGAAAGTC
>4.4|434541|32|NZ_CP006803|CRISPRCasFinder,CRT
ATTGTCGAACCCTTACGAATACCTAGGTTAGC
>4.5|434602|32|NZ_CP006803|CRISPRCasFinder,CRT
AAAGTTTGCTCCCCAAAGTCTGGAATGTATTC
>4.6|434663|32|NZ_CP006803|CRISPRCasFinder,CRT
AACTGGAAGAAGATTGAAGAAACTATCAATCA
>4.7|434724|32|NZ_CP006803|CRISPRCasFinder,CRT
TAATTCAGACATTACGGAGGAATAGAAAATGG
>4.8|434785|32|NZ_CP006803|CRISPRCasFinder,CRT
AGCGATGGAGGTGCTTTCAATGAGTGCATTTA
>4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT
GTTTTGTTTAATTAACTTACATAATTATAATA
>4.10|434907|32|NZ_CP006803|CRISPRCasFinder,CRT
TGCTACACCAAGCATTTCAGCACCATCTTGTA
>4.11|434968|32|NZ_CP006803|CRISPRCasFinder,CRT
TGCTTTAGAAATCCATTGAATCGCTTCTTTAT
>4.12|435029|32|NZ_CP006803|CRISPRCasFinder,CRT
TCTCCTTTCTACCCTGTATCGTTTTCCTCCTT
>4.13|435090|32|NZ_CP006803|CRISPRCasFinder,CRT
ACTGCTAAGGCTCGAAATTTAGCTGATGTGAA
>4.14|435151|32|NZ_CP006803|CRISPRCasFinder,CRT
TCCTCTCTCAATTTTTCATTCTCTTCTTGTAG
>4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT
TATTGAGAGGTGAAAACATGGAAAAAAGTAAA
>4.16|435273|33|NZ_CP006803|CRISPRCasFinder,CRT
GAAGCTACCGCCGTCTTGGCTGCCACCAAAGAG
>4.17|435335|32|NZ_CP006803|CRISPRCasFinder,CRT
GGAATAATAAGAATCAAATCGAATCAAATAGA
>4.18|435396|32|NZ_CP006803|CRISPRCasFinder,CRT
AGAATCAAATAGAATCATAAGAATTATTAATA
>4.19|435457|32|NZ_CP006803|CRISPRCasFinder,CRT
AAAAATCATGGATTTATCAGAATTAGAAAAGG
>4.20|435518|32|NZ_CP006803|CRISPRCasFinder,CRT
GGCATCAGGGGCACAAATCCAAACCTATAAGA
>4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT
AAGACTCAATCTGAAGAAGTAAAAGATGAAGT
>4.22|435640|32|NZ_CP006803|CRISPRCasFinder,CRT
AAGCCAGTTCGAAGGGCTACTAACTGGGATAA
>4.23|435701|32|NZ_CP006803|CRISPRCasFinder,CRT
TAATGCCCATTCCTTGGGATAAACCATTTCCG
>4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT
TGCCTGAATTTGATCGTTTTAAGGTTGGAGAT
>4.25|435823|32|NZ_CP006803|CRISPRCasFinder,CRT
ATAAATTCATGGATAAATTTACCATGATTCTT
>4.26|435884|32|NZ_CP006803|CRISPRCasFinder,CRT
GAAAAAGAAGCCTGACGATGAAAAACAATTTG
>4.27|435945|32|NZ_CP006803|CRISPRCasFinder,CRT
TAACCAACTTTTGCGTCGAAATATCCAAACAA
>4.28|434723|33|NZ_CP006803|PILER-CR
TTAATTCAGACATTACGGAGGAATAGAAAATGG
>4.29|434784|33|NZ_CP006803|PILER-CR
TAGCGATGGAGGTGCTTTCAATGAGTGCATTTA
>4.30|434845|33|NZ_CP006803|PILER-CR
CGTTTTGTTTAATTAACTTACATAATTATAATA
>4.31|434906|33|NZ_CP006803|PILER-CR
TTGCTACACCAAGCATTTCAGCACCATCTTGTA
>4.32|434967|33|NZ_CP006803|PILER-CR
TTGCTTTAGAAATCCATTGAATCGCTTCTTTAT
>4.33|435028|33|NZ_CP006803|PILER-CR
TTCTCCTTTCTACCCTGTATCGTTTTCCTCCTT
>4.34|435089|33|NZ_CP006803|PILER-CR
CACTGCTAAGGCTCGAAATTTAGCTGATGTGAA
>4.35|435150|33|NZ_CP006803|PILER-CR
TTCCTCTCTCAATTTTTCATTCTCTTCTTGTAG
>4.36|435211|33|NZ_CP006803|PILER-CR
TTATTGAGAGGTGAAAACATGGAAAAAAGTAAA
>4.37|435272|34|NZ_CP006803|PILER-CR
TGAAGCTACCGCCGTCTTGGCTGCCACCAAAGAG
>4.38|435334|33|NZ_CP006803|PILER-CR
TGGAATAATAAGAATCAAATCGAATCAAATAGA
>4.39|435395|33|NZ_CP006803|PILER-CR
TAGAATCAAATAGAATCATAAGAATTATTAATA
>4.40|435456|33|NZ_CP006803|PILER-CR
TAAAAATCATGGATTTATCAGAATTAGAAAAGG
>4.41|435517|33|NZ_CP006803|PILER-CR
TGGCATCAGGGGCACAAATCCAAACCTATAAGA
>4.42|435578|33|NZ_CP006803|PILER-CR
CAAGACTCAATCTGAAGAAGTAAAAGATGAAGT
>4.43|435639|33|NZ_CP006803|PILER-CR
TAAGCCAGTTCGAAGGGCTACTAACTGGGATAA
>4.44|435700|33|NZ_CP006803|PILER-CR
TTAATGCCCATTCCTTGGGATAAACCATTTCCG
>4.45|435761|33|NZ_CP006803|PILER-CR
TTGCCTGAATTTGATCGTTTTAAGGTTGGAGAT
>4.46|435822|33|NZ_CP006803|PILER-CR
CATAAATTCATGGATAAATTTACCATGATTCTT
>4.47|435883|33|NZ_CP006803|PILER-CR
TGAAAAAGAAGCCTGACGATGAAAAACAATTTG

CRISPR arrays and Neighbor proteins around NZ_CP006803_4

CRISPR arrays

The CRISPR arrays of NZ_CP006803_4

>merge|NZ_CP006803|4|434446-436005|PILER-CR,CRISPRCasFinder,CRT,PILER-CR
TTAGTGTATTCTCCACGTATGTGGAGATGATCCTACCGTATTCCCAATTAGCATAGGTTGAAAGTCGTATTCTCCACGTATGTGGAGATGATCCTATTGTCGAACCCTTACGAATACCTAGGTTAGCGTATTCTCCACGTATGTGGAGATGATCCTAAAGTTTGCTCCCCAAAGTCTGGAATGTATTCGTATTCTCCACGTATGTGGAGATGATCCTAACTGGAAGAAGATTGAAGAAACTATCAATCAGTATTCTCCACGTATGTGGAGATGATCCTTAATTCAGACATTACGGAGGAATAGAAAATGGGTATTCTCCACGTATGTGGAGATGATCCTAGCGATGGAGGTGCTTTCAATGAGTGCATTTAGTATTCTCCACGTATGTGGAGATGATCCCGTTTTGTTTAATTAACTTACATAATTATAATAGTATTCTCCACGTATGTGGAGATGATCCTTGCTACACCAAGCATTTCAGCACCATCTTGTAGTATTCTCCACGTATGTGGAGATGATCCTTGCTTTAGAAATCCATTGAATCGCTTCTTTATGTATTCTCCACGTATGTGGAGATGATCCTTCTCCTTTCTACCCTGTATCGTTTTCCTCCTTGTATTCTCCACGTATGTGGAGATGATCCCACTGCTAAGGCTCGAAATTTAGCTGATGTGAAGTATTCTCCACGTATGTGGAGATGATCCTTCCTCTCTCAATTTTTCATTCTCTTCTTGTAGGTATTCTCCACGTATGTGGAGATGATCCTTATTGAGAGGTGAAAACATGGAAAAAAGTAAAGTATTCTCCACGTATGTGGAGATGATCCTGAAGCTACCGCCGTCTTGGCTGCCACCAAAGAGGTATTCTCCACGTATGTGGAGATGATCCTGGAATAATAAGAATCAAATCGAATCAAATAGAGTATTCTCCACGTATGTGGAGATGATCCTAGAATCAAATAGAATCATAAGAATTATTAATAGTATTCTCCACGTATGTGGAGATGATCCTAAAAATCATGGATTTATCAGAATTAGAAAAGGGTATTCTCCACGTATGTGGAGATGATCCTGGCATCAGGGGCACAAATCCAAACCTATAAGAGTATTCTCCACGTATGTGGAGATGATCCCAAGACTCAATCTGAAGAAGTAAAAGATGAAGTGTATTCTCCACGTATGTGGAGATGATCCTAAGCCAGTTCGAAGGGCTACTAACTGGGATAAGTATTCTCCACGTATGTGGAGATGATCCTTAATGCCCATTCCTTGGGATAAACCATTTCCGGTATTCTCCACGTATGTGGAGATGATCCTTGCCTGAATTTGATCGTTTTAAGGTTGGAGATGTATTCTCCACGTATGTGGAGATGATCCCATAAATTCATGGATAAATTTACCATGATTCTTGTATTCTCCACGTATGTGGAGATGATCCTGAAAAAGAAGCCTGACGATGAAAAACAATTTGGTATTCTCCACGTATGTGGAGATGATCCTTAACCAACTTTTGCGTCGAAATATCCAAACAAGTATTCTCCACGTATGTGGAGGACTCCTG

>NZ_CP006803|4|4|434446-434602|PILER-CR
TTAGTGTATTCTCCACGTATGTGGAGATGATCCTA	CCGTATTCCCAATTAGCATAGGTTGAAAGT
CGTATTCTCCACGTATGTGGAGATGATCCTATTGT	CGAACCCTTACGAATACCTAGGTTAG
CGTATTCTCCACGTATGTGGAGATGATCCTAAAGTTTGCTCCCCAAAGTCTGGAATGTATTCGTATTCTCCACGTATGTGGAGATGATCCTAACTGGAAGAAGATTGAAGAAACTATCAATCAGTATTCTCCACGTATGTGGAGATGATCC	TTAATTCAGACATTACGGAGGAATAGAAAATGG
GTATTCTCCACGTATGTGGAGATGATCC	TAGCGATGGAGGTGCTTTCAATGAGTGCATTTA
GTATTCTCCACGTATGTGGAGATGATCC	CGTTTTGTTTAATTAACTTACATAATTATAATA
GTATTCTCCACGTATGTGGAGATGATCC	TTGCTACACCAAGCATTTCAGCACCATCTTGTA
GTATTCTCCACGTATGTGGAGATGATCC	TTGCTTTAGAAATCCATTGAATCGCTTCTTTAT
GTATTCTCCACGTATGTGGAGATGATCC	TTCTCCTTTCTACCCTGTATCGTTTTCCTCCTT
GTATTCTCCACGTATGTGGAGATGATCC	CACTGCTAAGGCTCGAAATTTAGCTGATGTGAA
GTATTCTCCACGTATGTGGAGATGATCC	TTCCTCTCTCAATTTTTCATTCTCTTCTTGTAG
GTATTCTCCACGTATGTGGAGATGATCC	TTATTGAGAGGTGAAAACATGGAAAAAAGTAAA
GTATTCTCCACGTATGTGGAGATGATCC	TGAAGCTACCGCCGTCTTGGCTGCCACCAAAGAG
GTATTCTCCACGTATGTGGAGATGATCC	TGGAATAATAAGAATCAAATCGAATCAAATAGA
GTATTCTCCACGTATGTGGAGATGATCC	TAGAATCAAATAGAATCATAAGAATTATTAATA
GTATTCTCCACGTATGTGGAGATGATCC	TAAAAATCATGGATTTATCAGAATTAGAAAAGG
GTATTCTCCACGTATGTGGAGATGATCC	TGGCATCAGGGGCACAAATCCAAACCTATAAGA
GTATTCTCCACGTATGTGGAGATGATCC	CAAGACTCAATCTGAAGAAGTAAAAGATGAAGT
GTATTCTCCACGTATGTGGAGATGATCC	TAAGCCAGTTCGAAGGGCTACTAACTGGGATAA
GTATTCTCCACGTATGTGGAGATGATCC	TTAATGCCCATTCCTTGGGATAAACCATTTCCG
GTATTCTCCACGTATGTGGAGATGATCC	TTGCCTGAATTTGATCGTTTTAAGGTTGGAGAT
GTATTCTCCACGTATGTGGAGATGATCC	CATAAATTCATGGATAAATTTACCATGATTCTT
GTATTCTCCACGTATGTGGAGATGATCC	TGAAAAAGAAGCCTGACGATGAAAAACAATTTG


>NZ_CP006803|4|2|434451-436005|CRISPRCasFinder
GTATTCTCCACGTATGTGGAGATGATCCT	ACCGTATTCCCAATTAGCATAGGTTGAAAGTC
GTATTCTCCACGTATGTGGAGATGATCCT	ATTGTCGAACCCTTACGAATACCTAGGTTAGC
GTATTCTCCACGTATGTGGAGATGATCCT	AAAGTTTGCTCCCCAAAGTCTGGAATGTATTC
GTATTCTCCACGTATGTGGAGATGATCCT	AACTGGAAGAAGATTGAAGAAACTATCAATCA
GTATTCTCCACGTATGTGGAGATGATCCT	TAATTCAGACATTACGGAGGAATAGAAAATGG
GTATTCTCCACGTATGTGGAGATGATCCT	AGCGATGGAGGTGCTTTCAATGAGTGCATTTA
GTATTCTCCACGTATGTGGAGATGATCCC	GTTTTGTTTAATTAACTTACATAATTATAATA
GTATTCTCCACGTATGTGGAGATGATCCT	TGCTACACCAAGCATTTCAGCACCATCTTGTA
GTATTCTCCACGTATGTGGAGATGATCCT	TGCTTTAGAAATCCATTGAATCGCTTCTTTAT
GTATTCTCCACGTATGTGGAGATGATCCT	TCTCCTTTCTACCCTGTATCGTTTTCCTCCTT
GTATTCTCCACGTATGTGGAGATGATCCC	ACTGCTAAGGCTCGAAATTTAGCTGATGTGAA
GTATTCTCCACGTATGTGGAGATGATCCT	TCCTCTCTCAATTTTTCATTCTCTTCTTGTAG
GTATTCTCCACGTATGTGGAGATGATCCT	TATTGAGAGGTGAAAACATGGAAAAAAGTAAA
GTATTCTCCACGTATGTGGAGATGATCCT	GAAGCTACCGCCGTCTTGGCTGCCACCAAAGAG
GTATTCTCCACGTATGTGGAGATGATCCT	GGAATAATAAGAATCAAATCGAATCAAATAGA
GTATTCTCCACGTATGTGGAGATGATCCT	AGAATCAAATAGAATCATAAGAATTATTAATA
GTATTCTCCACGTATGTGGAGATGATCCT	AAAAATCATGGATTTATCAGAATTAGAAAAGG
GTATTCTCCACGTATGTGGAGATGATCCT	GGCATCAGGGGCACAAATCCAAACCTATAAGA
GTATTCTCCACGTATGTGGAGATGATCCC	AAGACTCAATCTGAAGAAGTAAAAGATGAAGT
GTATTCTCCACGTATGTGGAGATGATCCT	AAGCCAGTTCGAAGGGCTACTAACTGGGATAA
GTATTCTCCACGTATGTGGAGATGATCCT	TAATGCCCATTCCTTGGGATAAACCATTTCCG
GTATTCTCCACGTATGTGGAGATGATCCT	TGCCTGAATTTGATCGTTTTAAGGTTGGAGAT
GTATTCTCCACGTATGTGGAGATGATCCC	ATAAATTCATGGATAAATTTACCATGATTCTT
GTATTCTCCACGTATGTGGAGATGATCCT	GAAAAAGAAGCCTGACGATGAAAAACAATTTG
GTATTCTCCACGTATGTGGAGATGATCCT	TAACCAACTTTTGCGTCGAAATATCCAAACAA
GTATTCTCCACGTATGTGGAGGACTCCTG

>NZ_CP006803|4|4|434451-436005|CRT
GTATTCTCCACGTATGTGGAGATGATCCT	ACCGTATTCCCAATTAGCATAGGTTGAAAGTC
GTATTCTCCACGTATGTGGAGATGATCCT	ATTGTCGAACCCTTACGAATACCTAGGTTAGC
GTATTCTCCACGTATGTGGAGATGATCCT	AAAGTTTGCTCCCCAAAGTCTGGAATGTATTC
GTATTCTCCACGTATGTGGAGATGATCCT	AACTGGAAGAAGATTGAAGAAACTATCAATCA
GTATTCTCCACGTATGTGGAGATGATCCT	TAATTCAGACATTACGGAGGAATAGAAAATGG
GTATTCTCCACGTATGTGGAGATGATCCT	AGCGATGGAGGTGCTTTCAATGAGTGCATTTA
GTATTCTCCACGTATGTGGAGATGATCCC	GTTTTGTTTAATTAACTTACATAATTATAATA
GTATTCTCCACGTATGTGGAGATGATCCT	TGCTACACCAAGCATTTCAGCACCATCTTGTA
GTATTCTCCACGTATGTGGAGATGATCCT	TGCTTTAGAAATCCATTGAATCGCTTCTTTAT
GTATTCTCCACGTATGTGGAGATGATCCT	TCTCCTTTCTACCCTGTATCGTTTTCCTCCTT
GTATTCTCCACGTATGTGGAGATGATCCC	ACTGCTAAGGCTCGAAATTTAGCTGATGTGAA
GTATTCTCCACGTATGTGGAGATGATCCT	TCCTCTCTCAATTTTTCATTCTCTTCTTGTAG
GTATTCTCCACGTATGTGGAGATGATCCT	TATTGAGAGGTGAAAACATGGAAAAAAGTAAA
GTATTCTCCACGTATGTGGAGATGATCCT	GAAGCTACCGCCGTCTTGGCTGCCACCAAAGAG
GTATTCTCCACGTATGTGGAGATGATCCT	GGAATAATAAGAATCAAATCGAATCAAATAGA
GTATTCTCCACGTATGTGGAGATGATCCT	AGAATCAAATAGAATCATAAGAATTATTAATA
GTATTCTCCACGTATGTGGAGATGATCCT	AAAAATCATGGATTTATCAGAATTAGAAAAGG
GTATTCTCCACGTATGTGGAGATGATCCT	GGCATCAGGGGCACAAATCCAAACCTATAAGA
GTATTCTCCACGTATGTGGAGATGATCCC	AAGACTCAATCTGAAGAAGTAAAAGATGAAGT
GTATTCTCCACGTATGTGGAGATGATCCT	AAGCCAGTTCGAAGGGCTACTAACTGGGATAA
GTATTCTCCACGTATGTGGAGATGATCCT	TAATGCCCATTCCTTGGGATAAACCATTTCCG
GTATTCTCCACGTATGTGGAGATGATCCT	TGCCTGAATTTGATCGTTTTAAGGTTGGAGAT
GTATTCTCCACGTATGTGGAGATGATCCC	ATAAATTCATGGATAAATTTACCATGATTCTT
GTATTCTCCACGTATGTGGAGATGATCCT	GAAAAAGAAGCCTGACGATGAAAAACAATTTG
GTATTCTCCACGTATGTGGAGATGATCCT	TAACCAACTTTTGCGTCGAAATATCCAAACAA
GTATTCTCCACGTATGTGGAGGACTCCTG

>NZ_CP006803|4|5|434695-435943|PILER-CR
	CCGTATTCCCAATTAGCATAGGTTGAAAGT
CGTATTCTCCACGTATGTGGAGATGATCCTATTGT	CGAACCCTTACGAATACCTAGGTTAG
CGTATTCTCCACGTATGTGGAGATGATCCTAAAGTTTGCTCCCCAAAGTCTGGAATGTATTCGTATTCTCCACGTATGTGGAGATGATCCTAACTGGAAGAAGATTGAAGAAACTATCAATCAGTATTCTCCACGTATGTGGAGATGATCC	TTAATTCAGACATTACGGAGGAATAGAAAATGG
GTATTCTCCACGTATGTGGAGATGATCC	TAGCGATGGAGGTGCTTTCAATGAGTGCATTTA
GTATTCTCCACGTATGTGGAGATGATCC	CGTTTTGTTTAATTAACTTACATAATTATAATA
GTATTCTCCACGTATGTGGAGATGATCC	TTGCTACACCAAGCATTTCAGCACCATCTTGTA
GTATTCTCCACGTATGTGGAGATGATCC	TTGCTTTAGAAATCCATTGAATCGCTTCTTTAT
GTATTCTCCACGTATGTGGAGATGATCC	TTCTCCTTTCTACCCTGTATCGTTTTCCTCCTT
GTATTCTCCACGTATGTGGAGATGATCC	CACTGCTAAGGCTCGAAATTTAGCTGATGTGAA
GTATTCTCCACGTATGTGGAGATGATCC	TTCCTCTCTCAATTTTTCATTCTCTTCTTGTAG
GTATTCTCCACGTATGTGGAGATGATCC	TTATTGAGAGGTGAAAACATGGAAAAAAGTAAA
GTATTCTCCACGTATGTGGAGATGATCC	TGAAGCTACCGCCGTCTTGGCTGCCACCAAAGAG
GTATTCTCCACGTATGTGGAGATGATCC	TGGAATAATAAGAATCAAATCGAATCAAATAGA
GTATTCTCCACGTATGTGGAGATGATCC	TAGAATCAAATAGAATCATAAGAATTATTAATA
GTATTCTCCACGTATGTGGAGATGATCC	TAAAAATCATGGATTTATCAGAATTAGAAAAGG
GTATTCTCCACGTATGTGGAGATGATCC	TGGCATCAGGGGCACAAATCCAAACCTATAAGA
GTATTCTCCACGTATGTGGAGATGATCC	CAAGACTCAATCTGAAGAAGTAAAAGATGAAGT
GTATTCTCCACGTATGTGGAGATGATCC	TAAGCCAGTTCGAAGGGCTACTAACTGGGATAA
GTATTCTCCACGTATGTGGAGATGATCC	TTAATGCCCATTCCTTGGGATAAACCATTTCCG
GTATTCTCCACGTATGTGGAGATGATCC	TTGCCTGAATTTGATCGTTTTAAGGTTGGAGAT
GTATTCTCCACGTATGTGGAGATGATCC	CATAAATTCATGGATAAATTTACCATGATTCTT
GTATTCTCCACGTATGTGGAGATGATCC	TGAAAAAGAAGCCTGACGATGAAAAACAATTTG
GTATTCTCCACGTATGTGGAGATGATCC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	gnl|CDD|378191
NZ_CP006803.1|WP_095669561.1|421660_422086_+|restriction-endonuclease	unknown	unknown	gnl|CDD|214906
NZ_CP006803.1|WP_003647179.1|440569_441412_-|kinase/pyrophosphorylase	unknown	unknown	gnl|CDD|377080
NZ_CP006803.1|WP_095669574.1|438961_439519_+|peptide-methionine-(S)-S-oxide-reductase-MsrA	unknown	unknown	gnl|CDD|376578
NZ_CP006803.1|WP_095669571.1|436327_437512_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl|CDD|235985
NZ_CP006803.1|WP_003647178.1|439615_440494_+|YitT-family-protein	unknown	unknown	gnl|CDD|224203
NZ_CP006803.1|WP_095669572.1|437619_438051_+|peptide-methionine-(R)-S-oxide-reductase-MsrB	unknown	unknown	gnl|CDD|234692
NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl|CDD|378050
NZ_CP006803.1|WP_095669570.1|436060_436261_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl|CDD|378153
NZ_CP006803.1|WP_049149059.1|441840_442284_+|GatB/YqeY-domain-containing-protein	unknown	unknown	gnl|CDD|370480
NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl|CDD|274693
NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl|CDD|378189
NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl|CDD|182031
NZ_CP006803.1|WP_095669560.1|421207_421423_+|hypothetical-protein	unknown	unknown	gnl|CDD|99906
NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	gnl|CDD|176648
NZ_CP006803.1|WP_095669573.1|438054_438816_+|SGNH/GDSL-hydrolase-family-protein	unknown	unknown	gnl|CDD|238141
NZ_CP006803.1|WP_003647182.1|442314_443274_+|PhoH-family-protein	unknown	unknown	gnl|CDD|224616
NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl|CDD|187776
NZ_CP006803.1|WP_003647180.1|441561_441738_+|30S-ribosomal-protein-S21	unknown	unknown	gnl|CDD|234707

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	1.8e-60	198.7	0.7
NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	2.7e-48	159.6	0.0
NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	2.4e-106	349.4	0.6
NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	4.3e-101	334.0	2.6
NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	4.8e-72	237.6	0.1
NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	1.5e-105	348.4	1.5
NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	5.7e-35	115.5	0.0
NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	1.1e-47	156.8	0.0

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl|CDD|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	1.03558e-20
NZ_CP006803.1|WP_095669561.1|421660_422086_+|restriction-endonuclease	gnl|CDD|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	4.61388e-18
NZ_CP006803.1|WP_003647179.1|440569_441412_-|kinase/pyrophosphorylase	gnl|CDD|377080	pfam03618, Kinase-PPPase, Kinase/pyrophosphorylase. This family of regulatory proteins has ADP-dependent kinase and inorganic phosphate-dependent pyrophosphorylase activity.	4.98007e-132
NZ_CP006803.1|WP_095669574.1|438961_439519_+|peptide-methionine-(S)-S-oxide-reductase-MsrA	gnl|CDD|376578	pfam01625, PMSR, Peptide methionine sulfoxide reductase. This enzyme repairs damaged proteins. Methionine sulfoxide in proteins is reduced to methionine.	1.79851e-97
NZ_CP006803.1|WP_095669571.1|436327_437512_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl|CDD|235985	PRK07309, PRK07309, pyridoxal phosphate-dependent aminotransferase.	2.49821e-154
NZ_CP006803.1|WP_003647178.1|439615_440494_+|YitT-family-protein	gnl|CDD|224203	COG1284, COG1284, Uncharacterized conserved protein [Function unknown].	4.94497e-62
NZ_CP006803.1|WP_095669572.1|437619_438051_+|peptide-methionine-(R)-S-oxide-reductase-MsrB	gnl|CDD|234692	PRK00222, PRK00222, peptide-methionine (R)-S-oxide reductase MsrB.	3.03603e-88
NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl|CDD|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	4.75478e-69
NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl|CDD|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.18406e-146
NZ_CP006803.1|WP_049149059.1|441840_442284_+|GatB/YqeY-domain-containing-protein	gnl|CDD|370480	pfam09424, YqeY, Yqey-like protein. The function of this domain found in the YqeY protein is uncertain.	9.29285e-57
NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl|CDD|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	4.58034e-132
NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl|CDD|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	8.31162e-76
NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3	gnl|CDD|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	2.88825e-83
NZ_CP006803.1|WP_095669560.1|421207_421423_+|hypothetical-protein	gnl|CDD|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	1.74157e-12
NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl|CDD|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	2.3796e-39
NZ_CP006803.1|WP_095669573.1|438054_438816_+|SGNH/GDSL-hydrolase-family-protein	gnl|CDD|238141	cd00229, SGNH_hydrolase, SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.	1.22749e-13
NZ_CP006803.1|WP_003647182.1|442314_443274_+|PhoH-family-protein	gnl|CDD|224616	COG1702, PhoH, Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms].	6.05412e-137
NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl|CDD|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	4.8378e-56
NZ_CP006803.1|WP_003647180.1|441561_441738_+|30S-ribosomal-protein-S21	gnl|CDD|234707	PRK00270, rpsU, 30S ribosomal protein S21; Reviewed.	5.64518e-15

Protein sequences

>NZ_CP006803.1|WP_095669569.1|433507_434395_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MIVITLSKTPNSLRGDLTKWCQEIQTGVYVGNLNAKVRELLWERIEKNIGGGEATMVYNTNNELGYTFRTNRKDKRVVDFDGIPFLMHINKPSDVVLGFSNAAKFHKVHRVSSSAKKIENQNELQNFVAIDLETTGLNSEKDRIISIAAVKYIKKNDPEVFYRLIKDIPEVPEHISKLTGLTTKKLRDSGVSLRDALIEFKKFVGSRLIVGYNLPFDMSFLENSIKKESLNSLENRAKDILPIVKRKNKFLEDYHLDTVLKKYDIENENPHHADSDAKSTWYLTKKLIEIKSLII
>NZ_CP006803.1|WP_095669568.1|432559_433498_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MQKKFGAKKPEIGELSKISDRVTFLYLEHAKLNRVDSAISVVDSQGTVYIPAAIISVLFLGPGVDVTHRAMELMGEAGMSVVWVGEEGVRQYAHGRALNHSSTLLQAQAKLVSNNRSRLKVARKMYQMRFPGIDVSNLTMQQLRGKEGARVRKVYQEQSQKTGVSWSRREYKVDDFEASTPINQALTAAHQALYGLSYSVIVALGASAGLGFVHTGHDLSFVYDFSDLYKAEYSIPIAFEVVKEYGKEDISTHTRYAMRDAFKDGRLIERMVKDLKYLLDVEDQTEVKAVMNLWDDKKGLQKFGVQYHELGE
>NZ_CP006803.1|WP_095669567.1|431909_432557_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLSRVEIDLKNRRKTYDLSHLGAYHNWVESCFPRYQDENNRPRNLWRIDVLNGRSYLLLLSTQKPNLEELSKYGVSGTAVTKEYDDFLNKLYLGEILRFRLTANPSRKISVPGQRQGRIMPHITIAQQKKWFLDRTDVNGFKVLEDQENYPQFDIVNREWKLLRHKGSGTARLSCVTFEGVLKITDLEKFKKAMIKGIGREKAYGMGLLTVIPM
>NZ_CP006803.1|WP_095669566.1|431186_431897_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKTLTLKLKAPLQAYGNEATFGRRTSNPYPTKSAVIGMIAAALGYDRRNSKIIDLNKLSFATRVDQPGKIMSDFQIVEYAKNANKKDKKLTYRDYLQDAIFMVAIGSENSDLINEIHYALRHPKFPLFLGRRSCPPAGPLEIEVFDNQNPLMVLQTMGWQAAEWYQKKHSNFKAEIVYDASLGSNDNFKFQLRDEVGSFDQRNRYHNYREVVSTYIPMKNETKWHAETMHDIMANI
>NZ_CP006803.1|WP_095669565.1|430084_431206_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTQENLYVDIHVLQTVPSSNINRDDTGAPKTAIYGGATRSRVSSQSWKKAVRDKFKEDRKRHDWLAGFRTKRSATLLAKELMKKDPSLSFDDAREKAKKVLSDMGLKFDKAKKNDKNKDKDYETKVLLFFSPGQLEKLAAYVLENDNFDKKEVKKILNDTQSLDLALFGRMVADDPELNVEAASQVAHAVSTHEVVSEFDFFTAVDDAKKSDESGSAMLSTLEYNSSTLYRYANVNMNELIHNLGKDLALIGLKEFIKDFVLSMPTGHQNSYANGTLPQYVLVTIRKDTPVNLVSAFEVPVQSNNGYVEKSVERLEEEFDNANIWVGEPVESFVNANSEIKTKDGERVKNINELLDSVSTVIAKRVEDEDANA
>NZ_CP006803.1|WP_157737913.1|429483_430080_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MKIDVKKDTARIIKKLHERDGNDKAILAAIRRSNSILSRQATIVWPMLFGFIKDKEFFSKTGMPNRQEKAVFTALRCYAVFEQGNDNERDREYINESSSSLFENLSFLRKDERLREALDRRVQAVLSSTNFESVSRSVVGLTKLVKANNAQASLNYPDLANDLYNFQFGYESSRKVAIKWGREYFSFNDQVNKESNED
>NZ_CP006803.1|WP_095669563.1|427755_429462_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MQKESFNLITDPWIQVLNQTGELKEVSLLEVFKNAAKYQRLAGEMQSQDLAILRLLVAILTTVYSRINENDKIYDGLELDERLHLVKVNRAPSYEQLKDTWHGLYKKKHFSNALFQYLKANSDKFDFFGDQPFYQVTKEVYDQVVPANKKVNIKNPKGTVDVKQINRTISESNNSPAIFSPRTSRMKNELNLSQLIRWIITYQSFTGVTDKTKITSKEKFSVSSGWLYGLNPVFAQGENLFQTLMLNLVFLDQYQEEKPVWEFDSSVDYIEFIKNQTESSKLSISFLYTVWSRILHLEWVDNKPIIFTAGLPKLDSTNLFQEPMTTWKHNDKEDDFYPATKHLNDLNKAMWRNFGQYVLTVSESNSQKAVETHEPELIKWLREIKRNEFLATDMSLTLKTVTLVSDGNATSQSPVAEINDNFKIRANVLFDESGKNYWPAIIEDMINMTQQAGKDFWIFANNISKLRGIDGSEFANNLTAEFYDTLNVPFLTWLASLRNDQERRDKVYEWETELKRIALGRAEEVLQNASPRDIIGRENSDQDEVNGLKNIFTIFNRYKLNVLIHING
>NZ_CP006803.1|WP_095669562.1|425000_427751_+|CRISPR-associated-helicase/endonuclease-Cas3
MVELTSAAKALWGKKTVHNDQELWLPLVAHLVDTKNVMQWLYEEWIGEGTKAIVRQNMTDEDAKKLVGFLGFFHDFGKATPAFQYKQSFPRHKDLDADIVENLTRAGFSLIRTDNRFFQRSPHPIAGEALLEFFGLNQSLGSIIGGHHGIPPQKDLSEIQFESYTSNIWGKDRDLKIQNEWKNVQKNIFQFGMSLCEYHDVKEMPDVNLNQAVILEGMLIMSDWLASSEYLNDSANIPLFPLISLDDDFDNLNMKDRYQKAINNWDLSDQWFPEEIMSVDKQYRLRFEFKPRPLQKEMSELISNAHDPGLIIIEAPTGIGKTELALTAAEQLAFKQGKTGLYMGLPTQATTNAMFTRVEKWLKNIAKEQQINPDIKLLQGKASFNKEYTSLQSTEHIYDNYYDDQEGNVVVNSWFSGKKSILSHFAVGTIDNLLLTALKQKHLFLRHLGFSNKVVIIDELHAYDSYMNSYLVKTIKWLGAYHVPVIALSATLPKVRRNDLLKAYLEGKYGCTKIEAYHDWKNNEGYPLISILDGNKLEQSNKFSTSNDEKRNINIIRFKGNEEEIINKALLEIENGGVAGIIVNTVKRAQDLARLVPEDTEALLLHSSFLSSDRENLEQELQKNVGKGAKRPKKMIVIGTQVLEQSLDIDFDVLFTDIAPIDLLIQRIGRLHRHNISRPPKLSTPTAYITGINSYGDYGKGNEYIYEKYLLMKTDHFLNGQLKVPEDVSHLVQDVYSTDTDSKIKDISEAKGKFNNHLLKSKQKAEIFQICDPKSPAQKNLFGWLNDIKTNVENDIYASACVRDIKETLEVVLLKKIDEEYFLLNGENIKEVTSEKIAGQAIRLPFAIIENASGHDKIDSTIRDLERGMQQLHTKWKNNIWLRGVLVLELDEQNTANLNGFLLKYSSKLGLIYEKE
>NZ_CP006803.1|WP_095669561.1|421660_422086_+|restriction-endonuclease
MSIYRNDDVLITDLMDRIDKLENQVTDLKKIYYKQSGESHSTFLYGCEVRGSDYLHLEDKVVPRLKENDPVLLIREADNKYDKNAISVATPAGLKLGYIPCEHNLIFSRLIDSGNLLFGRVKNFHWDGKNLELIIKVYLAN
>NZ_CP006803.1|WP_095669560.1|421207_421423_+|hypothetical-protein
MASNMRKAAKRTGLDYKIQARGGVKLGDNVNQINALMVGPHLKSEFDAIKTQVPDKIKVILIKPNYYSISI
>NZ_CP006803.1|WP_095669570.1|436060_436261_+|hypothetical-protein
MKVRYAGESFYSGLGLANGKVYVVLDKKGPFYRIIDDSGEDYLYSKTNPAPLDGNSKGGYWNIVEY
>NZ_CP006803.1|WP_095669571.1|436327_437512_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MPKLANDLSLTKNTRLNSLGPSKIRAFDAKASQIPGIIKLTIGEPDLNTPDHVKDAAIADIKANDSHYAPQAGKPELQDAISKYLNRSLNVKYDPTTEICVTVGATGALNDVFMSILNPGDKILVPTPVWALYFQLIKLTGAIPVQMDTSKDGFILTPEHLEKVLQNEGKGAKAIILTDPSNPTGRVYPEETLKALAEIITKYHLFSVTDEIYGELVYDNNVHHSLSQYIPERNILISGLSKAYAMTGWRLGYIAAPADIMKTIQKVNAFLVTSVTDNVQAAAIEALNNGQADPLESRKIYEDRLKFMKAGLEKLGFEMSAPQGAFYIFAKIPDAFGTDDEAFANELATKAKVGVTPGRYFGQGGQGYVRMSYASSTEQLKEALKRIAEFVKNI
>NZ_CP006803.1|WP_095669572.1|437619_438051_+|peptide-methionine-(R)-S-oxide-reductase-MsrB
MFNKEEALKKLNSEQYEVTQHAATEYPFTGKYDKFNQKGIYVDVVSGEPLFSSEDKYDAGCGWPSFTKPIEKLVYHRDQSHGMERTEVKSPLADSHLGHVFTDGPVDQGGLRYCINSAALKFIPYDKLEEEGYEEYKKLFKGR
>NZ_CP006803.1|WP_095669573.1|438054_438816_+|SGNH/GDSL-hydrolase-family-protein
MNFEEELYNLDVPEEHIPELLKFGKDNPEFLTKAIKAEGNAKKYSVAQTKMKPSDLINNQIAFLGSSVTYGAGALGESFVDYLSKKDNICAFKDAVSGTTLVDNDSNSYIGRIGRLPVLEKLTAFVLQLSTNDAIKGKEDLGKIAQDENFDKQTVTGAIEYILNYVKKNWNCPVLIFSNPKFDSEFYGQMVERVKELQNKWNFDFLNLWDDDAFNYNEKDRELYMLDPIHPTRAGYKLSWLPVIEEELLKIKK
>NZ_CP006803.1|WP_095669574.1|438961_439519_+|peptide-methionine-(S)-S-oxide-reductase-MsrA
MEATKSLDNTKESHYDTAIFAGGCFWCMVEPFDTYPGIVSVVSGYTGGHVENPSYEEVCTGTTGHVEAVEITFDPKIISYKKLVDIYWQVTDPTDAMGQFQDRGSQYQPIIFYNSPQQKKIAEESKRQLEDSHRFDEPIVTKIEPAEPFYPAEDYHQDFYKKDPLRYQIEEAGGRSQFIEKHWKK
>NZ_CP006803.1|WP_003647178.1|439615_440494_+|YitT-family-protein
MSQLEKLSRRHYLISKLSAAFLYALAVAVALNFFWGPGKIYASGITGFAQIIQSVSERFMPFTLSTSVMYFVLNIPLFILGWCKIGHRFTIFTIIAVLLGSIMMRVIAPIKITYDPIICALFGGVINGVGTGIALKSGISTGGLDVLGIILRKKTGKSFGQINIFFNLIIVICAGFVFGWTRALYTALNIFVNGRVIDAVYTQHQKMQVFIVTEHPKHIIEGIQRKMHRGITIFHDVEGAYSHTEKTVLMTIIDRYDMFDIYNIVIQSDPYAFMSVSEVDKVYGRFKEQKPV
>NZ_CP006803.1|WP_003647179.1|440569_441412_-|kinase/pyrophosphorylase
MTEEKKENQKIVNLIIISDSVGDTAFNMVQAGAVQYPDVKFNYRRYPFITNREKLEKVFNEITEFENVLIAFTLIHEDEQLAAIKFAREHNMKYVDLLSGVIENIHSLTGEEPKHEIGAVHHMGQNYFDRISAMEFAVMYDDGKDPKGFLEADVVLLGVSRTSKTPLSLFLANKNLKVANLPLVPQTHIPDEIYKVDPKKIIGLTNDPSVLNEIRRQRMIAYGLNPDTTYSNMDSINAELDAANKLYKKLGCYVINVAHRSIEETAALIMEHLGIDDYAK
>NZ_CP006803.1|WP_003647180.1|441561_441738_+|30S-ribosomal-protein-S21
MAKTIVHENESIDDALRRFKRSVSRSGTLQEYRKREFYEKPSVKRKLKSEAARKRRHY
>NZ_CP006803.1|WP_049149059.1|441840_442284_+|GatB/YqeY-domain-containing-protein
MSLNDTLMQDMKAAMKAKDKEALTTIRSLKAAVMNYKIKVGHDLTSDDELTVLSSALKQRKESLEEFTKAGRDDLIDQTKKEMQLIEKYMPKQMSKEELEQTVEETIKEVGASSKKDFGKVMQALMPKIKGKADGKAASSIVGKKLN
>NZ_CP006803.1|WP_003647182.1|442314_443274_+|PhoH-family-protein
MGQTVEATFTPTKPETIMNLVGINDANLRLIEESYDVQVTDTGSEIEVTGEESLVKKIMQIFTALDKVVTRGVTITATDVVSAIKMADKGTLEFFGELYNKILIRDAKGRPVRVKNMGQKRYIEAIQKYDVVFGIGPAGTGKTFLAVVMAIAAFKKGEVSRIILTRPAVEAGESLGFLPGDLKEKVDPYLRPIYDSLYAILGVETTNRLMERGVIEVAPLAYMRGRTLDDAFVILDEAQNTTQAQMKMFLTRLGFNSKMVVNGDQTQIDLPGKAKSGLLQAEHILANIEQVKFINFTFNDVVRHPVVAKIVRAYEKEGH

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP006803_1	1.1|420725|30|NZ_CP006803|PILER-CR,CRT	420725-420754	30	MN830256	Lactobacillus phage JNU_P7, complete genome	26931-26960	0	1.0
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	MN830257	Lactobacillus phage JNU_P11, complete genome	3440-3469	0	1.0
NZ_CP006803_3	3.3|423983|33|NZ_CP006803|PILER-CR,CRT	423983-424015	33	DQ320509	Lactobacillus phage KC5a, complete genome	24551-24583	0	1.0
NZ_CP006803_3	3.13|424594|33|NZ_CP006803|CRT	424594-424626	33	AF495798	Lactobacillus helveticus phage f-0303 endolysin gene, complete cds	535-567	0	1.0
NZ_CP006803_4	4.1|434481|30|NZ_CP006803|PILER-CR	434481-434510	30	MN830257	Lactobacillus phage JNU_P11, complete genome	19247-19276	0	1.0
NZ_CP006803_4	4.3|434480|32|NZ_CP006803|CRISPRCasFinder,CRT	434480-434511	32	MN830257	Lactobacillus phage JNU_P11, complete genome	19246-19277	0	1.0
NZ_CP006803_4	4.6|434663|32|NZ_CP006803|CRISPRCasFinder,CRT	434663-434694	32	NC_010179	Lactobacillus johnsonii prophage Lj771, complete genome	4747-4778	0	1.0
NZ_CP006803_4	4.13|435090|32|NZ_CP006803|CRISPRCasFinder,CRT	435090-435121	32	AJ131519	Lactobacillus bacteriophage phi adh complete genome	1092-1123	0	1.0
NZ_CP006803_4	4.13|435090|32|NZ_CP006803|CRISPRCasFinder,CRT	435090-435121	32	NC_000896	Lactobacillus prophage phiadh, complete genome	1092-1123	0	1.0
NZ_CP006803_4	4.13|435090|32|NZ_CP006803|CRISPRCasFinder,CRT	435090-435121	32	M62697	Bacteriophage adh repeat region and integrase (intG) gene, complete cds	603-634	0	1.0
NZ_CP006803_4	4.14|435151|32|NZ_CP006803|CRISPRCasFinder,CRT	435151-435182	32	AJ131519	Lactobacillus bacteriophage phi adh complete genome	41559-41590	0	1.0
NZ_CP006803_4	4.14|435151|32|NZ_CP006803|CRISPRCasFinder,CRT	435151-435182	32	NC_000896	Lactobacillus prophage phiadh, complete genome	41559-41590	0	1.0
NZ_CP006803_4	4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT	435579-435610	32	MN830257	Lactobacillus phage JNU_P11, complete genome	4028-4059	0	1.0
NZ_CP006803_4	4.22|435640|32|NZ_CP006803|CRISPRCasFinder,CRT	435640-435671	32	NC_024206	Lactobacillus phage phi jlb1, complete genome	6505-6536	0	1.0
NZ_CP006803_4	4.22|435640|32|NZ_CP006803|CRISPRCasFinder,CRT	435640-435671	32	DQ320509	Lactobacillus phage KC5a, complete genome	6366-6397	0	1.0
NZ_CP006803_4	4.23|435701|32|NZ_CP006803|CRISPRCasFinder,CRT	435701-435732	32	MN830257	Lactobacillus phage JNU_P11, complete genome	414-445	0	1.0
NZ_CP006803_4	4.34|435089|33|NZ_CP006803|PILER-CR	435089-435121	33	AJ131519	Lactobacillus bacteriophage phi adh complete genome	1092-1124	0	1.0
NZ_CP006803_4	4.34|435089|33|NZ_CP006803|PILER-CR	435089-435121	33	NC_000896	Lactobacillus prophage phiadh, complete genome	1092-1124	0	1.0
NZ_CP006803_4	4.34|435089|33|NZ_CP006803|PILER-CR	435089-435121	33	M62697	Bacteriophage adh repeat region and integrase (intG) gene, complete cds	602-634	0	1.0
NZ_CP006803_4	4.35|435150|33|NZ_CP006803|PILER-CR	435150-435182	33	AJ131519	Lactobacillus bacteriophage phi adh complete genome	41559-41591	0	1.0
NZ_CP006803_4	4.35|435150|33|NZ_CP006803|PILER-CR	435150-435182	33	NC_000896	Lactobacillus prophage phiadh, complete genome	41559-41591	0	1.0
NZ_CP006803_4	4.42|435578|33|NZ_CP006803|PILER-CR	435578-435610	33	MN830257	Lactobacillus phage JNU_P11, complete genome	4028-4060	0	1.0
NZ_CP006803_4	4.43|435639|33|NZ_CP006803|PILER-CR	435639-435671	33	NC_024206	Lactobacillus phage phi jlb1, complete genome	6504-6536	0	1.0
NZ_CP006803_4	4.43|435639|33|NZ_CP006803|PILER-CR	435639-435671	33	DQ320509	Lactobacillus phage KC5a, complete genome	6365-6397	0	1.0
NZ_CP006803_4	4.44|435700|33|NZ_CP006803|PILER-CR	435700-435732	33	MN830257	Lactobacillus phage JNU_P11, complete genome	413-445	0	1.0
NZ_CP006803_3	3.2|423922|33|NZ_CP006803|PILER-CR,CRT	423922-423954	33	NC_024206	Lactobacillus phage phi jlb1, complete genome	30359-30391	1	0.97
NZ_CP006803_3	3.2|423922|33|NZ_CP006803|PILER-CR,CRT	423922-423954	33	DQ320509	Lactobacillus phage KC5a, complete genome	30483-30515	1	0.97
NZ_CP006803_3	3.3|423983|33|NZ_CP006803|PILER-CR,CRT	423983-424015	33	NC_010179	Lactobacillus johnsonii prophage Lj771, complete genome	26259-26291	1	0.97
NZ_CP006803_3	3.3|423983|33|NZ_CP006803|PILER-CR,CRT	423983-424015	33	NC_024206	Lactobacillus phage phi jlb1, complete genome	24571-24603	1	0.97
NZ_CP006803_4	4.12|435029|32|NZ_CP006803|CRISPRCasFinder,CRT	435029-435060	32	AJ131519	Lactobacillus bacteriophage phi adh complete genome	43102-43133	1	0.969
NZ_CP006803_4	4.12|435029|32|NZ_CP006803|CRISPRCasFinder,CRT	435029-435060	32	NC_000896	Lactobacillus prophage phiadh, complete genome	43102-43133	1	0.969
NZ_CP006803_4	4.22|435640|32|NZ_CP006803|CRISPRCasFinder,CRT	435640-435671	32	MN830257	Lactobacillus phage JNU_P11, complete genome	15517-15548	1	0.969
NZ_CP006803_4	4.22|435640|32|NZ_CP006803|CRISPRCasFinder,CRT	435640-435671	32	NC_010179	Lactobacillus johnsonii prophage Lj771, complete genome	6792-6823	1	0.969
NZ_CP006803_4	4.22|435640|32|NZ_CP006803|CRISPRCasFinder,CRT	435640-435671	32	MN830256	Lactobacillus phage JNU_P7, complete genome	29776-29807	1	0.969
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	MN830257	Lactobacillus phage JNU_P11, complete genome	30383-30414	1	0.969
NZ_CP006803_4	4.33|435028|33|NZ_CP006803|PILER-CR	435028-435060	33	AJ131519	Lactobacillus bacteriophage phi adh complete genome	43102-43134	1	0.97
NZ_CP006803_4	4.33|435028|33|NZ_CP006803|PILER-CR	435028-435060	33	NC_000896	Lactobacillus prophage phiadh, complete genome	43102-43134	1	0.97
NZ_CP006803_4	4.43|435639|33|NZ_CP006803|PILER-CR	435639-435671	33	MN830257	Lactobacillus phage JNU_P11, complete genome	15517-15549	1	0.97
NZ_CP006803_4	4.43|435639|33|NZ_CP006803|PILER-CR	435639-435671	33	MN830256	Lactobacillus phage JNU_P7, complete genome	29775-29807	1	0.97
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	MN830257	Lactobacillus phage JNU_P11, complete genome	30383-30415	1	0.97
NZ_CP006803_3	3.5|424105|33|NZ_CP006803|PILER-CR,CRT	424105-424137	33	NC_019782	Lactobacillus phage AQ113, complete genome	22112-22144	2	0.939
NZ_CP006803_3	3.13|424594|33|NZ_CP006803|CRT	424594-424626	33	AJ131519	Lactobacillus bacteriophage phi adh complete genome	42494-42526	2	0.939
NZ_CP006803_3	3.13|424594|33|NZ_CP006803|CRT	424594-424626	33	NC_000896	Lactobacillus prophage phiadh, complete genome	42494-42526	2	0.939
NZ_CP006803_4	4.43|435639|33|NZ_CP006803|PILER-CR	435639-435671	33	NC_010179	Lactobacillus johnsonii prophage Lj771, complete genome	6791-6823	2	0.939
NZ_CP006803_2	2.14|422600|31|NZ_CP006803|CRT	422600-422630	31	MN830256	Lactobacillus phage JNU_P7, complete genome	33727-33757	3	0.903
NZ_CP006803_3	3.5|424105|33|NZ_CP006803|PILER-CR,CRT	424105-424137	33	MN830257	Lactobacillus phage JNU_P11, complete genome	24007-24039	3	0.909
NZ_CP006803_2	2.5|422478|31|NZ_CP006803|PILER-CR,CRT	422478-422508	31	CP024783	Lactobacillus johnsonii pf01 plasmid pLJPF01S, complete sequence	13595-13625	4	0.871
NZ_CP006803_2	2.10|422477|32|NZ_CP006803|CRISPRCasFinder	422477-422508	32	CP024783	Lactobacillus johnsonii pf01 plasmid pLJPF01S, complete sequence	13594-13625	4	0.875
NZ_CP006803_2	2.12|422599|32|NZ_CP006803|CRISPRCasFinder	422599-422630	32	MN830256	Lactobacillus phage JNU_P7, complete genome	33727-33758	4	0.875
NZ_CP006803_4	4.1|434481|30|NZ_CP006803|PILER-CR	434481-434510	30	KC847113	Bacillus phage PBP180, complete sequence	310-339	5	0.833
NZ_CP006803_1	1.1|420725|30|NZ_CP006803|PILER-CR,CRT	420725-420754	30	NZ_CP019242	Rhodoferax antarcticus strain DSMZ24876 plasmid unnamed2	76016-76045	6	0.8
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	AP014387	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S44-C19, *** SEQUENCING IN PROGRESS ***	16603-16635	6	0.818
NZ_CP006803_4	4.1|434481|30|NZ_CP006803|PILER-CR	434481-434510	30	NZ_CP014853	Bacillus thuringiensis strain HD12 plasmid pHD120345, complete sequence	57988-58017	6	0.8
NZ_CP006803_4	4.1|434481|30|NZ_CP006803|PILER-CR	434481-434510	30	NC_018486	Bacillus thuringiensis HD-771 plasmid p01, complete sequence	38991-39020	6	0.8
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	NC_017261	Buchnera aphidicola str. Ua (Uroleucon ambrosiae) plasmid pLeu, complete sequence	2773-2804	6	0.812
NZ_CP006803_4	4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT	435579-435610	32	NC_014023	Bacillus megaterium QM B1551 plasmid pBM700, complete sequence	26029-26060	6	0.812
NZ_CP006803_4	4.23|435701|32|NZ_CP006803|CRISPRCasFinder,CRT	435701-435732	32	MK075001	Staphylococcus phage phiSP15-1, complete genome	33430-33461	6	0.812
NZ_CP006803_4	4.25|435823|32|NZ_CP006803|CRISPRCasFinder,CRT	435823-435854	32	NC_019765	Stanieria cyanosphaera PCC 7437 plasmid pSTA7437.01, complete sequence	240692-240723	6	0.812
NZ_CP006803_1	1.2|420791|30|NZ_CP006803|PILER-CR,CRT	420791-420820	30	NC_009231	Clostridium phage phiC2, complete genome	22314-22343	7	0.767
NZ_CP006803_1	1.2|420791|30|NZ_CP006803|PILER-CR,CRT	420791-420820	30	NC_011398	Clostridium phage phiCD27, complete genome	23516-23545	7	0.767
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	AP013434	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-U-MedDCM-OCT-S32-C65	24781-24810	7	0.767
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	MN693045	Marine virus AFVG_25M135, complete genome	8966-8995	7	0.767
NZ_CP006803_2	2.5|422478|31|NZ_CP006803|PILER-CR,CRT	422478-422508	31	MN693010	Marine virus AFVG_117M73, complete genome	20844-20874	7	0.774
NZ_CP006803_2	2.5|422478|31|NZ_CP006803|PILER-CR,CRT	422478-422508	31	MN694652	Marine virus AFVG_250M647, complete genome	18146-18176	7	0.774
NZ_CP006803_4	4.3|434480|32|NZ_CP006803|CRISPRCasFinder,CRT	434480-434511	32	KC847113	Bacillus phage PBP180, complete sequence	309-340	7	0.781
NZ_CP006803_4	4.6|434663|32|NZ_CP006803|CRISPRCasFinder,CRT	434663-434694	32	NZ_CP053834	Arcobacter cloacae strain LMG 26153 plasmid pACLO, complete sequence	155765-155796	7	0.781
NZ_CP006803_4	4.10|434907|32|NZ_CP006803|CRISPRCasFinder,CRT	434907-434938	32	MN694694	Marine virus AFVG_250M960, complete genome	35425-35456	7	0.781
NZ_CP006803_4	4.14|435151|32|NZ_CP006803|CRISPRCasFinder,CRT	435151-435182	32	NZ_CP016589	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence	475037-475068	7	0.781
NZ_CP006803_4	4.18|435396|32|NZ_CP006803|CRISPRCasFinder,CRT	435396-435427	32	NZ_AP017918	Candidatus Azobacteroides pseudotrichonymphae plasmid pAPPJ4 DNA, complete sequence, phylotype ProJPt-1	6972-7003	7	0.781
NZ_CP006803_4	4.19|435457|32|NZ_CP006803|CRISPRCasFinder,CRT	435457-435488	32	AP014398	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S46-C79, *** SEQUENCING IN PROGRESS ***	8865-8896	7	0.781
NZ_CP006803_4	4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT	435579-435610	32	MN693415	Marine virus AFVG_25M102, complete genome	27517-27548	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	43405-43436	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_KX839207	Klebsiella pneumoniae strain KP1814 plasmid pKP1814-1, complete sequence	100139-100170	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	313376-313407	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_CP025467	Klebsiella pneumoniae strain JS187 plasmid p187-1, complete sequence	235148-235179	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	11389-11420	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	212790-212821	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	184962-184993	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	43947-43978	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	262488-262519	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	178923-178954	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_CP038277	Raoultella ornithinolytica strain WLK218 plasmid pWLK-238550, complete sequence	227506-227537	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_CP024641	Klebsiella michiganensis strain F107 plasmid unnamed1, complete sequence	275173-275204	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	CP027603	UNVERIFIED_ORG: Klebsiella pneumoniae strain AR_0080 plasmid unnamed, complete sequence	77559-77590	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	43866-43897	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	124270-124301	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	281393-281424	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_MF344561	Klebsiella pneumoniae strain 11219 plasmid p11219-IMP, complete sequence	45013-45044	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	43619-43650	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	46167-46198	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_MF344567	Klebsiella pneumoniae strain A708 plasmid pA708-IMP, complete sequence	43947-43978	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	43858-43889	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	45013-45044	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_CP026369	Klebsiella quasipneumoniae strain A708 plasmid pA708-1, complete sequence	77058-77089	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NZ_CP028952	Klebsiella aerogenes strain AR_0161 plasmid unnamed, complete sequence	429979-430010	7	0.781
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	216796-216827	7	0.781
NZ_CP006803_1	1.1|420725|30|NZ_CP006803|PILER-CR,CRT	420725-420754	30	NZ_CP037921	Hymenobacter sp. 17J36-26 plasmid unnamed1, complete sequence	137641-137670	8	0.733
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	NZ_CP024108	Bacillus cytotoxicus strain CH_15 plasmid pCh15_83, complete sequence	23387-23416	8	0.733
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	NZ_CP024100	Bacillus cytotoxicus strain CH_38 plasmid pCh38_83, complete sequence	2689-2718	8	0.733
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	NZ_CP024122	Bacillus cytotoxicus strain CH_1 plasmid pCh1_67, complete sequence	9245-9274	8	0.733
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	NZ_CP024115	Bacillus cytotoxicus strain CH_3 plasmid pCh3_83, complete sequence	10352-10381	8	0.733
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	NZ_CP024110	Bacillus cytotoxicus strain CH_13 plasmid pCh13_79, complete sequence	2022-2051	8	0.733
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	NZ_CP024106	Bacillus cytotoxicus strain CH_23 plasmid pCh23_67, complete sequence	26573-26602	8	0.733
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	NZ_CP024118	Bacillus cytotoxicus strain CH_2 plasmid pCh2_83, complete sequence	8038-8067	8	0.733
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	NZ_CP024097	Bacillus cytotoxicus strain CH_39 plasmid pCh39_83, complete sequence	27547-27576	8	0.733
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	NZ_CP024103	Bacillus cytotoxicus strain CH_25 plasmid pCh25_67, complete sequence	64075-64104	8	0.733
NZ_CP006803_2	2.3|422356|31|NZ_CP006803|PILER-CR,CRT	422356-422386	31	MN693509	Marine virus AFVG_25M367, complete genome	31248-31278	8	0.742
NZ_CP006803_2	2.5|422478|31|NZ_CP006803|PILER-CR,CRT	422478-422508	31	NZ_CP039262	Lactobacillus johnsonii strain DC22.2 plasmid pLjDC22.2_1, complete sequence	2870-2900	8	0.742
NZ_CP006803_2	2.8|422355|32|NZ_CP006803|CRISPRCasFinder	422355-422386	32	NZ_CP031446	Acinetobacter baumannii strain MDR-UNC plasmid pAB120, complete sequence	649-680	8	0.75
NZ_CP006803_2	2.8|422355|32|NZ_CP006803|CRISPRCasFinder	422355-422386	32	NZ_KY704308	Acinetobacter baumannii strain IHIT32296 plasmid pAbIHIT32296, complete sequence	1912-1943	8	0.75
NZ_CP006803_2	2.8|422355|32|NZ_CP006803|CRISPRCasFinder	422355-422386	32	NZ_CP034097	Acinetobacter baumannii strain A52 plasmid pA52-OXA-72, complete sequence	7487-7518	8	0.75
NZ_CP006803_2	2.8|422355|32|NZ_CP006803|CRISPRCasFinder	422355-422386	32	NZ_CP033871	Acinetobacter baumannii strain MRSN15313 plasmid p597A-14.8, complete sequence	6938-6969	8	0.75
NZ_CP006803_2	2.8|422355|32|NZ_CP006803|CRISPRCasFinder	422355-422386	32	NZ_CP043954	Acinetobacter baumannii strain K09-14 plasmid pK09-14, complete sequence	367-398	8	0.75
NZ_CP006803_2	2.8|422355|32|NZ_CP006803|CRISPRCasFinder	422355-422386	32	MN461227	Acinetobacter pittii strain A352 plasmid pA352, complete sequence	1299-1330	8	0.75
NZ_CP006803_2	2.8|422355|32|NZ_CP006803|CRISPRCasFinder	422355-422386	32	MN481287	Acinetobacter pittii strain A32949 plasmid pA2949, complete sequence	1299-1330	8	0.75
NZ_CP006803_2	2.8|422355|32|NZ_CP006803|CRISPRCasFinder	422355-422386	32	NZ_CP049809	Acinetobacter pittii strain A1254 plasmid pA1254_3, complete sequence	361-392	8	0.75
NZ_CP006803_2	2.8|422355|32|NZ_CP006803|CRISPRCasFinder	422355-422386	32	NC_019359	Acinetobacter baumannii plasmid pAB120, complete sequence	10200-10231	8	0.75
NZ_CP006803_2	2.9|422416|32|NZ_CP006803|CRISPRCasFinder	422416-422447	32	NZ_CP024264	Escherichia coli O169:H41 strain F6326-C1 plasmid unnamed1	29044-29075	8	0.75
NZ_CP006803_2	2.9|422416|32|NZ_CP006803|CRISPRCasFinder	422416-422447	32	NZ_CP031294	Escherichia coli strain EC17GD31 plasmid pGD31-F25, complete sequence	8347-8378	8	0.75
NZ_CP006803_2	2.9|422416|32|NZ_CP006803|CRISPRCasFinder	422416-422447	32	NZ_CP029421	Escherichia coli strain 3385 plasmid unnamed1, complete sequence	56992-57023	8	0.75
NZ_CP006803_2	2.10|422477|32|NZ_CP006803|CRISPRCasFinder	422477-422508	32	NZ_CP039262	Lactobacillus johnsonii strain DC22.2 plasmid pLjDC22.2_1, complete sequence	2870-2901	8	0.75
NZ_CP006803_2	2.10|422477|32|NZ_CP006803|CRISPRCasFinder	422477-422508	32	MN693010	Marine virus AFVG_117M73, complete genome	20843-20874	8	0.75
NZ_CP006803_2	2.10|422477|32|NZ_CP006803|CRISPRCasFinder	422477-422508	32	MN694652	Marine virus AFVG_250M647, complete genome	18146-18177	8	0.75
NZ_CP006803_4	4.3|434480|32|NZ_CP006803|CRISPRCasFinder,CRT	434480-434511	32	NZ_CP014853	Bacillus thuringiensis strain HD12 plasmid pHD120345, complete sequence	57987-58018	8	0.75
NZ_CP006803_4	4.3|434480|32|NZ_CP006803|CRISPRCasFinder,CRT	434480-434511	32	NC_018486	Bacillus thuringiensis HD-771 plasmid p01, complete sequence	38990-39021	8	0.75
NZ_CP006803_4	4.5|434602|32|NZ_CP006803|CRISPRCasFinder,CRT	434602-434633	32	MN871445	UNVERIFIED: Serratia phage KpHz_2, complete genome	199457-199488	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	NZ_LR134420	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 11	22980-23011	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	NC_049481	Lactococcus phage CHPC361, complete genome	27647-27678	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	JQ740813	Lactococcus Phage ASCC532, complete genome	29634-29665	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	AY249139	Lactococcus phage bIL66M1 E15 (e15) gene, partial cds; and E14 (e14), E13 (e13), E12 (e12), E11 (e11), E10 (e10), E9 (e9), E8 (e8), E7 (e7), E6 (e6), E5 (e5), E4 (e4), E3 (e3), E2 (e2), and E1 (e1) genes, complete cds	5071-5102	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	MK301437	Lactococcus phage 1W08F, complete genome	27875-27906	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	KP793108	Lactococcus phage 936 group phage Phi5.12, complete genome	26944-26975	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	NC_001909	Lactococcus phage bIL170, complete genome	29186-29217	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	MF346933	Lactococcus phage vB_Llc_bIBBF14, complete genome	27188-27219	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	NC_049348	Lactococcus lactis phage p272, complete genome	27860-27891	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	MG253650	Lactococcus phage vB_Llc_bIBB77s, complete genome	26762-26793	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	NC_049352	Lactococcus phage phi15, complete genome	29736-29767	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	JQ740790	Lactococcus Phage ASCC284, complete genome	30299-30330	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	MN689522	Lactococcus phage CHPC958, complete genome	29406-29437	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	NC_049426	Lactococcus phage vB_Llc_bIBBF12, complete genome	27122-27153	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	MG253648	Lactococcus phage vB_Llc_bIBB14s, complete genome	27209-27240	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	JQ740792	Lactococcus Phage ASCC310, complete genome	29678-29709	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	NC_049486	Lactococcus phage CHPC959, complete genome	26275-26306	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	AF009630	Bacteriophage bIL170, complete genome	29186-29217	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	KC182548	Lactococcus lactis phage P113G, complete genome	27889-27920	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	JQ740795	Lactococcus Phage ASCC356, complete genome	29677-29708	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	NC_049482	Lactococcus phage CHPC362, complete genome	24878-24909	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	NC_049363	Lactococcus phage 936 group phage Phi44, complete genome	29127-29158	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	KP793115	Lactococcus phage 936 group phage Phi114, complete genome	28280-28311	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	MG253653	Lactococcus phage vB_Llc_bIBBF13, complete genome	26706-26737	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	NZ_CP024791	Nostoc flagelliforme CCNUN1 plasmid pNFSY06, complete sequence	222296-222327	8	0.75
NZ_CP006803_4	4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT	434846-434877	32	CP040041	Acinetobacter baumannii strain VB958 plasmid unnamed1, complete sequence	230168-230199	8	0.75
NZ_CP006803_4	4.14|435151|32|NZ_CP006803|CRISPRCasFinder,CRT	435151-435182	32	MN693596	Marine virus AFVG_25M324, complete genome	45304-45335	8	0.75
NZ_CP006803_4	4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT	435212-435243	32	NC_022051	Listeria monocytogenes strain J1926 plasmid, complete sequence	1617-1648	8	0.75
NZ_CP006803_4	4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT	435212-435243	32	CP044433	Listeria monocytogenes strain FDA00009448 plasmid pCFSAN038814, complete sequence	46318-46349	8	0.75
NZ_CP006803_4	4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT	435212-435243	32	CP044431	Listeria monocytogenes strain FDA00006667 plasmid pCFSAN038814, complete sequence	28106-28137	8	0.75
NZ_CP006803_4	4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT	435212-435243	32	NC_022046	Listeria monocytogenes strain J1776 plasmid, complete sequence	1553-1584	8	0.75
NZ_CP006803_4	4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT	435212-435243	32	NC_022047	Listeria monocytogenes strain J1817 plasmid, complete sequence	6348-6379	8	0.75
NZ_CP006803_4	4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT	435212-435243	32	NZ_CP053631	Listeria monocytogenes strain OB040119 plasmid pOB040119, complete sequence	36338-36369	8	0.75
NZ_CP006803_4	4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT	435212-435243	32	NZ_CP053629	Listeria monocytogenes strain OB030029 plasmid pOB030029, complete sequence	36338-36369	8	0.75
NZ_CP006803_4	4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT	435212-435243	32	NZ_CP053633	Listeria monocytogenes strain OB050226 plasmid pOB050226, complete sequence	36334-36365	8	0.75
NZ_CP006803_4	4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT	435212-435243	32	NZ_CP014254	Listeria monocytogenes strain CFSAN023459 plasmid CFSAN023459_02, complete sequence	31027-31058	8	0.75
NZ_CP006803_4	4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT	435212-435243	32	NZ_CP009691	Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence	277272-277303	8	0.75
NZ_CP006803_4	4.19|435457|32|NZ_CP006803|CRISPRCasFinder,CRT	435457-435488	32	NZ_CP016846	Carnobacterium maltaromaticum strain TMW 2.1581 plasmid pL21581-2, complete sequence	30281-30312	8	0.75
NZ_CP006803_4	4.19|435457|32|NZ_CP006803|CRISPRCasFinder,CRT	435457-435488	32	NZ_CP013615	Clostridium perfringens strain JP838 plasmid pJFP838A, complete sequence	233728-233759	8	0.75
NZ_CP006803_4	4.19|435457|32|NZ_CP006803|CRISPRCasFinder,CRT	435457-435488	32	MT559528	UNVERIFIED: Klebsiella phage vB_KpnP_cmc20193, complete genome	4146-4177	8	0.75
NZ_CP006803_4	4.19|435457|32|NZ_CP006803|CRISPRCasFinder,CRT	435457-435488	32	MK521906	Klebsiella phage vB_KpnM_FZ14, complete genome	34534-34565	8	0.75
NZ_CP006803_4	4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT	435579-435610	32	NZ_CP053812	Vibrio cholerae strain W6G plasmid pW6G, complete sequence	91274-91305	8	0.75
NZ_CP006803_4	4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT	435579-435610	32	NZ_CP053815	Vibrio cholerae strain W7G plasmid pW7G, complete sequence	47105-47136	8	0.75
NZ_CP006803_4	4.27|435945|32|NZ_CP006803|CRISPRCasFinder,CRT	435945-435976	32	NZ_CP046704	Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence	124269-124300	8	0.75
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	NC_049481	Lactococcus phage CHPC361, complete genome	27646-27678	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	JQ740813	Lactococcus Phage ASCC532, complete genome	29633-29665	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	AY249139	Lactococcus phage bIL66M1 E15 (e15) gene, partial cds; and E14 (e14), E13 (e13), E12 (e12), E11 (e11), E10 (e10), E9 (e9), E8 (e8), E7 (e7), E6 (e6), E5 (e5), E4 (e4), E3 (e3), E2 (e2), and E1 (e1) genes, complete cds	5070-5102	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	MK301437	Lactococcus phage 1W08F, complete genome	27874-27906	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	KP793108	Lactococcus phage 936 group phage Phi5.12, complete genome	26943-26975	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	NC_001909	Lactococcus phage bIL170, complete genome	29185-29217	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	MF346933	Lactococcus phage vB_Llc_bIBBF14, complete genome	27187-27219	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	NC_049348	Lactococcus lactis phage p272, complete genome	27859-27891	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	MG253650	Lactococcus phage vB_Llc_bIBB77s, complete genome	26761-26793	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	NC_049352	Lactococcus phage phi15, complete genome	29735-29767	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	JQ740790	Lactococcus Phage ASCC284, complete genome	30298-30330	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	MN689522	Lactococcus phage CHPC958, complete genome	29405-29437	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	NC_049426	Lactococcus phage vB_Llc_bIBBF12, complete genome	27121-27153	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	MG253648	Lactococcus phage vB_Llc_bIBB14s, complete genome	27208-27240	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	JQ740792	Lactococcus Phage ASCC310, complete genome	29677-29709	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	NC_049486	Lactococcus phage CHPC959, complete genome	26274-26306	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	AF009630	Bacteriophage bIL170, complete genome	29185-29217	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	KC182548	Lactococcus lactis phage P113G, complete genome	27888-27920	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	JQ740795	Lactococcus Phage ASCC356, complete genome	29676-29708	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	NC_049482	Lactococcus phage CHPC362, complete genome	24877-24909	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	NC_049363	Lactococcus phage 936 group phage Phi44, complete genome	29126-29158	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	KP793115	Lactococcus phage 936 group phage Phi114, complete genome	28279-28311	8	0.758
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	MG253653	Lactococcus phage vB_Llc_bIBBF13, complete genome	26705-26737	8	0.758
NZ_CP006803_4	4.40|435456|33|NZ_CP006803|PILER-CR	435456-435488	33	NZ_CP016846	Carnobacterium maltaromaticum strain TMW 2.1581 plasmid pL21581-2, complete sequence	30280-30312	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_KX839207	Klebsiella pneumoniae strain KP1814 plasmid pKP1814-1, complete sequence	100138-100170	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	313375-313407	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_CP019048	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence	11388-11420	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	184961-184993	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_CP024641	Klebsiella michiganensis strain F107 plasmid unnamed1, complete sequence	275172-275204	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_CP026369	Klebsiella quasipneumoniae strain A708 plasmid pA708-1, complete sequence	77057-77089	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_CP028952	Klebsiella aerogenes strain AR_0161 plasmid unnamed, complete sequence	429978-430010	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	216795-216827	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	43405-43437	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_CP025467	Klebsiella pneumoniae strain JS187 plasmid p187-1, complete sequence	235148-235180	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	212790-212822	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	KU318421	Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence	43947-43979	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NC_023911	Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence	262488-262520	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	178923-178955	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_CP038277	Raoultella ornithinolytica strain WLK218 plasmid pWLK-238550, complete sequence	227506-227538	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	CP027603	UNVERIFIED_ORG: Klebsiella pneumoniae strain AR_0080 plasmid unnamed, complete sequence	77559-77591	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	43866-43898	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	124270-124302	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_CP026019	Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence	281393-281425	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_MF344561	Klebsiella pneumoniae strain 11219 plasmid p11219-IMP, complete sequence	45013-45045	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_MF344566	Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence	43619-43651	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	46167-46199	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_MF344567	Klebsiella pneumoniae strain A708 plasmid pA708-IMP, complete sequence	43947-43979	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_MF344563	Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence	43858-43890	8	0.758
NZ_CP006803_4	4.45|435761|33|NZ_CP006803|PILER-CR	435761-435793	33	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	45013-45045	8	0.758
NZ_CP006803_1	1.1|420725|30|NZ_CP006803|PILER-CR,CRT	420725-420754	30	KT588075	Acinetobacter phage Ab105-2phi, complete genome	13193-13222	9	0.7
NZ_CP006803_1	1.1|420725|30|NZ_CP006803|PILER-CR,CRT	420725-420754	30	MT349887	Acinetobacter phage 5W, complete genome	37563-37592	9	0.7
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	MN693631	Marine virus AFVG_250M1143, complete genome	2615-2644	9	0.7
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	MN694579	Marine virus AFVG_250M1138, complete genome	3076-3105	9	0.7
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	MN694584	Marine virus AFVG_250M353, complete genome	38041-38070	9	0.7
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	MN694540	Marine virus AFVG_250M802, complete genome	37193-37222	9	0.7
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	AP014266	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S41-C121, *** SEQUENCING IN PROGRESS ***	17177-17206	9	0.7
NZ_CP006803_1	1.3|420857|30|NZ_CP006803|PILER-CR,CRT	420857-420886	30	MN693684	Marine virus AFVG_250M122, complete genome	37371-37400	9	0.7
NZ_CP006803_2	2.4|422417|31|NZ_CP006803|PILER-CR,CRT	422417-422447	31	NZ_CP024264	Escherichia coli O169:H41 strain F6326-C1 plasmid unnamed1	29044-29074	9	0.71
NZ_CP006803_2	2.4|422417|31|NZ_CP006803|PILER-CR,CRT	422417-422447	31	NZ_CP029421	Escherichia coli strain 3385 plasmid unnamed1, complete sequence	56992-57022	9	0.71
NZ_CP006803_2	2.4|422417|31|NZ_CP006803|PILER-CR,CRT	422417-422447	31	NZ_CP031294	Escherichia coli strain EC17GD31 plasmid pGD31-F25, complete sequence	8348-8378	9	0.71
NZ_CP006803_2	2.5|422478|31|NZ_CP006803|PILER-CR,CRT	422478-422508	31	NZ_CP043518	Lactococcus lactis subsp. lactis bv. diacetylactis strain SD96 plasmid pSD96_06, complete sequence	1034-1064	9	0.71
NZ_CP006803_2	2.10|422477|32|NZ_CP006803|CRISPRCasFinder	422477-422508	32	NZ_CP043518	Lactococcus lactis subsp. lactis bv. diacetylactis strain SD96 plasmid pSD96_06, complete sequence	1033-1064	9	0.719
NZ_CP006803_2	2.13|422539|31|NZ_CP006803|CRT	422539-422569	31	NZ_CP020540	Sphingobium herbicidovorans strain MH plasmid pSHV1, complete sequence	115792-115822	9	0.71
NZ_CP006803_3	3.11|424472|33|NZ_CP006803|PILER-CR,CRT	424472-424504	33	NZ_CP015341	Lactobacillus brevis strain 100D8 plasmid unnamed3, complete sequence	1301-1333	9	0.727
NZ_CP006803_4	4.1|434481|30|NZ_CP006803|PILER-CR	434481-434510	30	NC_030948	Ralstonia phage RSP15 DNA, complete genome	29165-29194	9	0.7
NZ_CP006803_4	4.6|434663|32|NZ_CP006803|CRISPRCasFinder,CRT	434663-434694	32	MN369743	Streptomyces phage Tribute, complete genome	38034-38065	9	0.719
NZ_CP006803_4	4.6|434663|32|NZ_CP006803|CRISPRCasFinder,CRT	434663-434694	32	MF358542	Streptomyces phage Sushi23, complete genome	38565-38596	9	0.719
NZ_CP006803_4	4.6|434663|32|NZ_CP006803|CRISPRCasFinder,CRT	434663-434694	32	MK494112	Streptomyces phage EGole, complete genome	39419-39450	9	0.719
NZ_CP006803_4	4.6|434663|32|NZ_CP006803|CRISPRCasFinder,CRT	434663-434694	32	NC_042011	Streptomyces phage Peebs, complete genome	38207-38238	9	0.719
NZ_CP006803_4	4.18|435396|32|NZ_CP006803|CRISPRCasFinder,CRT	435396-435427	32	LT615366	Enterococcus phage VPE25 genome assembly, chromosome: VPE25	35402-35433	9	0.719
NZ_CP006803_4	4.18|435396|32|NZ_CP006803|CRISPRCasFinder,CRT	435396-435427	32	LT546030	Enterococcus phage VPE25 genome assembly, chromosome: I	35402-35433	9	0.719
NZ_CP006803_4	4.18|435396|32|NZ_CP006803|CRISPRCasFinder,CRT	435396-435427	32	AP014199	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C74-MedDCM-OCT-S25-C34, *** SEQUENCING IN PROGRESS ***	10883-10914	9	0.719
NZ_CP006803_4	4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT	435579-435610	32	NC_049930	Enterococcus phage vB_EfaP_Zip, complete genome	224-255	9	0.719
NZ_CP006803_4	4.23|435701|32|NZ_CP006803|CRISPRCasFinder,CRT	435701-435732	32	MH617622	Inoviridae sp. isolate ctbd37, complete genome	1774-1805	9	0.719
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	MT939487	Erwinia phage pEa_SNUABM_47, complete genome	85965-85996	9	0.719
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	MT939486	Erwinia phage pEa_SNUABM_12, complete genome	86377-86408	9	0.719
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	NC_041917	Serratia phage BF, complete genome	86344-86375	9	0.719
NZ_CP006803_4	4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT	435762-435793	32	MT939488	Erwinia phage pEa_SNUABM_50, complete genome	85836-85867	9	0.719
NZ_CP006803_4	4.26|435884|32|NZ_CP006803|CRISPRCasFinder,CRT	435884-435915	32	NC_014841	Pantoea sp. At-9b plasmid pPAT9B04, complete sequence	12254-12285	9	0.719
NZ_CP006803_4	4.30|434845|33|NZ_CP006803|PILER-CR	434845-434877	33	NZ_LR134420	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 11	22980-23012	9	0.727
NZ_CP006803_4	4.35|435150|33|NZ_CP006803|PILER-CR	435150-435182	33	MN693596	Marine virus AFVG_25M324, complete genome	45303-45335	9	0.727
NZ_CP006803_4	4.36|435211|33|NZ_CP006803|PILER-CR	435211-435243	33	NC_022051	Listeria monocytogenes strain J1926 plasmid, complete sequence	1617-1649	9	0.727
NZ_CP006803_4	4.36|435211|33|NZ_CP006803|PILER-CR	435211-435243	33	CP044433	Listeria monocytogenes strain FDA00009448 plasmid pCFSAN038814, complete sequence	46317-46349	9	0.727
NZ_CP006803_4	4.36|435211|33|NZ_CP006803|PILER-CR	435211-435243	33	CP044431	Listeria monocytogenes strain FDA00006667 plasmid pCFSAN038814, complete sequence	28106-28138	9	0.727
NZ_CP006803_4	4.36|435211|33|NZ_CP006803|PILER-CR	435211-435243	33	NC_022046	Listeria monocytogenes strain J1776 plasmid, complete sequence	1553-1585	9	0.727
NZ_CP006803_4	4.36|435211|33|NZ_CP006803|PILER-CR	435211-435243	33	NC_022047	Listeria monocytogenes strain J1817 plasmid, complete sequence	6348-6380	9	0.727
NZ_CP006803_4	4.36|435211|33|NZ_CP006803|PILER-CR	435211-435243	33	NZ_CP053631	Listeria monocytogenes strain OB040119 plasmid pOB040119, complete sequence	36338-36370	9	0.727
NZ_CP006803_4	4.36|435211|33|NZ_CP006803|PILER-CR	435211-435243	33	NZ_CP053629	Listeria monocytogenes strain OB030029 plasmid pOB030029, complete sequence	36338-36370	9	0.727
NZ_CP006803_4	4.36|435211|33|NZ_CP006803|PILER-CR	435211-435243	33	NZ_CP053633	Listeria monocytogenes strain OB050226 plasmid pOB050226, complete sequence	36334-36366	9	0.727
NZ_CP006803_4	4.36|435211|33|NZ_CP006803|PILER-CR	435211-435243	33	NZ_CP014254	Listeria monocytogenes strain CFSAN023459 plasmid CFSAN023459_02, complete sequence	31027-31059	9	0.727
NZ_CP006803_2	2.11|422538|32|NZ_CP006803|CRISPRCasFinder	422538-422569	32	NZ_CP020540	Sphingobium herbicidovorans strain MH plasmid pSHV1, complete sequence	115792-115823	10	0.688
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP028168	Escherichia coli strain CFSAN064036 plasmid pGMI17-004_1, complete sequence	7383-7415	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MG569891	Shigella sonnei strain DE105 plasmid pDE105, complete sequence	21978-22010	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KU130396	Escherichia coli strain S68 plasmid pS68, complete sequence	113990-114022	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KT779550	Escherichia coli strain 369 plasmid p369, complete sequence	106006-106038	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KJ866866	Escherichia coli strain SKLX3330 plasmid pSKLX3330, complete sequence	16009-16041	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_020991	Shigella sonnei 10188 plasmid pKHSB1 complete sequence	52233-52265	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP010130	Escherichia coli strain C9 plasmid A, complete genome	28749-28781	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP042631	Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-4, complete sequence	21440-21472	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP010233	Escherichia coli strain S30 plasmid B, complete sequence	71575-71607	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP013193	Escherichia coli strain FORC_031 plasmid pFORC31.3, complete sequence	65727-65759	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP049350	Escherichia coli strain 3R plasmid p3R-2, complete sequence	77209-77241	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP043738	Escherichia coli strain CVM N17EC0616 plasmid pN17EC0616-2, complete sequence	83281-83313	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP020511	Escherichia coli strain 165 plasmid unnamed2, complete sequence	17872-17904	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP020547	Escherichia coli strain ZJ3920 plasmid pZJ3920-2, complete sequence	46072-46104	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP010317	Escherichia coli strain 789 plasmid pAPEC-O78-2	105185-105217	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP012627	Escherichia coli strain SF-468 plasmid pSF-468-2, complete sequence	25640-25672	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_LT838199	Escherichia coli isolate WI1 isolate plasmid pWI1-incI1, complete sequence	80791-80823	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP013221	Salmonella enterica subsp. enterica serovar Anatum strain GT-01 plasmid PDM02, complete sequence	111045-111077	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP041621	Shigella flexneri strain C32 plasmid pC32_2, complete sequence	76116-76148	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP015996	Escherichia coli strain S51 plasmid pS51_1, complete sequence	92982-93014	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP045189	Escherichia coli strain NT1F31 plasmid pNT1F31-96kb, complete sequence	64779-64811	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP024285	Escherichia albertii strain 2014C-4356 plasmid unnamed3, complete sequence	103419-103451	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP027327	Escherichia coli strain 2013C-4830 plasmid unnamed2, complete sequence	40255-40287	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP019248	Escherichia coli strain Combat13F7 plasmid pCombat13F7-3, complete sequence	2739-2771	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP019248	Escherichia coli strain Combat13F7 plasmid pCombat13F7-3, complete sequence	120385-120417	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP014966	Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2010K-1587 plasmid pSTY1-2010K-1587, complete sequence	118021-118053	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP049984	Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N40391 plasmid pN40391-1, complete sequence	7881-7913	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP049985	Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N40391 plasmid pN40391-2, complete sequence	5619-5651	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP049985	Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N40391 plasmid pN40391-2, complete sequence	9177-9209	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP053576	Salmonella enterica strain 2012K-0845 plasmid unnamed1, complete sequence	48827-48859	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP038347	Escherichia coli O157:H7 strain G5295 plasmid pG5295-2, complete sequence	55630-55662	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP045527	Shigella sonnei strain 6607.69 plasmid p6607-69, complete sequence	76557-76589	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP044137	Escherichia coli O157 strain AR-0430 plasmid pAR-0430-1, complete sequence	4511-4543	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP032264	Escherichia coli strain AR_0089 plasmid unnamed2, complete sequence	31794-31826	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP034251	Salmonella enterica subsp. enterica serovar Derby strain Sa64 plasmid pSa64T-188, complete sequence	148861-148893	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP053754	Shigella sonnei strain 506 plasmid pMHMC-003, complete sequence	23226-23258	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP031283	Escherichia fergusonii strain 40A plasmid p150_40A, complete sequence	74339-74371	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP050747	Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-2, complete sequence	86871-86903	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP022734	Escherichia coli strain SA186 plasmid pSA186_5, complete sequence	100955-100987	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP035469	Escherichia coli strain U12A plasmid pU12A_B, complete sequence	80464-80496	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	KU932029	Escherichia coli plasmid pEC15I_1, complete sequence	21703-21735	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	KU932030	Escherichia coli plasmid pEC15I_2, complete sequence	21703-21735	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_025176	Escherichia coli plasmid pH2291-112, complete sequence	57300-57332	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_023899	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTM7, complete sequence	40677-40709	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_023900	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTM2, complete sequence	42149-42181	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_025143	Escherichia coli plasmid pC59-112, complete sequence	34700-34732	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_025144	Escherichia coli plasmid pC49-108, complete sequence	12221-12253	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP027535	Escherichia coli strain AR_0081 plasmid unnamed1, complete sequence	22539-22571	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP009566	Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 plasmid pCVM22462, complete sequence	36754-36786	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_021811	Salmonella enterica subsp. enterica serovar Heidelberg str. 41578 plasmid pSEEH1578_01, complete sequence	109913-109945	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP048298	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-1, complete sequence	7880-7912	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP018975	Escherichia coli strain Ecol_545 plasmid pEC545_1, complete sequence	95489-95521	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP023365	Escherichia coli strain 144 plasmid p92, complete sequence	67809-67841	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN419430	Escherichia coli strain 2016-4017437 plasmid p17437, complete sequence	14823-14855	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN419431	Escherichia coli strain 2016-40-19138 plasmid p19138, complete sequence	20114-20146	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN419432	Escherichia coli strain 2016-40-21254 plasmid p21254, complete sequence	84242-84274	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN419433	Escherichia coli strain 2016-40-20426 plasmid p20426, complete sequence	43309-43341	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN419436	Escherichia coli strain 2016-40-22440 plasmid p22440, complete sequence	16728-16760	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN419437	Escherichia coli strain 2016-40-22638 plasmid p22638, complete sequence	10870-10902	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP035721	Escherichia coli strain U15A plasmid pU15A_A, complete sequence	80439-80471	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP029058	Escherichia coli strain FORC_081 plasmid pFORC_081_1, complete sequence	131200-131232	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP039604	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014868 plasmid p12-6919.1, complete sequence	59640-59672	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN125610	Salmonella enterica subsp. enterica serovar Enteritidis strain 1.11-3A7 plasmid pIncI1-CTX-M-14, complete sequence	36506-36538	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_021813	Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069 plasmid pCFSAN002069_01, complete sequence	5294-5326	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_019111	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal8934a, complete sequence	16018-16050	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP027135	Escherichia coli strain AR_0369 plasmid unnamed3	6014-6046	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP027135	Escherichia coli strain AR_0369 plasmid unnamed3	139722-139754	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP029975	Escherichia coli strain 51008369SK1 plasmid p51008369SK1_B, complete sequence	106304-106336	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP043228	Escherichia coli strain Ec-050 plasmid pEc-050-TEM-30, complete sequence	80858-80890	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MH884650	Salmonella sp. strain Sa21 plasmid pSa21-HP, complete sequence	84724-84756	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MH884651	Salmonella sp. strain Sa21 plasmid pSa21-TC-CIP, complete sequence	111673-111705	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP019905	Escherichia coli strain MDR_56 plasmid unnamed6, complete sequence	93213-93245	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MN241905	Salmonella enterica subsp. enterica serovar Typhimurium strain STM3224 plasmid pUY_STM96, complete sequence	16116-16148	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MK070495	Escherichia coli strain MB6212 plasmid pMB5876, complete sequence	18888-18920	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP027127	Escherichia coli strain AR_0374 plasmid unnamed2	58317-58349	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_023326	Escherichia coli ACN001 plasmid pACN001-F, complete sequence	63538-63570	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP013224	Salmonella enterica subsp. enterica serovar Anatum strain GT-38 plasmid PDM04, complete sequence	1100-1132	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KX246268	Escherichia coli strain RD174 plasmid pHNRD174, complete sequence	71653-71685	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KU355874	Escherichia coli strain FAM22871 plasmid pFAM22871_2, complete sequence	83184-83216	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KX058576	Salmonella enterica strain SJTUF10584 plasmid pS10584, complete sequence	80099-80131	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KX452392	Escherichia coli strain JB10 plasmid pJB10, complete sequence	1839-1871	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_015965	Salmonella enterica subsp. enterica serovar Typhimurium plasmid R621a, complete sequence	79301-79333	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KP987217	Klebsiella pneumoniae strain 628 plasmid p628-CTXM, complete sequence	70784-70816	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KM377238	Escherichia coli strain HV114 plasmid pHV114, complete sequence	96057-96089	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KM377239	Escherichia coli strain HV292 plasmid pHV292, complete sequence	102330-102362	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KP198616	Escherichia coli strain C0996A plasmid pCTXM123_C0996, complete sequence	93872-93904	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KM377240	Escherichia coli strain HV295 plasmid pHV295, complete sequence	90136-90168	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP018625	Escherichia coli strain FORC_044 plasmid pFORC44_1, complete sequence	5141-5173	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP018625	Escherichia coli strain FORC_044 plasmid pFORC44_1, complete sequence	110476-110508	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP024918	Klebsiella pneumoniae strain NH54 plasmid pKPNH54.2, complete sequence	1046-1078	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP045763	Salmonella enterica subsp. enterica serovar Heidelberg str. 41578 plasmid p1CFSAN000318, complete sequence	105499-105531	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP028485	Escherichia coli strain E41-1 plasmid p2, complete sequence	84606-84638	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP010142	Escherichia coli strain D3 plasmid B, complete sequence	68056-68088	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP032445	Salmonella enterica subsp. enterica serovar Fresno strain USMARC-69835 plasmid pSFR1-USMARC-69835, complete sequence	69326-69358	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP018116	Escherichia coli strain MRSN346638 plasmid pMRSN346638_119.3, complete sequence	104227-104259	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP018110	Escherichia coli strain MRSN346595 plasmid pMRSN346595_120.3, complete sequence	105299-105331	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP014622	Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1727 isolate SAN1261-1 plasmid pSAN1-1727, complete sequence	82147-82179	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_LS992187	Escherichia coli isolate Escherichia coli str. 3426 plasmid 3, complete sequence	27368-27400	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP053786	Escherichia coli isolate 2-101 plasmid p2-101, complete sequence	94098-94130	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP033963	Klebsiella pneumoniae strain L482 plasmid p4_L382, complete sequence	87907-87939	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_LS999562	Escherichia coli isolate EC-TO143 plasmid 3, complete sequence	1102-1134	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP053788	Escherichia coli isolate J31 plasmid pJ31, complete sequence	94098-94130	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KF290378	Salmonella enterica subsp. enterica serovar Typhimurium strain STm2 plasmid pSTM2, complete sequence	85272-85304	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_EU418931	Escherichia coli strain JIE174 plasmid pJIE174, complete sequence	81817-81849	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP048295	Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-3, complete sequence	95739-95771	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_013120	Escherichia coli plasmid pEK204, complete sequence	79178-79210	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_025198	Escherichia coli plasmid pJIE512b, complete sequence	77741-77773	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP019252	Escherichia coli strain 13KWH46 plasmid p13KWH46-2, complete sequence	18297-18329	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP019252	Escherichia coli strain 13KWH46 plasmid p13KWH46-2, complete sequence	117329-117361	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP006641	Escherichia coli PCN061 plasmid PCN061p5, complete sequence	88672-88704	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN915010	Escherichia coli strain TJ-33 plasmid pNDM-TJ33, complete sequence	182385-182417	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN915012	Escherichia coli strain GD-33 plasmid pNDM33-2, complete sequence	72229-72261	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN915013	Escherichia coli strain TD-33 plasmid pNDM-TD33, complete sequence	109503-109535	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP028315	Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067217 plasmid pSC-31-1, complete sequence	87604-87636	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP019249	Escherichia coli strain Combat13F7 plasmid pCombat13F7-4, complete sequence	21377-21409	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_023329	Escherichia coli strain B3804 plasmid pIFM3804, complete sequence	89836-89868	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP022060	Salmonella enterica strain FDAARGOS_312 plasmid unnamed1 sequence	10473-10505	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP022064	Salmonella enterica strain FDAARGOS_312 plasmid unnamed4, complete sequence	1347-1379	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP022064	Salmonella enterica strain FDAARGOS_312 plasmid unnamed4, complete sequence	100291-100323	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP022065	Salmonella enterica strain FDAARGOS_312 plasmid unnamed5 sequence	1791-1823	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP027374	Escherichia coli strain 05-3629 plasmid unnamed1, complete sequence	46798-46830	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP016572	Salmonella enterica subsp. enterica serovar Heidelberg strain AMR588-04-00320 plasmid pAMR588-04-00320_99, complete sequence	84401-84433	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CM019852	Escherichia coli strain CVM N17EC0326 plasmid pN17EC0326-2, complete sequence, whole genome shotgun sequence	41963-41995	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP038417	Escherichia coli O157:H7 strain 3-5-1 plasmid pGM351-2, complete sequence	74209-74241	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP014662	Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1783 plasmid pSAN1-2010K-2577, complete sequence	89253-89285	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP044183	Salmonella enterica subsp. enterica serovar Heidelberg strain AR-0404 plasmid pAR-0404-2, complete sequence	66721-66753	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP045756	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000752 plasmid p2CFSAN000752, complete sequence	33123-33155	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP025239	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE2-1928, complete sequence	82205-82237	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MK181557	Escherichia coli plasmid p14019095, complete sequence	93518-93550	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MK181558	Escherichia coli plasmid p15076331, complete sequence	94864-94896	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MK181559	Escherichia coli plasmid p199, complete sequence	107644-107676	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MK181560	Escherichia coli plasmid p14006165, complete sequence	95002-95034	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MK181561	Escherichia coli plasmid p14011252, complete sequence	93242-93274	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MK181562	Escherichia coli plasmid p15090172, complete sequence	92733-92765	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MK181563	Escherichia coli plasmid p15095941, complete sequence	94755-94787	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MK181564	Escherichia coli plasmid p15124679, complete sequence	94754-94786	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MK181565	Escherichia coli plasmid pESBL20140131, complete sequence	93372-93404	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MK181566	Escherichia coli plasmid p15078279, complete sequence	93968-94000	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MK181567	Escherichia coli plasmid pESBL20150097, complete sequence	93503-93535	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MK181568	Escherichia coli plasmid pESBL20150178, complete sequence	93485-93517	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP034252	Salmonella enterica subsp. enterica serovar Derby strain Sa64 plasmid pSa64-96, complete sequence	93707-93739	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP030000	Salmonella enterica subsp. enterica serovar Brandenburg strain SA20113174 plasmid pSA20113174.1, complete sequence	86578-86610	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP027333	Escherichia coli strain 2013C-3277 plasmid unnamed2	36962-36994	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MF152729	Escherichia coli plasmid pCTXM1-MU2, complete sequence	95293-95325	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_024979	Escherichia coli strain ESBL-305 plasmid pESBL-305, complete sequence	92989-93021	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_024980	Escherichia coli strain ESBL-315 plasmid pESBL-315, complete sequence	78475-78507	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP042618	Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-3_MCR3, complete sequence	93516-93548	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_024975	Escherichia coli strain E17.16 plasmid pE17.16, complete sequence	86723-86755	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_024977	Escherichia coli strain ESBL-12 plasmid pESBL-12, complete sequence	81828-81860	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_024978	Escherichia coli strain ESBL-283 plasmid pESBL-283, complete sequence	95574-95606	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP040548	Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-p3, complete sequence	84745-84777	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_019043	Escherichia coli plasmid pND11_107, complete sequence	91204-91236	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP029110	Escherichia coli strain AR436 plasmid unnamed2	40401-40433	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP052382	Klebsiella pneumoniae strain D16KP0008 plasmid pD16KP0008-1, complete sequence	76119-76151	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP053867	Salmonella enterica subsp. enterica serovar Typhimurium strain SL7207 plasmid pSL7202-2a, complete sequence	72310-72342	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP053868	Salmonella enterica subsp. enterica serovar Typhimurium strain SL7207 plasmid pSL7202-2b, complete sequence	72310-72342	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP024854	Escherichia coli strain AR_0006 plasmid tig00000311, complete sequence	82415-82447	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP045519	Salmonella enterica subsp. enterica serovar Anatum strain Sal-5091 plasmid pSal-5091_CMY, complete sequence	85116-85148	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP045467	Salmonella enterica subsp. enterica serovar Anatum strain Sal-3973 plasmid pSal-3973_DHA_CMY, complete sequence	122889-122921	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP021208	Escherichia coli strain strain Z247 plasmid p2474-3, complete sequence	12462-12494	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_005014	Salmonella enterica subsp. enterica serovar Typhimurium plasmid R64, complete sequence	106229-106261	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_023290	Salmonella enterica subsp. enterica serovar Typhimurium strain 9134 plasmid p9134dT, complete sequence	98558-98590	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP040270	Escherichia coli strain 1500 plasmid pEc1500_CTX, complete sequence	76115-76147	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_LT985231	Escherichia coli strain 730 genome assembly, plasmid: RCS37_pII	99688-99720	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_023275	Salmonella enterica subsp. enterica serovar Typhimurium strain 9134 plasmid p9134, complete sequence	105069-105101	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_023276	Salmonella enterica subsp. enterica serovar Typhimurium strain 9134 plasmid p9134dAT, complete sequence	80779-80811	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP039490	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000752 plasmid pCFSAN000752, complete sequence	15807-15839	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP039490	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000752 plasmid pCFSAN000752, complete sequence	116531-116563	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP031615	Klebsiella pneumoniae strain ZYST1 plasmid pZYST1C2, complete sequence	57249-57281	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP023376	Escherichia coli strain 1283 plasmid p92, complete sequence	77368-77400	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP024822	Escherichia coli strain CREC-591 plasmid pCREC-591_1, complete sequence	77528-77560	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP024976	Escherichia coli strain CV839-15 plasmid pCV839-15-p2, complete sequence	2626-2658	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP030191	Salmonella enterica strain SA20104250 plasmid pSA20104250.1, complete sequence	95544-95576	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	KU932026	Escherichia coli plasmid pEC14II_1, complete sequence	15498-15530	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	KU932027	Escherichia coli plasmid pEC14II_2, complete sequence	15316-15348	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	KU932032	Escherichia coli plasmid pEC16I_1, complete sequence	9565-9597	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	KU932033	Escherichia coli plasmid pEC16I_2, complete sequence	10620-10652	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MG516908	Escherichia coli plasmid pEc42, complete sequence	98631-98663	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_025142	Escherichia coli plasmid pC60-108, complete sequence	5144-5176	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_025147	Escherichia coli plasmid pV404, complete sequence	87068-87100	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP016533	Salmonella enterica subsp. enterica serovar Heidelberg strain SA01AB09084001 plasmid pSA01AB09084001_92, complete sequence	77382-77414	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP024146	Escherichia coli strain 14EC029 plasmid p14EC029e, complete sequence	54912-54944	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_019123	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH1148_107, complete sequence	92235-92267	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_019131	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH146_87, complete sequence	72023-72055	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_019137	Salmonella enterica subsp. enterica serovar Derby plasmid pSD107, complete sequence	92941-92973	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_019099	Salmonella enterica plasmid pNF1358, complete sequence	84778-84810	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KJ406378	Shigella sonnei strain SS084469 plasmid pSH4469, complete sequence	76556-76588	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP030025	Salmonella enterica subsp. enterica serovar Ohio strain SA20120345 plasmid pSA20120345.1, complete sequence	83992-84024	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP042944	Escherichia fergusonii strain ATCC 35471 plasmid pATCC-35472_2	38771-38803	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP016516	Salmonella enterica subsp. enterica serovar Heidelberg strain 11-004736-1-7 plasmid p11-004736-1-7_99, complete sequence	84400-84432	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP025751	Escherichia coli strain CV839-06 plasmid pCV839-06-p1, complete sequence	102801-102833	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP051282	Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Junco_ST-35 plasmid pST35-95663.1B, complete sequence	64658-64690	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP014972	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY1-1898, complete sequence	81934-81966	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP032495	Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_118, complete sequence	103293-103325	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP012936	Salmonella enterica subsp. enterica serovar Heidelberg strain N13-01290 plasmid pN13-01290_98, complete sequence	84401-84433	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_014234	Escherichia coli ETEC 1392/75 plasmid p746, complete sequence	59976-60008	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_019097	Escherichia coli plasmid Plm, complete sequence	84172-84204	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP023370	Escherichia coli strain 1428 plasmid p96, complete sequence	62973-63005	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP023385	Escherichia coli strain 1223 plasmid p87, complete sequence	72719-72751	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP012923	Salmonella enterica subsp. enterica serovar Heidelberg strain SA02DT10168701 plasmid pSA02DT10168701_99, complete sequence	84413-84445	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_011419	Escherichia coli SE11 plasmid pSE11-1, complete sequence	85080-85112	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP012929	Salmonella enterica subsp. enterica serovar Heidelberg strain 12-4374 plasmid p12-4374_96, complete sequence	81444-81476	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP040542	Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-p3, complete sequence	84750-84782	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_002122	Shigella sonnei plasmid P9 DNA, complete sequence	78846-78878	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP023382	Escherichia coli strain 127 plasmid p95, complete sequence	79891-79923	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN419434	Escherichia coli strain 2016-40-21249 plasmid p21249, complete sequence	47502-47534	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN419435	Escherichia coli strain 2016-40-14263 plasmid p14263, complete sequence	31020-31052	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN419438	Escherichia coli strain 2016-40-24003 plasmid p24003, complete sequence	11133-11165	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP025279	Salmonella enterica subsp. enterica serovar Montevideo str. USDA-ARS-USMARC-1913 plasmid pSLU-1913, complete sequence	77841-77873	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP053560	Escherichia coli strain EC1 plasmid pEC1, complete sequence	99057-99089	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP053677	Escherichia coli strain EC38 plasmid pEC38, complete sequence	93463-93495	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_011081	Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 plasmid pSL476_91, complete sequence	76811-76843	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP023356	Escherichia coli strain 746 plasmid p95, complete sequence	79874-79906	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP041679	Escherichia coli strain ESBL 15 plasmid unnamed1, complete sequence	73803-73835	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP015916	Escherichia coli strain 210205630 isolate 210205630 plasmid pSLy4, complete sequence	43385-43417	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP049876	Salmonella enterica subsp. enterica serovar Adjame strain 388789 plasmid unnamed, complete sequence	5372-5404	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	LC480203	Escherichia coli B64 plasmid pB64 DNA, complete sequence	94606-94638	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP016585	Salmonella enterica subsp. enterica serovar Heidelberg strain SH14-009 plasmid pSH14-009_99, complete sequence	84875-84907	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP043947	Escherichia coli strain AR202.2 plasmid pMPTEM-30, complete sequence	41119-41151	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP029837	Salmonella enterica subsp. enterica serovar Typhimurium strain 10ST07093 plasmid p10ST07093A, complete sequence	51042-51074	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP016522	Salmonella enterica subsp. enterica serovar Heidelberg strain SA02DT09004001 plasmid pSA02DT09004001_101, complete sequence	87125-87157	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	LC485173	Escherichia coli B1 plasmid pColBM-B1 DNA, complete sequence	69639-69671	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP049611	Escherichia coli strain 06-3538 plasmid p06-3538-2	39154-39186	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP016865	Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2010K-1587 isolate USDA-ARS-USMARC-1908 plasmid pSTY2-2010K-1587, complete sequence	86664-86696	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP053678	Escherichia coli strain EC28 plasmid pEC28, complete sequence	98802-98834	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_007635	Escherichia coli plasmid pCoo, complete sequence	83797-83829	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP018104	Escherichia coli strain MRSN352231 plasmid pMR0716_tem1, complete sequence	192933-192965	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP032888	Escherichia coli strain SCEC020022 plasmid pCTXM14_020022, complete sequence	94581-94613	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_024955	Escherichia coli strain AHC4 plasmid pHNAH4-1, complete sequence	94628-94660	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP043943	Escherichia coli strain AR216.2b plasmid pMPTEM-30, complete sequence	100602-100634	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP027415	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_320 plasmid unnamed1, complete sequence	1669-1701	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP027415	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_320 plasmid unnamed1, complete sequence	102740-102772	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP027409	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_317 plasmid unnamed, complete sequence	188179-188211	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_023915	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTM709 DNA, complete genome	84586-84618	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP028312	Salmonella enterica subsp. enterica serovar Heidelberg strain CFSAN067218 plasmid pSH-04-1, complete sequence	16127-16159	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_AP014805	Escherichia coli O119:H6 strain EC404/03 plasmid pEC404/03-2, complete sequence	69010-69042	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	CP054413	Escherichia coli strain SCU-204 plasmid pSCU-204-2, complete sequence	71557-71589	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_LT985248	Escherichia coli strain 720 plasmid RCS48_pI, complete sequence	66798-66830	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP026941	Escherichia coli strain CFS3313 plasmid pCFS3313-2, complete sequence	96958-96990	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP041441	Escherichia coli strain YPE12 plasmid pYPE12-122k, complete sequence	107375-107407	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_LT985273	Escherichia coli strain 03-235 plasmid RCS72_pI, complete sequence	94098-94130	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_LT985280	Escherichia coli strain 13947 plasmid RCS75_pI, complete sequence	93817-93849	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_LT985286	Escherichia coli strain 13948 plasmid RCS76_pI, complete sequence	95504-95536	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_LT985256	Escherichia coli strain 580 plasmid RCS49_p, complete sequence	66985-67017	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_LT985268	Escherichia coli strain 699 plasmid RCS58_p, complete sequence	103057-103089	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_LT985235	Escherichia coli strain 654 plasmid RCS34_p, complete sequence	96770-96802	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MH674341	Escherichia coli strain EC07 plasmid pUR-EC07, complete sequence	90868-90900	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MN540570	Escherichia coli strain E.coli4feg plasmid pIV_IncI1, complete sequence	38902-38934	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP041394	Escherichia coli strain ECOL-18-VL-LA-PA-Ryan-0026 plasmid p45407_2	50691-50723	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP045951	Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00010529 plasmid pAUSMDU00010529_02, complete sequence	78807-78839	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN262643	Escherichia coli strain EC009 plasmid pEC009.2, complete sequence	99632-99664	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN124285	Escherichia coli strain RKI3099 plasmid pRKI3099a, complete sequence	100120-100152	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP053081	Escherichia coli strain HB37 plasmid pHB37-1, complete sequence	88728-88760	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MH847038	Escherichia coli strain 04-021 plasmid p04-021, complete sequence	107703-107735	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MG948334	Escherichia coli strain 2305 plasmid p2305, complete sequence	96654-96686	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MH847571	Escherichia coli strain 17-461F plasmid p17-461F, complete sequence	34843-34875	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MH257955	Escherichia coli strain 104 plasmid pHXH-3, complete sequence	10260-10292	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MH422553	Escherichia coli strain L-I1 plasmid pIncI1, complete sequence	78557-78589	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KY748189	Escherichia coli strain EC007 plasmid pEC007, complete sequence	90891-90923	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KY865323	Escherichia coli strain SY286M plasmid pECM13, complete sequence	96351-96383	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MG764547	Escherichia coli strain 14E509 plasmid p14E509-CTXM, complete sequence	97655-97687	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MH472638	Escherichia coli strain ESBL20160056 plasmid pESBL20160056, complete sequence	86568-86600	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MF344577	Klebsiella pneumoniae strain N201205880 plasmid p205880-NR2, complete sequence	68725-68757	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KY748188	Escherichia coli strain EC006 plasmid pEC006, complete sequence	92229-92261	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MG825376	Escherichia coli strain 1108 plasmid p1108-CMY2, complete sequence	83150-83182	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_KY748190	Escherichia coli strain EC008 plasmid pEC008, complete sequence	108123-108155	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MG844436	Escherichia coli strain EC13 plasmid pCMY-136, complete sequence	75792-75824	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP016568	Salmonella enterica subsp. enterica serovar Heidelberg strain AMR588-04-00318 plasmid pAMR588-04-00318_99, complete sequence	84400-84432	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_MG948333	Escherichia coli strain 2454 plasmid p2454, complete sequence	72771-72803	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NC_019104	Salmonella enterica subsp. enterica serovar Kentucky plasmid pCS0010A_95, complete sequence	80612-80644	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MF554637	uncultured bacterium clone AA-100 plasmid pPIMMR, complete sequence	99407-99439	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP048361	Escherichia coli strain 53 plasmid p53_B, complete sequence	73246-73278	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	MN548042	Klebsiella pneumoniae strain QD23 plasmid pQD23-1, complete sequence	85705-85737	10	0.697
NZ_CP006803_3	3.4|424044|33|NZ_CP006803|PILER-CR,CRT	424044-424076	33	NZ_CP040536	Klebsiella pneumoniae strain CR-HvKP1 plasmid pCR-HvKP1-p3, complete sequence	84745-84777	10	0.697
NZ_CP006803_4	4.10|434907|32|NZ_CP006803|CRISPRCasFinder,CRT	434907-434938	32	MN694044	Marine virus AFVG_250M514, complete genome	15572-15603	10	0.688
NZ_CP006803_4	4.13|435090|32|NZ_CP006803|CRISPRCasFinder,CRT	435090-435121	32	NZ_CP024789	Nostoc flagelliforme CCNUN1 plasmid pNFSY04, complete sequence	93393-93424	10	0.688
NZ_CP006803_4	4.18|435396|32|NZ_CP006803|CRISPRCasFinder,CRT	435396-435427	32	NZ_CP041669	Legionella israelensis strain L18-01051 plasmid unnamed, complete sequence	18382-18413	10	0.688
NZ_CP006803_4	4.19|435457|32|NZ_CP006803|CRISPRCasFinder,CRT	435457-435488	32	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	24833-24864	10	0.688
NZ_CP006803_4	4.47|435883|33|NZ_CP006803|PILER-CR	435883-435915	33	NC_014841	Pantoea sp. At-9b plasmid pPAT9B04, complete sequence	12253-12285	10	0.697
NZ_CP006803_4	4.3|434480|32|NZ_CP006803|CRISPRCasFinder,CRT	434480-434511	32	NC_030948	Ralstonia phage RSP15 DNA, complete genome	29164-29195	11	0.656
NZ_CP006803_4	4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT	435579-435610	32	NC_049857	Lactococcus phage P1048, complete genome	75061-75092	11	0.656

1. spacer 1.1|420725|30|NZ_CP006803|PILER-CR,CRT matches to MN830256 (Lactobacillus phage JNU_P7, complete genome) position: , mismatch: 0, identity: 1.0

aaaccatctcatcgttgctcatcatcctat	CRISPR spacer
aaaccatctcatcgttgctcatcatcctat	Protospacer
******************************

2. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to MN830257 (Lactobacillus phage JNU_P11, complete genome) position: , mismatch: 0, identity: 1.0

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
tgactgtagatgaaaatgtagttactagtg	Protospacer
******************************

3. spacer 3.3|423983|33|NZ_CP006803|PILER-CR,CRT matches to DQ320509 (Lactobacillus phage KC5a, complete genome) position: , mismatch: 0, identity: 1.0

tttctttttcttctactggactaccaacatttt	CRISPR spacer
tttctttttcttctactggactaccaacatttt	Protospacer
*********************************

4. spacer 3.13|424594|33|NZ_CP006803|CRT matches to AF495798 (Lactobacillus helveticus phage f-0303 endolysin gene, complete cds) position: , mismatch: 0, identity: 1.0

ttgccaaattgctactccgtccattgacgggaa	CRISPR spacer
ttgccaaattgctactccgtccattgacgggaa	Protospacer
*********************************

5. spacer 4.1|434481|30|NZ_CP006803|PILER-CR matches to MN830257 (Lactobacillus phage JNU_P11, complete genome) position: , mismatch: 0, identity: 1.0

ccgtattcccaattagcataggttgaaagt	CRISPR spacer
ccgtattcccaattagcataggttgaaagt	Protospacer
******************************

6. spacer 4.3|434480|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN830257 (Lactobacillus phage JNU_P11, complete genome) position: , mismatch: 0, identity: 1.0

accgtattcccaattagcataggttgaaagtc	CRISPR spacer
accgtattcccaattagcataggttgaaagtc	Protospacer
********************************

7. spacer 4.6|434663|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_010179 (Lactobacillus johnsonii prophage Lj771, complete genome) position: , mismatch: 0, identity: 1.0

aactggaagaagattgaagaaactatcaatca	CRISPR spacer
aactggaagaagattgaagaaactatcaatca	Protospacer
********************************

8. spacer 4.13|435090|32|NZ_CP006803|CRISPRCasFinder,CRT matches to AJ131519 (Lactobacillus bacteriophage phi adh complete genome) position: , mismatch: 0, identity: 1.0

actgctaaggctcgaaatttagctgatgtgaa	CRISPR spacer
actgctaaggctcgaaatttagctgatgtgaa	Protospacer
********************************

9. spacer 4.13|435090|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_000896 (Lactobacillus prophage phiadh, complete genome) position: , mismatch: 0, identity: 1.0

actgctaaggctcgaaatttagctgatgtgaa	CRISPR spacer
actgctaaggctcgaaatttagctgatgtgaa	Protospacer
********************************

10. spacer 4.13|435090|32|NZ_CP006803|CRISPRCasFinder,CRT matches to M62697 (Bacteriophage adh repeat region and integrase (intG) gene, complete cds) position: , mismatch: 0, identity: 1.0

actgctaaggctcgaaatttagctgatgtgaa	CRISPR spacer
actgctaaggctcgaaatttagctgatgtgaa	Protospacer
********************************

11. spacer 4.14|435151|32|NZ_CP006803|CRISPRCasFinder,CRT matches to AJ131519 (Lactobacillus bacteriophage phi adh complete genome) position: , mismatch: 0, identity: 1.0

tcctctctcaatttttcattctcttcttgtag	CRISPR spacer
tcctctctcaatttttcattctcttcttgtag	Protospacer
********************************

12. spacer 4.14|435151|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_000896 (Lactobacillus prophage phiadh, complete genome) position: , mismatch: 0, identity: 1.0

tcctctctcaatttttcattctcttcttgtag	CRISPR spacer
tcctctctcaatttttcattctcttcttgtag	Protospacer
********************************

13. spacer 4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN830257 (Lactobacillus phage JNU_P11, complete genome) position: , mismatch: 0, identity: 1.0

aagactcaatctgaagaagtaaaagatgaagt	CRISPR spacer
aagactcaatctgaagaagtaaaagatgaagt	Protospacer
********************************

14. spacer 4.22|435640|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_024206 (Lactobacillus phage phi jlb1, complete genome) position: , mismatch: 0, identity: 1.0

aagccagttcgaagggctactaactgggataa	CRISPR spacer
aagccagttcgaagggctactaactgggataa	Protospacer
********************************

15. spacer 4.22|435640|32|NZ_CP006803|CRISPRCasFinder,CRT matches to DQ320509 (Lactobacillus phage KC5a, complete genome) position: , mismatch: 0, identity: 1.0

aagccagttcgaagggctactaactgggataa	CRISPR spacer
aagccagttcgaagggctactaactgggataa	Protospacer
********************************

16. spacer 4.23|435701|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN830257 (Lactobacillus phage JNU_P11, complete genome) position: , mismatch: 0, identity: 1.0

taatgcccattccttgggataaaccatttccg	CRISPR spacer
taatgcccattccttgggataaaccatttccg	Protospacer
********************************

17. spacer 4.34|435089|33|NZ_CP006803|PILER-CR matches to AJ131519 (Lactobacillus bacteriophage phi adh complete genome) position: , mismatch: 0, identity: 1.0

cactgctaaggctcgaaatttagctgatgtgaa	CRISPR spacer
cactgctaaggctcgaaatttagctgatgtgaa	Protospacer
*********************************

18. spacer 4.34|435089|33|NZ_CP006803|PILER-CR matches to NC_000896 (Lactobacillus prophage phiadh, complete genome) position: , mismatch: 0, identity: 1.0

cactgctaaggctcgaaatttagctgatgtgaa	CRISPR spacer
cactgctaaggctcgaaatttagctgatgtgaa	Protospacer
*********************************

19. spacer 4.34|435089|33|NZ_CP006803|PILER-CR matches to M62697 (Bacteriophage adh repeat region and integrase (intG) gene, complete cds) position: , mismatch: 0, identity: 1.0

cactgctaaggctcgaaatttagctgatgtgaa	CRISPR spacer
cactgctaaggctcgaaatttagctgatgtgaa	Protospacer
*********************************

20. spacer 4.35|435150|33|NZ_CP006803|PILER-CR matches to AJ131519 (Lactobacillus bacteriophage phi adh complete genome) position: , mismatch: 0, identity: 1.0

ttcctctctcaatttttcattctcttcttgtag	CRISPR spacer
ttcctctctcaatttttcattctcttcttgtag	Protospacer
*********************************

21. spacer 4.35|435150|33|NZ_CP006803|PILER-CR matches to NC_000896 (Lactobacillus prophage phiadh, complete genome) position: , mismatch: 0, identity: 1.0

ttcctctctcaatttttcattctcttcttgtag	CRISPR spacer
ttcctctctcaatttttcattctcttcttgtag	Protospacer
*********************************

22. spacer 4.42|435578|33|NZ_CP006803|PILER-CR matches to MN830257 (Lactobacillus phage JNU_P11, complete genome) position: , mismatch: 0, identity: 1.0

caagactcaatctgaagaagtaaaagatgaagt	CRISPR spacer
caagactcaatctgaagaagtaaaagatgaagt	Protospacer
*********************************

23. spacer 4.43|435639|33|NZ_CP006803|PILER-CR matches to NC_024206 (Lactobacillus phage phi jlb1, complete genome) position: , mismatch: 0, identity: 1.0

taagccagttcgaagggctactaactgggataa	CRISPR spacer
taagccagttcgaagggctactaactgggataa	Protospacer
*********************************

24. spacer 4.43|435639|33|NZ_CP006803|PILER-CR matches to DQ320509 (Lactobacillus phage KC5a, complete genome) position: , mismatch: 0, identity: 1.0

taagccagttcgaagggctactaactgggataa	CRISPR spacer
taagccagttcgaagggctactaactgggataa	Protospacer
*********************************

25. spacer 4.44|435700|33|NZ_CP006803|PILER-CR matches to MN830257 (Lactobacillus phage JNU_P11, complete genome) position: , mismatch: 0, identity: 1.0

ttaatgcccattccttgggataaaccatttccg	CRISPR spacer
ttaatgcccattccttgggataaaccatttccg	Protospacer
*********************************

26. spacer 3.2|423922|33|NZ_CP006803|PILER-CR,CRT matches to NC_024206 (Lactobacillus phage phi jlb1, complete genome) position: , mismatch: 1, identity: 0.97

cacgaccatagataacatcggaatactcagagt	CRISPR spacer
cacgtccatagataacatcggaatactcagagt	Protospacer
**** ****************************

27. spacer 3.2|423922|33|NZ_CP006803|PILER-CR,CRT matches to DQ320509 (Lactobacillus phage KC5a, complete genome) position: , mismatch: 1, identity: 0.97

cacgaccatagataacatcggaatactcagagt	CRISPR spacer
cacgaccatagataacatcggaatactcagaat	Protospacer
*******************************.*

28. spacer 3.3|423983|33|NZ_CP006803|PILER-CR,CRT matches to NC_010179 (Lactobacillus johnsonii prophage Lj771, complete genome) position: , mismatch: 1, identity: 0.97

tttctttttcttctactggactaccaacatttt	CRISPR spacer
cttctttttcttctactggactaccaacatttt	Protospacer
.********************************

29. spacer 3.3|423983|33|NZ_CP006803|PILER-CR,CRT matches to NC_024206 (Lactobacillus phage phi jlb1, complete genome) position: , mismatch: 1, identity: 0.97

tttctttttcttctactggactaccaacatttt	CRISPR spacer
cttctttttcttctactggactaccaacatttt	Protospacer
.********************************

30. spacer 4.12|435029|32|NZ_CP006803|CRISPRCasFinder,CRT matches to AJ131519 (Lactobacillus bacteriophage phi adh complete genome) position: , mismatch: 1, identity: 0.969

tctcctttctaccctgtatcgttttcctcctt	CRISPR spacer
tctcctttctatcctgtatcgttttcctcctt	Protospacer
***********.********************

31. spacer 4.12|435029|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_000896 (Lactobacillus prophage phiadh, complete genome) position: , mismatch: 1, identity: 0.969

tctcctttctaccctgtatcgttttcctcctt	CRISPR spacer
tctcctttctatcctgtatcgttttcctcctt	Protospacer
***********.********************

32. spacer 4.22|435640|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN830257 (Lactobacillus phage JNU_P11, complete genome) position: , mismatch: 1, identity: 0.969

aagccagttcgaagggctactaactgggataa	CRISPR spacer
aagccagttcgaagggctacaaactgggataa	Protospacer
******************** ***********

33. spacer 4.22|435640|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_010179 (Lactobacillus johnsonii prophage Lj771, complete genome) position: , mismatch: 1, identity: 0.969

aagccagttcgaagggctactaactgggataa	CRISPR spacer
aagacagttcgaagggctactaactgggataa	Protospacer
*** ****************************

34. spacer 4.22|435640|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN830256 (Lactobacillus phage JNU_P7, complete genome) position: , mismatch: 1, identity: 0.969

aagccagttcgaagggctactaactgggataa	CRISPR spacer
aagccagttcgaagggctacaaactgggataa	Protospacer
******************** ***********

35. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN830257 (Lactobacillus phage JNU_P11, complete genome) position: , mismatch: 1, identity: 0.969

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tgcctgaatttgatcgttttaatgttggagat	Protospacer
********************** *********

36. spacer 4.33|435028|33|NZ_CP006803|PILER-CR matches to AJ131519 (Lactobacillus bacteriophage phi adh complete genome) position: , mismatch: 1, identity: 0.97

ttctcctttctaccctgtatcgttttcctcctt	CRISPR spacer
ttctcctttctatcctgtatcgttttcctcctt	Protospacer
************.********************

37. spacer 4.33|435028|33|NZ_CP006803|PILER-CR matches to NC_000896 (Lactobacillus prophage phiadh, complete genome) position: , mismatch: 1, identity: 0.97

ttctcctttctaccctgtatcgttttcctcctt	CRISPR spacer
ttctcctttctatcctgtatcgttttcctcctt	Protospacer
************.********************

38. spacer 4.43|435639|33|NZ_CP006803|PILER-CR matches to MN830257 (Lactobacillus phage JNU_P11, complete genome) position: , mismatch: 1, identity: 0.97

taagccagttcgaagggctactaactgggataa	CRISPR spacer
taagccagttcgaagggctacaaactgggataa	Protospacer
********************* ***********

39. spacer 4.43|435639|33|NZ_CP006803|PILER-CR matches to MN830256 (Lactobacillus phage JNU_P7, complete genome) position: , mismatch: 1, identity: 0.97

taagccagttcgaagggctactaactgggataa	CRISPR spacer
taagccagttcgaagggctacaaactgggataa	Protospacer
********************* ***********

40. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to MN830257 (Lactobacillus phage JNU_P11, complete genome) position: , mismatch: 1, identity: 0.97

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ttgcctgaatttgatcgttttaatgttggagat	Protospacer
*********************** *********

41. spacer 3.5|424105|33|NZ_CP006803|PILER-CR,CRT matches to NC_019782 (Lactobacillus phage AQ113, complete genome) position: , mismatch: 2, identity: 0.939

tggacggagtagcgatctggcaatttactgaca	CRISPR spacer
tggacggagtagcgatctggcaattcactgata	Protospacer
*************************.*****.*

42. spacer 3.13|424594|33|NZ_CP006803|CRT matches to AJ131519 (Lactobacillus bacteriophage phi adh complete genome) position: , mismatch: 2, identity: 0.939

ttgccaaattgctactccgtccattgacgggaa	CRISPR spacer
ttgccaaattgctaccccgtccattgatgggaa	Protospacer
***************.***********.*****

43. spacer 3.13|424594|33|NZ_CP006803|CRT matches to NC_000896 (Lactobacillus prophage phiadh, complete genome) position: , mismatch: 2, identity: 0.939

ttgccaaattgctactccgtccattgacgggaa	CRISPR spacer
ttgccaaattgctaccccgtccattgatgggaa	Protospacer
***************.***********.*****

44. spacer 4.43|435639|33|NZ_CP006803|PILER-CR matches to NC_010179 (Lactobacillus johnsonii prophage Lj771, complete genome) position: , mismatch: 2, identity: 0.939

taagccagttcgaagggctactaactgggataa	CRISPR spacer
caagacagttcgaagggctactaactgggataa	Protospacer
.*** ****************************

45. spacer 2.14|422600|31|NZ_CP006803|CRT matches to MN830256 (Lactobacillus phage JNU_P7, complete genome) position: , mismatch: 3, identity: 0.903

aagcccctgctgtaaaatcaatgactaactt	CRISPR spacer
agccctctgctgtaaaatcaatgactaactt	Protospacer
*. **.*************************

46. spacer 3.5|424105|33|NZ_CP006803|PILER-CR,CRT matches to MN830257 (Lactobacillus phage JNU_P11, complete genome) position: , mismatch: 3, identity: 0.909

tggacggagtagcgatctggcaatttactgaca	CRISPR spacer
tggacggagtagcaatctggcaatttaccgata	Protospacer
*************.**************.**.*

47. spacer 2.5|422478|31|NZ_CP006803|PILER-CR,CRT matches to CP024783 (Lactobacillus johnsonii pf01 plasmid pLJPF01S, complete sequence) position: , mismatch: 4, identity: 0.871

caagcatctgctgaagctccattttaggact	CRISPR spacer
caagcatcagctgaagccccattttaggctt	Protospacer
******** ********.********** .*

48. spacer 2.10|422477|32|NZ_CP006803|CRISPRCasFinder matches to CP024783 (Lactobacillus johnsonii pf01 plasmid pLJPF01S, complete sequence) position: , mismatch: 4, identity: 0.875

tcaagcatctgctgaagctccattttaggact	CRISPR spacer
tcaagcatcagctgaagccccattttaggctt	Protospacer
********* ********.********** .*

49. spacer 2.12|422599|32|NZ_CP006803|CRISPRCasFinder matches to MN830256 (Lactobacillus phage JNU_P7, complete genome) position: , mismatch: 4, identity: 0.875

taagcccctgctgtaaaatcaatgactaactt	CRISPR spacer
aagccctctgctgtaaaatcaatgactaactt	Protospacer
 *. **.*************************

50. spacer 4.1|434481|30|NZ_CP006803|PILER-CR matches to KC847113 (Bacillus phage PBP180, complete sequence) position: , mismatch: 5, identity: 0.833

ccgtattcccaattagcataggttgaaagt	CRISPR spacer
ccatattcccagttagcataggttgacatc	Protospacer
**.********.************** * .

51. spacer 1.1|420725|30|NZ_CP006803|PILER-CR,CRT matches to NZ_CP019242 (Rhodoferax antarcticus strain DSMZ24876 plasmid unnamed2) position: , mismatch: 6, identity: 0.8

aaaccatctcatcgttgctcatcatcctat	CRISPR spacer
acaccatctgatccttgctcatcatcacgt	Protospacer
* ******* *** ************ ..*

52. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to AP014387 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S44-C19, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.818

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
ctcttttagctgcttgataacctttatcaaaaa	Protospacer
**.*****************.*******. *  

53. spacer 4.1|434481|30|NZ_CP006803|PILER-CR matches to NZ_CP014853 (Bacillus thuringiensis strain HD12 plasmid pHD120345, complete sequence) position: , mismatch: 6, identity: 0.8

ccgtattcccaattagcataggttgaaagt	CRISPR spacer
ccgtactcccaatttgcataggtagtacga	Protospacer
*****.******** ******** * * * 

54. spacer 4.1|434481|30|NZ_CP006803|PILER-CR matches to NC_018486 (Bacillus thuringiensis HD-771 plasmid p01, complete sequence) position: , mismatch: 6, identity: 0.8

ccgtattcccaattagcataggttgaaagt	CRISPR spacer
ccgtactcccaatttgcataggtagtacga	Protospacer
*****.******** ******** * * * 

55. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_017261 (Buchnera aphidicola str. Ua (Uroleucon ambrosiae) plasmid pLeu, complete sequence) position: , mismatch: 6, identity: 0.812

gttttgtttaattaacttacat-aattataata	CRISPR spacer
tttttgtttatataacttacataaattactat-	Protospacer
 *********  ********** *****. ** 

56. spacer 4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_014023 (Bacillus megaterium QM B1551 plasmid pBM700, complete sequence) position: , mismatch: 6, identity: 0.812

-aagactcaatctgaagaagtaaaagatgaagt	CRISPR spacer
caacaatc-atctgatgaagtaaaagaggaaga	Protospacer
 ** * ** ****** *********** **** 

57. spacer 4.23|435701|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MK075001 (Staphylococcus phage phiSP15-1, complete genome) position: , mismatch: 6, identity: 0.812

taatgcccattccttgggataaaccatttccg---	CRISPR spacer
caatgcccattcctttggttaaac---ttccgaaa	Protospacer
.************** ** *****   *****   

58. spacer 4.25|435823|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_019765 (Stanieria cyanosphaera PCC 7437 plasmid pSTA7437.01, complete sequence) position: , mismatch: 6, identity: 0.812

ataaattc-atggataaatttaccatgattctt	CRISPR spacer
-tgtattcaatggatgaatctaccatgattctg	Protospacer
 *. **** ******.***.************ 

59. spacer 1.2|420791|30|NZ_CP006803|PILER-CR,CRT matches to NC_009231 (Clostridium phage phiC2, complete genome) position: , mismatch: 7, identity: 0.767

ccagaactagcaccaccgtaccagacttct	CRISPR spacer
taagaaccagcaccaccgtaccaaccccct	Protospacer
. *****.***************. *..**

60. spacer 1.2|420791|30|NZ_CP006803|PILER-CR,CRT matches to NC_011398 (Clostridium phage phiCD27, complete genome) position: , mismatch: 7, identity: 0.767

ccagaactagcaccaccgtaccagacttct	CRISPR spacer
taagaaccagcaccaccgtaccaaccccct	Protospacer
. *****.***************. *..**

61. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to AP013434 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-U-MedDCM-OCT-S32-C65) position: , mismatch: 7, identity: 0.767

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
gaactgtagctaaaaatgtagttacatctg	Protospacer
 .******* *.*************   **

62. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to MN693045 (Marine virus AFVG_25M135, complete genome) position: , mismatch: 7, identity: 0.767

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
gaactgtagctaaaaatgtagttacatctg	Protospacer
 .******* *.*************   **

63. spacer 2.5|422478|31|NZ_CP006803|PILER-CR,CRT matches to MN693010 (Marine virus AFVG_117M73, complete genome) position: , mismatch: 7, identity: 0.774

caagcatctgctgaagctcc----attttaggact	CRISPR spacer
gaagcatctgttgaagctccagttattttaa----	Protospacer
 *********.*********    ******.    

64. spacer 2.5|422478|31|NZ_CP006803|PILER-CR,CRT matches to MN694652 (Marine virus AFVG_250M647, complete genome) position: , mismatch: 7, identity: 0.774

caagcatctgctgaagctcc----attttaggact	CRISPR spacer
gaagcatctgttgaagctccagttattttaa----	Protospacer
 *********.*********    ******.    

65. spacer 4.3|434480|32|NZ_CP006803|CRISPRCasFinder,CRT matches to KC847113 (Bacillus phage PBP180, complete sequence) position: , mismatch: 7, identity: 0.781

accgtattcccaattagcataggttgaaagtc	CRISPR spacer
tccatattcccagttagcataggttgacatcg	Protospacer
 **.********.************** * . 

66. spacer 4.6|434663|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP053834 (Arcobacter cloacae strain LMG 26153 plasmid pACLO, complete sequence) position: , mismatch: 7, identity: 0.781

aactggaagaagattgaagaaactatcaatca	CRISPR spacer
aattataagaatattgaagaaaatatcaaaaa	Protospacer
**.*. ***** ********** ******  *

67. spacer 4.10|434907|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN694694 (Marine virus AFVG_250M960, complete genome) position: , mismatch: 7, identity: 0.781

-tgctacaccaagcatttcagcaccatcttgta	CRISPR spacer
attcca-atcaagcattccagcaccttcttgtc	Protospacer
 * *.* *.********.******* ****** 

68. spacer 4.14|435151|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP016589 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence) position: , mismatch: 7, identity: 0.781

tcctctctcaatttttcattctcttcttgtag-	CRISPR spacer
ttttcactcaatttttctttctcttc-aatagt	Protospacer
*..** *********** ********  .*** 

69. spacer 4.18|435396|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_AP017918 (Candidatus Azobacteroides pseudotrichonymphae plasmid pAPPJ4 DNA, complete sequence, phylotype ProJPt-1) position: , mismatch: 7, identity: 0.781

---agaatcaaatagaatcataagaattattaata	CRISPR spacer
tatagagt---atagaataataaaaattattaatt	Protospacer
   ***.*   ******* ****.********** 

70. spacer 4.19|435457|32|NZ_CP006803|CRISPRCasFinder,CRT matches to AP014398 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S46-C79, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.781

aaaaatcatggatttatcagaattagaaaagg	CRISPR spacer
cgaaggtatggatttatcagatttagaaaaag	Protospacer
 .**. .************** ********.*

71. spacer 4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN693415 (Marine virus AFVG_25M102, complete genome) position: , mismatch: 7, identity: 0.781

aagactcaatctgaagaagtaaaagatgaagt	CRISPR spacer
gaaacttgttctgaagaagaaaaagatcaagt	Protospacer
.*.***.. ********** ******* ****

72. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

73. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_KX839207 (Klebsiella pneumoniae strain KP1814 plasmid pKP1814-1, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

74. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

75. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP025467 (Klebsiella pneumoniae strain JS187 plasmid p187-1, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

76. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

77. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

78. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

79. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

80. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

81. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

82. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP038277 (Raoultella ornithinolytica strain WLK218 plasmid pWLK-238550, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

83. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP024641 (Klebsiella michiganensis strain F107 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

84. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to CP027603 (UNVERIFIED_ORG: Klebsiella pneumoniae strain AR_0080 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

85. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

86. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

87. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

88. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_MF344561 (Klebsiella pneumoniae strain 11219 plasmid p11219-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

89. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

90. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

91. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_MF344567 (Klebsiella pneumoniae strain A708 plasmid pA708-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

92. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

93. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

94. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP026369 (Klebsiella quasipneumoniae strain A708 plasmid pA708-1, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

95. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP028952 (Klebsiella aerogenes strain AR_0161 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

96. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
tccctgaatttgatgattttaaggtttatgac	Protospacer
* ************ .********** . **.

97. spacer 1.1|420725|30|NZ_CP006803|PILER-CR,CRT matches to NZ_CP037921 (Hymenobacter sp. 17J36-26 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aaaccatctcatcgttgctcatcatcctat	CRISPR spacer
gcttgatctcatcgttgctgatgatcctgt	Protospacer
.  . ************** ** *****.*

98. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024108 (Bacillus cytotoxicus strain CH_15 plasmid pCh15_83, complete sequence) position: , mismatch: 8, identity: 0.733

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
atcctgtagatgaaaatgaagttatttatt	Protospacer
   *************** *****.* .* 

99. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024100 (Bacillus cytotoxicus strain CH_38 plasmid pCh38_83, complete sequence) position: , mismatch: 8, identity: 0.733

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
atcctgtagatgaaaatgaagttatttatt	Protospacer
   *************** *****.* .* 

100. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024122 (Bacillus cytotoxicus strain CH_1 plasmid pCh1_67, complete sequence) position: , mismatch: 8, identity: 0.733

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
atcctgtagatgaaaatgaagttatttatt	Protospacer
   *************** *****.* .* 

101. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024115 (Bacillus cytotoxicus strain CH_3 plasmid pCh3_83, complete sequence) position: , mismatch: 8, identity: 0.733

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
atcctgtagatgaaaatgaagttatttatt	Protospacer
   *************** *****.* .* 

102. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024110 (Bacillus cytotoxicus strain CH_13 plasmid pCh13_79, complete sequence) position: , mismatch: 8, identity: 0.733

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
atcctgtagatgaaaatgaagttatttatt	Protospacer
   *************** *****.* .* 

103. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024106 (Bacillus cytotoxicus strain CH_23 plasmid pCh23_67, complete sequence) position: , mismatch: 8, identity: 0.733

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
atcctgtagatgaaaatgaagttatttatt	Protospacer
   *************** *****.* .* 

104. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024118 (Bacillus cytotoxicus strain CH_2 plasmid pCh2_83, complete sequence) position: , mismatch: 8, identity: 0.733

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
atcctgtagatgaaaatgaagttatttatt	Protospacer
   *************** *****.* .* 

105. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024097 (Bacillus cytotoxicus strain CH_39 plasmid pCh39_83, complete sequence) position: , mismatch: 8, identity: 0.733

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
atcctgtagatgaaaatgaagttatttatt	Protospacer
   *************** *****.* .* 

106. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024103 (Bacillus cytotoxicus strain CH_25 plasmid pCh25_67, complete sequence) position: , mismatch: 8, identity: 0.733

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
atcctgtagatgaaaatgaagttatttatt	Protospacer
   *************** *****.* .* 

107. spacer 2.3|422356|31|NZ_CP006803|PILER-CR,CRT matches to MN693509 (Marine virus AFVG_25M367, complete genome) position: , mismatch: 8, identity: 0.742

agtgttgtacctgaattaatggcatattcta	CRISPR spacer
acttcatctcctgaattaatggcatcttcta	Protospacer
* * .  . **************** *****

108. spacer 2.5|422478|31|NZ_CP006803|PILER-CR,CRT matches to NZ_CP039262 (Lactobacillus johnsonii strain DC22.2 plasmid pLjDC22.2_1, complete sequence) position: , mismatch: 8, identity: 0.742

caagcatctgctgaagctccattttaggact	CRISPR spacer
gctgcatcagctgaagcaccattttaagctt	Protospacer
   ***** ******** ********.* .*

109. spacer 2.8|422355|32|NZ_CP006803|CRISPRCasFinder matches to NZ_CP031446 (Acinetobacter baumannii strain MDR-UNC plasmid pAB120, complete sequence) position: , mismatch: 8, identity: 0.75

tagtgttgtacctgaattaatggcatattcta	CRISPR spacer
tagtgttgtacataaattaatggttttttagg	Protospacer
*********** *.*********. * **  .

110. spacer 2.8|422355|32|NZ_CP006803|CRISPRCasFinder matches to NZ_KY704308 (Acinetobacter baumannii strain IHIT32296 plasmid pAbIHIT32296, complete sequence) position: , mismatch: 8, identity: 0.75

tagtgttgtacctgaattaatggcatattcta	CRISPR spacer
tagtgttgtacataaattaatggttttttagg	Protospacer
*********** *.*********. * **  .

111. spacer 2.8|422355|32|NZ_CP006803|CRISPRCasFinder matches to NZ_CP034097 (Acinetobacter baumannii strain A52 plasmid pA52-OXA-72, complete sequence) position: , mismatch: 8, identity: 0.75

tagtgttgtacctgaattaatggcatattcta	CRISPR spacer
tagtgttgtacataaattaatggttttttagg	Protospacer
*********** *.*********. * **  .

112. spacer 2.8|422355|32|NZ_CP006803|CRISPRCasFinder matches to NZ_CP033871 (Acinetobacter baumannii strain MRSN15313 plasmid p597A-14.8, complete sequence) position: , mismatch: 8, identity: 0.75

tagtgttgtacctgaattaatggcatattcta	CRISPR spacer
tagtgttgtacataaattaatggttttttagg	Protospacer
*********** *.*********. * **  .

113. spacer 2.8|422355|32|NZ_CP006803|CRISPRCasFinder matches to NZ_CP043954 (Acinetobacter baumannii strain K09-14 plasmid pK09-14, complete sequence) position: , mismatch: 8, identity: 0.75

tagtgttgtacctgaattaatggcatattcta	CRISPR spacer
tagtgttgtacataaattaatggttttttagg	Protospacer
*********** *.*********. * **  .

114. spacer 2.8|422355|32|NZ_CP006803|CRISPRCasFinder matches to MN461227 (Acinetobacter pittii strain A352 plasmid pA352, complete sequence) position: , mismatch: 8, identity: 0.75

tagtgttgtacctgaattaatggcatattcta	CRISPR spacer
tagtgttgtacataaattaatggttttttagg	Protospacer
*********** *.*********. * **  .

115. spacer 2.8|422355|32|NZ_CP006803|CRISPRCasFinder matches to MN481287 (Acinetobacter pittii strain A32949 plasmid pA2949, complete sequence) position: , mismatch: 8, identity: 0.75

tagtgttgtacctgaattaatggcatattcta	CRISPR spacer
tagtgttgtacataaattaatggttttttagg	Protospacer
*********** *.*********. * **  .

116. spacer 2.8|422355|32|NZ_CP006803|CRISPRCasFinder matches to NZ_CP049809 (Acinetobacter pittii strain A1254 plasmid pA1254_3, complete sequence) position: , mismatch: 8, identity: 0.75

tagtgttgtacctgaattaatggcatattcta	CRISPR spacer
tagtgttgtacataaattaatggttttttagg	Protospacer
*********** *.*********. * **  .

117. spacer 2.8|422355|32|NZ_CP006803|CRISPRCasFinder matches to NC_019359 (Acinetobacter baumannii plasmid pAB120, complete sequence) position: , mismatch: 8, identity: 0.75

tagtgttgtacctgaattaatggcatattcta	CRISPR spacer
tagtgttgtacataaattaatggttttttagg	Protospacer
*********** *.*********. * **  .

118. spacer 2.9|422416|32|NZ_CP006803|CRISPRCasFinder matches to NZ_CP024264 (Escherichia coli O169:H41 strain F6326-C1 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

-gcgatatctagtcgaaagaaatatgggttacc	CRISPR spacer
cgtgg-atttaatcgaaagaaatatgggttttg	Protospacer
 *.*. **.**.****************** . 

119. spacer 2.9|422416|32|NZ_CP006803|CRISPRCasFinder matches to NZ_CP031294 (Escherichia coli strain EC17GD31 plasmid pGD31-F25, complete sequence) position: , mismatch: 8, identity: 0.75

-gcgatatctagtcgaaagaaatatgggttacc	CRISPR spacer
cgtgg-atttaatcgaaagaaatatgggttttg	Protospacer
 *.*. **.**.****************** . 

120. spacer 2.9|422416|32|NZ_CP006803|CRISPRCasFinder matches to NZ_CP029421 (Escherichia coli strain 3385 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

-gcgatatctagtcgaaagaaatatgggttacc	CRISPR spacer
cgtgg-atttaatcgaaagaaatatgggttttg	Protospacer
 *.*. **.**.****************** . 

121. spacer 2.10|422477|32|NZ_CP006803|CRISPRCasFinder matches to NZ_CP039262 (Lactobacillus johnsonii strain DC22.2 plasmid pLjDC22.2_1, complete sequence) position: , mismatch: 8, identity: 0.75

tcaagcatctgctgaagctccattttaggact	CRISPR spacer
tgctgcatcagctgaagcaccattttaagctt	Protospacer
*   ***** ******** ********.* .*

122. spacer 2.10|422477|32|NZ_CP006803|CRISPRCasFinder matches to MN693010 (Marine virus AFVG_117M73, complete genome) position: , mismatch: 8, identity: 0.75

tcaagcatctgctgaagctcc----attttaggact	CRISPR spacer
cgaagcatctgttgaagctccagttattttaa----	Protospacer
. *********.*********    ******.    

123. spacer 2.10|422477|32|NZ_CP006803|CRISPRCasFinder matches to MN694652 (Marine virus AFVG_250M647, complete genome) position: , mismatch: 8, identity: 0.75

tcaagcatctgctgaagctcc----attttaggact	CRISPR spacer
cgaagcatctgttgaagctccagttattttaa----	Protospacer
. *********.*********    ******.    

124. spacer 4.3|434480|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP014853 (Bacillus thuringiensis strain HD12 plasmid pHD120345, complete sequence) position: , mismatch: 8, identity: 0.75

accgtattcccaattagcataggttgaaagtc	CRISPR spacer
tccgtactcccaatttgcataggtagtacgag	Protospacer
 *****.******** ******** * * *  

125. spacer 4.3|434480|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_018486 (Bacillus thuringiensis HD-771 plasmid p01, complete sequence) position: , mismatch: 8, identity: 0.75

accgtattcccaattagcataggttgaaagtc	CRISPR spacer
tccgtactcccaatttgcataggtagtacgag	Protospacer
 *****.******** ******** * * *  

126. spacer 4.5|434602|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN871445 (UNVERIFIED: Serratia phage KpHz_2, complete genome) position: , mismatch: 8, identity: 0.75

aaagtttgctccccaaagtctggaatgtattc	CRISPR spacer
ggtgtgtaatccccaaagtctctaatgtattc	Protospacer
.. ** *. ************  *********

127. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_LR134420 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 11) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata-	CRISPR spacer
taattgtttaaataacttaaataatta-agtgc	Protospacer
   ******** ******* ******* *.*. 

128. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_049481 (Lactococcus phage CHPC361, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataagtataaca	Protospacer
   .*.************* **** *****.*

129. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to JQ740813 (Lactococcus Phage ASCC532, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

130. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to AY249139 (Lactococcus phage bIL66M1 E15 (e15) gene, partial cds; and E14 (e14), E13 (e13), E12 (e12), E11 (e11), E10 (e10), E9 (e9), E8 (e8), E7 (e7), E6 (e6), E5 (e5), E4 (e4), E3 (e3), E2 (e2), and E1 (e1) genes, complete cds) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

131. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MK301437 (Lactococcus phage 1W08F, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

132. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to KP793108 (Lactococcus phage 936 group phage Phi5.12, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

133. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_001909 (Lactococcus phage bIL170, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

134. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MF346933 (Lactococcus phage vB_Llc_bIBBF14, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

135. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_049348 (Lactococcus lactis phage p272, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

136. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MG253650 (Lactococcus phage vB_Llc_bIBB77s, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

137. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_049352 (Lactococcus phage phi15, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

138. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to JQ740790 (Lactococcus Phage ASCC284, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

139. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN689522 (Lactococcus phage CHPC958, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

140. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_049426 (Lactococcus phage vB_Llc_bIBBF12, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

141. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MG253648 (Lactococcus phage vB_Llc_bIBB14s, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

142. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to JQ740792 (Lactococcus Phage ASCC310, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

143. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_049486 (Lactococcus phage CHPC959, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataagtataaca	Protospacer
   .*.************* **** *****.*

144. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to AF009630 (Bacteriophage bIL170, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

145. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to KC182548 (Lactococcus lactis phage P113G, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

146. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to JQ740795 (Lactococcus Phage ASCC356, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

147. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_049482 (Lactococcus phage CHPC362, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

148. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_049363 (Lactococcus phage 936 group phage Phi44, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

149. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to KP793115 (Lactococcus phage 936 group phage Phi114, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

150. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MG253653 (Lactococcus phage vB_Llc_bIBBF13, complete genome) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
taactatttaattaacttagataataataaca	Protospacer
   .*.************* ***** ****.*

151. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP024791 (Nostoc flagelliforme CCNUN1 plasmid pNFSY06, complete sequence) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
ctattgttgaattaagttacataattcaacaa	Protospacer
 * ***** ****** **********  *  *

152. spacer 4.9|434846|32|NZ_CP006803|CRISPRCasFinder,CRT matches to CP040041 (Acinetobacter baumannii strain VB958 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gttttgtttaattaacttacataattataata	CRISPR spacer
ttgttgtttaattaatttaaataattgatatt	Protospacer
 * ************.*** ******.  ** 

153. spacer 4.14|435151|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN693596 (Marine virus AFVG_25M324, complete genome) position: , mismatch: 8, identity: 0.75

tcctctctcaatttttcattctcttcttgtag	CRISPR spacer
gaacctcttaattttttattctcttcttgaat	Protospacer
   .****.*******.************ * 

154. spacer 4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_022051 (Listeria monocytogenes strain J1926 plasmid, complete sequence) position: , mismatch: 8, identity: 0.75

tattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aattgagaggagaaatcatggaaaataaacat	Protospacer
 ********* **** ********* *.  * 

155. spacer 4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT matches to CP044433 (Listeria monocytogenes strain FDA00009448 plasmid pCFSAN038814, complete sequence) position: , mismatch: 8, identity: 0.75

tattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aattgagaggagaaatcatggaaaataaacat	Protospacer
 ********* **** ********* *.  * 

156. spacer 4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT matches to CP044431 (Listeria monocytogenes strain FDA00006667 plasmid pCFSAN038814, complete sequence) position: , mismatch: 8, identity: 0.75

tattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aattgagaggagaaatcatggaaaataaacat	Protospacer
 ********* **** ********* *.  * 

157. spacer 4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_022046 (Listeria monocytogenes strain J1776 plasmid, complete sequence) position: , mismatch: 8, identity: 0.75

tattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aattgagaggagaaatcatggaaaataaacat	Protospacer
 ********* **** ********* *.  * 

158. spacer 4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_022047 (Listeria monocytogenes strain J1817 plasmid, complete sequence) position: , mismatch: 8, identity: 0.75

tattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aattgagaggagaaatcatggaaaataaacat	Protospacer
 ********* **** ********* *.  * 

159. spacer 4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP053631 (Listeria monocytogenes strain OB040119 plasmid pOB040119, complete sequence) position: , mismatch: 8, identity: 0.75

tattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aattgagaggagaaatcatggaaaataaacat	Protospacer
 ********* **** ********* *.  * 

160. spacer 4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP053629 (Listeria monocytogenes strain OB030029 plasmid pOB030029, complete sequence) position: , mismatch: 8, identity: 0.75

tattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aattgagaggagaaatcatggaaaataaacat	Protospacer
 ********* **** ********* *.  * 

161. spacer 4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP053633 (Listeria monocytogenes strain OB050226 plasmid pOB050226, complete sequence) position: , mismatch: 8, identity: 0.75

tattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aattgagaggagaaatcatggaaaataaacat	Protospacer
 ********* **** ********* *.  * 

162. spacer 4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP014254 (Listeria monocytogenes strain CFSAN023459 plasmid CFSAN023459_02, complete sequence) position: , mismatch: 8, identity: 0.75

tattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aattgagaggagaaatcatggaaaataaacat	Protospacer
 ********* **** ********* *.  * 

163. spacer 4.15|435212|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP009691 (Bacillus mycoides strain ATCC 6462 plasmid pBMX_1, complete sequence) position: , mismatch: 8, identity: 0.75

tattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aaaagagaggtgaagacatggtaaaaaagaag	Protospacer
 *  **********.****** *****. **.

164. spacer 4.19|435457|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP016846 (Carnobacterium maltaromaticum strain TMW 2.1581 plasmid pL21581-2, complete sequence) position: , mismatch: 8, identity: 0.75

aaaaatcatggatttatcagaattagaaaagg	CRISPR spacer
agatgaaatggatttagcagatttagaaaaga	Protospacer
*.* .  ********* **** *********.

165. spacer 4.19|435457|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP013615 (Clostridium perfringens strain JP838 plasmid pJFP838A, complete sequence) position: , mismatch: 8, identity: 0.75

aaaaatcatggatttatcagaattagaaaagg	CRISPR spacer
taaagaaatggaattatcagaattagataaaa	Protospacer
 ***.  ***** ************** **..

166. spacer 4.19|435457|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MT559528 (UNVERIFIED: Klebsiella phage vB_KpnP_cmc20193, complete genome) position: , mismatch: 8, identity: 0.75

aaaaatcatggatttatcagaattagaaaagg	CRISPR spacer
acaataaatggatttatcacaattacaaaaat	Protospacer
* **   ************ ***** ****. 

167. spacer 4.19|435457|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MK521906 (Klebsiella phage vB_KpnM_FZ14, complete genome) position: , mismatch: 8, identity: 0.75

aaaaatcatggatttatcagaattagaaaagg	CRISPR spacer
acaataaatggatttatcacaattacaaaaat	Protospacer
* **   ************ ***** ****. 

168. spacer 4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP053812 (Vibrio cholerae strain W6G plasmid pW6G, complete sequence) position: , mismatch: 8, identity: 0.75

aagactcaatctgaagaagtaaaagatgaagt	CRISPR spacer
ttgaggcaatctcaagaagtaaaagacgagga	Protospacer
  **  ****** *************.**.* 

169. spacer 4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP053815 (Vibrio cholerae strain W7G plasmid pW7G, complete sequence) position: , mismatch: 8, identity: 0.75

aagactcaatctgaagaagtaaaagatgaagt	CRISPR spacer
ttgaggcaatctcaagaagtaaaagacgagga	Protospacer
  **  ****** *************.**.* 

170. spacer 4.27|435945|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP046704 (Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence) position: , mismatch: 8, identity: 0.75

taaccaacttttgcgtcgaaata--tccaaacaa	CRISPR spacer
taaccaacttttgcctcaaaatacttttgagc--	Protospacer
************** **.*****  *...*.*  

171. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to NC_049481 (Lactococcus phage CHPC361, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataagtataaca	Protospacer
*   .*.************* **** *****.*

172. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to JQ740813 (Lactococcus Phage ASCC532, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

173. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to AY249139 (Lactococcus phage bIL66M1 E15 (e15) gene, partial cds; and E14 (e14), E13 (e13), E12 (e12), E11 (e11), E10 (e10), E9 (e9), E8 (e8), E7 (e7), E6 (e6), E5 (e5), E4 (e4), E3 (e3), E2 (e2), and E1 (e1) genes, complete cds) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

174. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to MK301437 (Lactococcus phage 1W08F, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

175. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to KP793108 (Lactococcus phage 936 group phage Phi5.12, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

176. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to NC_001909 (Lactococcus phage bIL170, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

177. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to MF346933 (Lactococcus phage vB_Llc_bIBBF14, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

178. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to NC_049348 (Lactococcus lactis phage p272, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

179. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to MG253650 (Lactococcus phage vB_Llc_bIBB77s, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

180. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to NC_049352 (Lactococcus phage phi15, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

181. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to JQ740790 (Lactococcus Phage ASCC284, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

182. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to MN689522 (Lactococcus phage CHPC958, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

183. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to NC_049426 (Lactococcus phage vB_Llc_bIBBF12, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

184. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to MG253648 (Lactococcus phage vB_Llc_bIBB14s, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

185. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to JQ740792 (Lactococcus Phage ASCC310, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

186. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to NC_049486 (Lactococcus phage CHPC959, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataagtataaca	Protospacer
*   .*.************* **** *****.*

187. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to AF009630 (Bacteriophage bIL170, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

188. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to KC182548 (Lactococcus lactis phage P113G, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

189. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to JQ740795 (Lactococcus Phage ASCC356, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

190. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to NC_049482 (Lactococcus phage CHPC362, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

191. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to NC_049363 (Lactococcus phage 936 group phage Phi44, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

192. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to KP793115 (Lactococcus phage 936 group phage Phi114, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

193. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to MG253653 (Lactococcus phage vB_Llc_bIBBF13, complete genome) position: , mismatch: 8, identity: 0.758

cgttttgtttaattaacttacataattataata	CRISPR spacer
ctaactatttaattaacttagataataataaca	Protospacer
*   .*.************* ***** ****.*

194. spacer 4.40|435456|33|NZ_CP006803|PILER-CR matches to NZ_CP016846 (Carnobacterium maltaromaticum strain TMW 2.1581 plasmid pL21581-2, complete sequence) position: , mismatch: 8, identity: 0.758

taaaaatcatggatttatcagaattagaaaagg	CRISPR spacer
tagatgaaatggatttagcagatttagaaaaga	Protospacer
**.* .  ********* **** *********.

195. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_KX839207 (Klebsiella pneumoniae strain KP1814 plasmid pKP1814-1, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

196. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

197. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_CP019048 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166a, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

198. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

199. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_CP024641 (Klebsiella michiganensis strain F107 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

200. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_CP026369 (Klebsiella quasipneumoniae strain A708 plasmid pA708-1, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

201. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_CP028952 (Klebsiella aerogenes strain AR_0161 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

202. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

203. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

204. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_CP025467 (Klebsiella pneumoniae strain JS187 plasmid p187-1, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

205. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

206. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to KU318421 (Klebsiella pneumoniae strain KP04 plasmid pKP04VIM, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

207. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NC_023911 (Raoultella planticola strain KpNDM1 plasmid pKpNDM1, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

208. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

209. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_CP038277 (Raoultella ornithinolytica strain WLK218 plasmid pWLK-238550, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

210. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to CP027603 (UNVERIFIED_ORG: Klebsiella pneumoniae strain AR_0080 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

211. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

212. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

213. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_CP026019 (Klebsiella pneumoniae strain 13190 plasmid p13190-1, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

214. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_MF344561 (Klebsiella pneumoniae strain 11219 plasmid p11219-IMP, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

215. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_MF344566 (Klebsiella pneumoniae strain A324 plasmid pA324-IMP, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

216. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

217. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_MF344567 (Klebsiella pneumoniae strain A708 plasmid pA708-IMP, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

218. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_MF344563 (Klebsiella pneumoniae strain 13190 plasmid p13190-VIM, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

219. spacer 4.45|435761|33|NZ_CP006803|PILER-CR matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 8, identity: 0.758

ttgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
ctccctgaatttgatgattttaaggtttatgac	Protospacer
.* ************ .********** . **.

220. spacer 1.1|420725|30|NZ_CP006803|PILER-CR,CRT matches to KT588075 (Acinetobacter phage Ab105-2phi, complete genome) position: , mismatch: 9, identity: 0.7

aaaccatctcatcgttgctcatcatcctat	CRISPR spacer
ctgggatctcattgttgctcatcctccttg	Protospacer
  .  *******.********** ****  

221. spacer 1.1|420725|30|NZ_CP006803|PILER-CR,CRT matches to MT349887 (Acinetobacter phage 5W, complete genome) position: , mismatch: 9, identity: 0.7

aaaccatctcatcgttgctcatcatcctat	CRISPR spacer
ctgggatctcattgttgctcatcctccttg	Protospacer
  .  *******.********** ****  

222. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to MN693631 (Marine virus AFVG_250M1143, complete genome) position: , mismatch: 9, identity: 0.7

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
tgcctgtagatgaaaatgtaggtgtggaaa	Protospacer
** ****************** *.. .. .

223. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to MN694579 (Marine virus AFVG_250M1138, complete genome) position: , mismatch: 9, identity: 0.7

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
tgcctgtagatgaaaatgtaggtgtggaaa	Protospacer
** ****************** *.. .. .

224. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to MN694584 (Marine virus AFVG_250M353, complete genome) position: , mismatch: 9, identity: 0.7

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
tgcctgtagatgaaaatgtaggtgtggaaa	Protospacer
** ****************** *.. .. .

225. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to MN694540 (Marine virus AFVG_250M802, complete genome) position: , mismatch: 9, identity: 0.7

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
tgcctgtagatgaaaatgtaggtgtggaaa	Protospacer
** ****************** *.. .. .

226. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to AP014266 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S41-C121, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.7

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
tgcctgtagatgaaaatgtaggtgtggaaa	Protospacer
** ****************** *.. .. .

227. spacer 1.3|420857|30|NZ_CP006803|PILER-CR,CRT matches to MN693684 (Marine virus AFVG_250M122, complete genome) position: , mismatch: 9, identity: 0.7

tgactgtagatgaaaatgtagttactagtg	CRISPR spacer
tgcctgtagatgaaaatgtaggtgtggaaa	Protospacer
** ****************** *.. .. .

228. spacer 2.4|422417|31|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024264 (Escherichia coli O169:H41 strain F6326-C1 plasmid unnamed1) position: , mismatch: 9, identity: 0.71

cgatatctagtcgaaagaaatatgggttacc	CRISPR spacer
gtggatttaatcgaaagaaatatgggttttg	Protospacer
  . **.**.****************** . 

229. spacer 2.4|422417|31|NZ_CP006803|PILER-CR,CRT matches to NZ_CP029421 (Escherichia coli strain 3385 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

cgatatctagtcgaaagaaatatgggttacc	CRISPR spacer
gtggatttaatcgaaagaaatatgggttttg	Protospacer
  . **.**.****************** . 

230. spacer 2.4|422417|31|NZ_CP006803|PILER-CR,CRT matches to NZ_CP031294 (Escherichia coli strain EC17GD31 plasmid pGD31-F25, complete sequence) position: , mismatch: 9, identity: 0.71

cgatatctagtcgaaagaaatatgggttacc	CRISPR spacer
gtggatttaatcgaaagaaatatgggttttg	Protospacer
  . **.**.****************** . 

231. spacer 2.5|422478|31|NZ_CP006803|PILER-CR,CRT matches to NZ_CP043518 (Lactococcus lactis subsp. lactis bv. diacetylactis strain SD96 plasmid pSD96_06, complete sequence) position: , mismatch: 9, identity: 0.71

caagcatctgctgaagctccattttaggact	CRISPR spacer
aaagaatctactgaagctccatttccttccg	Protospacer
 *** ****.**************.    * 

232. spacer 2.10|422477|32|NZ_CP006803|CRISPRCasFinder matches to NZ_CP043518 (Lactococcus lactis subsp. lactis bv. diacetylactis strain SD96 plasmid pSD96_06, complete sequence) position: , mismatch: 9, identity: 0.719

tcaagcatctgctgaagctccattttaggact	CRISPR spacer
taaagaatctactgaagctccatttccttccg	Protospacer
* *** ****.**************.    * 

233. spacer 2.13|422539|31|NZ_CP006803|CRT matches to NZ_CP020540 (Sphingobium herbicidovorans strain MH plasmid pSHV1, complete sequence) position: , mismatch: 9, identity: 0.71

cattgtgaacgccatttgctgtgtaggacca	CRISPR spacer
ttacctgaacgccatatgctgtgaaggatga	Protospacer
.  . ********** ******* ****. *

234. spacer 3.11|424472|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP015341 (Lactobacillus brevis strain 100D8 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.727

tctggaccagcagcaccccatacatacggttta	CRISPR spacer
ctaggcccagcagcaccccagacatacttgttg	Protospacer
.. ** ************** ******   **.

235. spacer 4.1|434481|30|NZ_CP006803|PILER-CR matches to NC_030948 (Ralstonia phage RSP15 DNA, complete genome) position: , mismatch: 9, identity: 0.7

ccgtattcccaattagcataggttgaaagt	CRISPR spacer
ttgtattcccaatttgcaaaggttgcctta	Protospacer
..************ *** ******     

236. spacer 4.6|434663|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN369743 (Streptomyces phage Tribute, complete genome) position: , mismatch: 9, identity: 0.719

aactggaagaagattgaagaaactatcaatca	CRISPR spacer
aaggtaaagaagattgaagatgctatcaaggc	Protospacer
**   .************** .*******   

237. spacer 4.6|434663|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MF358542 (Streptomyces phage Sushi23, complete genome) position: , mismatch: 9, identity: 0.719

aactggaagaagattgaagaaactatcaatca	CRISPR spacer
aaggtaaagaagattgaagatgctatcaaggc	Protospacer
**   .************** .*******   

238. spacer 4.6|434663|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MK494112 (Streptomyces phage EGole, complete genome) position: , mismatch: 9, identity: 0.719

aactggaagaagattgaagaaactatcaatca	CRISPR spacer
aaggtaaagaagattgaagatgctatcaaggc	Protospacer
**   .************** .*******   

239. spacer 4.6|434663|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_042011 (Streptomyces phage Peebs, complete genome) position: , mismatch: 9, identity: 0.719

aactggaagaagattgaagaaactatcaatca	CRISPR spacer
aaggtaaagaagattgaagacgctatcaaggc	Protospacer
**   .************** .*******   

240. spacer 4.18|435396|32|NZ_CP006803|CRISPRCasFinder,CRT matches to LT615366 (Enterococcus phage VPE25 genome assembly, chromosome: VPE25) position: , mismatch: 9, identity: 0.719

agaatcaaatagaatcataagaattattaata	CRISPR spacer
agccgcaaataaaataataagaattattgcgg	Protospacer
**   ******.*** ************.  .

241. spacer 4.18|435396|32|NZ_CP006803|CRISPRCasFinder,CRT matches to LT546030 (Enterococcus phage VPE25 genome assembly, chromosome: I) position: , mismatch: 9, identity: 0.719

agaatcaaatagaatcataagaattattaata	CRISPR spacer
agccgcaaataaaataataagaattattgcgg	Protospacer
**   ******.*** ************.  .

242. spacer 4.18|435396|32|NZ_CP006803|CRISPRCasFinder,CRT matches to AP014199 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C74-MedDCM-OCT-S25-C34, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.719

agaatcaaatagaatcataagaattattaata	CRISPR spacer
gatatcaaataggatcagaagaattaggaact	Protospacer
.. *********.**** ********  **. 

243. spacer 4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_049930 (Enterococcus phage vB_EfaP_Zip, complete genome) position: , mismatch: 9, identity: 0.719

aagactcaatctgaagaagtaaaagatgaagt	CRISPR spacer
gaagttgaatctgaagaagttaaagaagaaaa	Protospacer
.*...* ************* ***** ***. 

244. spacer 4.23|435701|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MH617622 (Inoviridae sp. isolate ctbd37, complete genome) position: , mismatch: 9, identity: 0.719

taatgcccattccttgggataaaccatttccg	CRISPR spacer
tcatgcccattgcttgcgataaacctaaagcc	Protospacer
* ********* **** ********     * 

245. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MT939487 (Erwinia phage pEa_SNUABM_47, complete genome) position: , mismatch: 9, identity: 0.719

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
gtactgattttgatcgttttaacgttttccat	Protospacer
   **** ************** ***    **

246. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MT939486 (Erwinia phage pEa_SNUABM_12, complete genome) position: , mismatch: 9, identity: 0.719

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
gtactgattttgatcgttttaacgttttccat	Protospacer
   **** ************** ***    **

247. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_041917 (Serratia phage BF, complete genome) position: , mismatch: 9, identity: 0.719

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
gtactgattttgatcgttttaacgttttccat	Protospacer
   **** ************** ***    **

248. spacer 4.24|435762|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MT939488 (Erwinia phage pEa_SNUABM_50, complete genome) position: , mismatch: 9, identity: 0.719

tgcctgaatttgatcgttttaaggttggagat	CRISPR spacer
gtactgattttgatcgttttaacgttttccat	Protospacer
   **** ************** ***    **

249. spacer 4.26|435884|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_014841 (Pantoea sp. At-9b plasmid pPAT9B04, complete sequence) position: , mismatch: 9, identity: 0.719

gaaaaagaagcctgacgatgaaaaacaatttg	CRISPR spacer
tcagtgaaaacctgacgatgaataacaatttc	Protospacer
  *. ..**.************ ******** 

250. spacer 4.30|434845|33|NZ_CP006803|PILER-CR matches to NZ_LR134420 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 11) position: , mismatch: 9, identity: 0.727

cgttttgtttaattaacttacataattataata-	CRISPR spacer
gtaattgtttaaataacttaaataatta-agtgc	Protospacer
    ******** ******* ******* *.*. 

251. spacer 4.35|435150|33|NZ_CP006803|PILER-CR matches to MN693596 (Marine virus AFVG_25M324, complete genome) position: , mismatch: 9, identity: 0.727

ttcctctctcaatttttcattctcttcttgtag	CRISPR spacer
agaacctcttaattttttattctcttcttgaat	Protospacer
    .****.*******.************ * 

252. spacer 4.36|435211|33|NZ_CP006803|PILER-CR matches to NC_022051 (Listeria monocytogenes strain J1926 plasmid, complete sequence) position: , mismatch: 9, identity: 0.727

ttattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aaattgagaggagaaatcatggaaaataaacat	Protospacer
  ********* **** ********* *.  * 

253. spacer 4.36|435211|33|NZ_CP006803|PILER-CR matches to CP044433 (Listeria monocytogenes strain FDA00009448 plasmid pCFSAN038814, complete sequence) position: , mismatch: 9, identity: 0.727

ttattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aaattgagaggagaaatcatggaaaataaacat	Protospacer
  ********* **** ********* *.  * 

254. spacer 4.36|435211|33|NZ_CP006803|PILER-CR matches to CP044431 (Listeria monocytogenes strain FDA00006667 plasmid pCFSAN038814, complete sequence) position: , mismatch: 9, identity: 0.727

ttattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aaattgagaggagaaatcatggaaaataaacat	Protospacer
  ********* **** ********* *.  * 

255. spacer 4.36|435211|33|NZ_CP006803|PILER-CR matches to NC_022046 (Listeria monocytogenes strain J1776 plasmid, complete sequence) position: , mismatch: 9, identity: 0.727

ttattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aaattgagaggagaaatcatggaaaataaacat	Protospacer
  ********* **** ********* *.  * 

256. spacer 4.36|435211|33|NZ_CP006803|PILER-CR matches to NC_022047 (Listeria monocytogenes strain J1817 plasmid, complete sequence) position: , mismatch: 9, identity: 0.727

ttattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aaattgagaggagaaatcatggaaaataaacat	Protospacer
  ********* **** ********* *.  * 

257. spacer 4.36|435211|33|NZ_CP006803|PILER-CR matches to NZ_CP053631 (Listeria monocytogenes strain OB040119 plasmid pOB040119, complete sequence) position: , mismatch: 9, identity: 0.727

ttattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aaattgagaggagaaatcatggaaaataaacat	Protospacer
  ********* **** ********* *.  * 

258. spacer 4.36|435211|33|NZ_CP006803|PILER-CR matches to NZ_CP053629 (Listeria monocytogenes strain OB030029 plasmid pOB030029, complete sequence) position: , mismatch: 9, identity: 0.727

ttattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aaattgagaggagaaatcatggaaaataaacat	Protospacer
  ********* **** ********* *.  * 

259. spacer 4.36|435211|33|NZ_CP006803|PILER-CR matches to NZ_CP053633 (Listeria monocytogenes strain OB050226 plasmid pOB050226, complete sequence) position: , mismatch: 9, identity: 0.727

ttattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aaattgagaggagaaatcatggaaaataaacat	Protospacer
  ********* **** ********* *.  * 

260. spacer 4.36|435211|33|NZ_CP006803|PILER-CR matches to NZ_CP014254 (Listeria monocytogenes strain CFSAN023459 plasmid CFSAN023459_02, complete sequence) position: , mismatch: 9, identity: 0.727

ttattgagaggtgaaaacatggaaaaaagtaaa	CRISPR spacer
aaattgagaggagaaatcatggaaaataaacat	Protospacer
  ********* **** ********* *.  * 

261. spacer 2.11|422538|32|NZ_CP006803|CRISPRCasFinder matches to NZ_CP020540 (Sphingobium herbicidovorans strain MH plasmid pSHV1, complete sequence) position: , mismatch: 10, identity: 0.688

tcattgtgaacgccatttgctgtgtaggacca	CRISPR spacer
cttacctgaacgccatatgctgtgaaggatga	Protospacer
..  . ********** ******* ****. *

262. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP028168 (Escherichia coli strain CFSAN064036 plasmid pGMI17-004_1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

263. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MG569891 (Shigella sonnei strain DE105 plasmid pDE105, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

264. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KU130396 (Escherichia coli strain S68 plasmid pS68, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

265. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KT779550 (Escherichia coli strain 369 plasmid p369, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

266. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KJ866866 (Escherichia coli strain SKLX3330 plasmid pSKLX3330, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

267. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_020991 (Shigella sonnei 10188 plasmid pKHSB1 complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

268. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP010130 (Escherichia coli strain C9 plasmid A, complete genome) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

269. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP042631 (Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-4, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

270. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP010233 (Escherichia coli strain S30 plasmid B, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

271. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP013193 (Escherichia coli strain FORC_031 plasmid pFORC31.3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

272. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP049350 (Escherichia coli strain 3R plasmid p3R-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

273. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP043738 (Escherichia coli strain CVM N17EC0616 plasmid pN17EC0616-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

274. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP020511 (Escherichia coli strain 165 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

275. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP020547 (Escherichia coli strain ZJ3920 plasmid pZJ3920-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

276. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP010317 (Escherichia coli strain 789 plasmid pAPEC-O78-2) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

277. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP012627 (Escherichia coli strain SF-468 plasmid pSF-468-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

278. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_LT838199 (Escherichia coli isolate WI1 isolate plasmid pWI1-incI1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

279. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP013221 (Salmonella enterica subsp. enterica serovar Anatum strain GT-01 plasmid PDM02, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

280. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP041621 (Shigella flexneri strain C32 plasmid pC32_2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

281. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP015996 (Escherichia coli strain S51 plasmid pS51_1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

282. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP045189 (Escherichia coli strain NT1F31 plasmid pNT1F31-96kb, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

283. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024285 (Escherichia albertii strain 2014C-4356 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

284. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP027327 (Escherichia coli strain 2013C-4830 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

285. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP019248 (Escherichia coli strain Combat13F7 plasmid pCombat13F7-3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

286. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP019248 (Escherichia coli strain Combat13F7 plasmid pCombat13F7-3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

287. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP014966 (Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2010K-1587 plasmid pSTY1-2010K-1587, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

288. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP049984 (Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N40391 plasmid pN40391-1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

289. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP049985 (Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N40391 plasmid pN40391-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

290. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP049985 (Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N40391 plasmid pN40391-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

291. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP053576 (Salmonella enterica strain 2012K-0845 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

292. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP038347 (Escherichia coli O157:H7 strain G5295 plasmid pG5295-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

293. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP045527 (Shigella sonnei strain 6607.69 plasmid p6607-69, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

294. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP044137 (Escherichia coli O157 strain AR-0430 plasmid pAR-0430-1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

295. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP032264 (Escherichia coli strain AR_0089 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

296. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP034251 (Salmonella enterica subsp. enterica serovar Derby strain Sa64 plasmid pSa64T-188, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

297. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP053754 (Shigella sonnei strain 506 plasmid pMHMC-003, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

298. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP031283 (Escherichia fergusonii strain 40A plasmid p150_40A, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

299. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP050747 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

300. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP022734 (Escherichia coli strain SA186 plasmid pSA186_5, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

301. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP035469 (Escherichia coli strain U12A plasmid pU12A_B, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

302. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to KU932029 (Escherichia coli plasmid pEC15I_1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

303. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to KU932030 (Escherichia coli plasmid pEC15I_2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

304. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_025176 (Escherichia coli plasmid pH2291-112, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

305. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_023899 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTM7, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

306. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_023900 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTM2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

307. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_025143 (Escherichia coli plasmid pC59-112, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

308. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_025144 (Escherichia coli plasmid pC49-108, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

309. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP027535 (Escherichia coli strain AR_0081 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

310. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP009566 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 plasmid pCVM22462, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

311. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_021811 (Salmonella enterica subsp. enterica serovar Heidelberg str. 41578 plasmid pSEEH1578_01, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

312. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP048298 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

313. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP018975 (Escherichia coli strain Ecol_545 plasmid pEC545_1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

314. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP023365 (Escherichia coli strain 144 plasmid p92, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

315. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN419430 (Escherichia coli strain 2016-4017437 plasmid p17437, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

316. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN419431 (Escherichia coli strain 2016-40-19138 plasmid p19138, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

317. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN419432 (Escherichia coli strain 2016-40-21254 plasmid p21254, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

318. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN419433 (Escherichia coli strain 2016-40-20426 plasmid p20426, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

319. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN419436 (Escherichia coli strain 2016-40-22440 plasmid p22440, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

320. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN419437 (Escherichia coli strain 2016-40-22638 plasmid p22638, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

321. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP035721 (Escherichia coli strain U15A plasmid pU15A_A, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

322. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP029058 (Escherichia coli strain FORC_081 plasmid pFORC_081_1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

323. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP039604 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014868 plasmid p12-6919.1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

324. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN125610 (Salmonella enterica subsp. enterica serovar Enteritidis strain 1.11-3A7 plasmid pIncI1-CTX-M-14, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

325. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_021813 (Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069 plasmid pCFSAN002069_01, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

326. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_019111 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal8934a, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

327. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP027135 (Escherichia coli strain AR_0369 plasmid unnamed3) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

328. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP027135 (Escherichia coli strain AR_0369 plasmid unnamed3) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

329. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP029975 (Escherichia coli strain 51008369SK1 plasmid p51008369SK1_B, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

330. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP043228 (Escherichia coli strain Ec-050 plasmid pEc-050-TEM-30, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

331. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MH884650 (Salmonella sp. strain Sa21 plasmid pSa21-HP, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

332. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MH884651 (Salmonella sp. strain Sa21 plasmid pSa21-TC-CIP, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

333. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP019905 (Escherichia coli strain MDR_56 plasmid unnamed6, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

334. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MN241905 (Salmonella enterica subsp. enterica serovar Typhimurium strain STM3224 plasmid pUY_STM96, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

335. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MK070495 (Escherichia coli strain MB6212 plasmid pMB5876, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

336. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP027127 (Escherichia coli strain AR_0374 plasmid unnamed2) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

337. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_023326 (Escherichia coli ACN001 plasmid pACN001-F, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

338. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP013224 (Salmonella enterica subsp. enterica serovar Anatum strain GT-38 plasmid PDM04, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

339. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KX246268 (Escherichia coli strain RD174 plasmid pHNRD174, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

340. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KU355874 (Escherichia coli strain FAM22871 plasmid pFAM22871_2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

341. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KX058576 (Salmonella enterica strain SJTUF10584 plasmid pS10584, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

342. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KX452392 (Escherichia coli strain JB10 plasmid pJB10, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

343. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_015965 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid R621a, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

344. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KP987217 (Klebsiella pneumoniae strain 628 plasmid p628-CTXM, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

345. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KM377238 (Escherichia coli strain HV114 plasmid pHV114, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

346. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KM377239 (Escherichia coli strain HV292 plasmid pHV292, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

347. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KP198616 (Escherichia coli strain C0996A plasmid pCTXM123_C0996, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

348. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KM377240 (Escherichia coli strain HV295 plasmid pHV295, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

349. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP018625 (Escherichia coli strain FORC_044 plasmid pFORC44_1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

350. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP018625 (Escherichia coli strain FORC_044 plasmid pFORC44_1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

351. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024918 (Klebsiella pneumoniae strain NH54 plasmid pKPNH54.2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

352. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP045763 (Salmonella enterica subsp. enterica serovar Heidelberg str. 41578 plasmid p1CFSAN000318, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

353. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP028485 (Escherichia coli strain E41-1 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

354. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP010142 (Escherichia coli strain D3 plasmid B, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

355. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP032445 (Salmonella enterica subsp. enterica serovar Fresno strain USMARC-69835 plasmid pSFR1-USMARC-69835, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

356. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP018116 (Escherichia coli strain MRSN346638 plasmid pMRSN346638_119.3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

357. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP018110 (Escherichia coli strain MRSN346595 plasmid pMRSN346595_120.3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

358. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP014622 (Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1727 isolate SAN1261-1 plasmid pSAN1-1727, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

359. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_LS992187 (Escherichia coli isolate Escherichia coli str. 3426 plasmid 3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

360. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP053786 (Escherichia coli isolate 2-101 plasmid p2-101, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

361. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP033963 (Klebsiella pneumoniae strain L482 plasmid p4_L382, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

362. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_LS999562 (Escherichia coli isolate EC-TO143 plasmid 3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

363. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP053788 (Escherichia coli isolate J31 plasmid pJ31, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

364. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KF290378 (Salmonella enterica subsp. enterica serovar Typhimurium strain STm2 plasmid pSTM2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

365. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_EU418931 (Escherichia coli strain JIE174 plasmid pJIE174, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

366. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP048295 (Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

367. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_013120 (Escherichia coli plasmid pEK204, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

368. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_025198 (Escherichia coli plasmid pJIE512b, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

369. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP019252 (Escherichia coli strain 13KWH46 plasmid p13KWH46-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

370. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP019252 (Escherichia coli strain 13KWH46 plasmid p13KWH46-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

371. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP006641 (Escherichia coli PCN061 plasmid PCN061p5, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

372. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN915010 (Escherichia coli strain TJ-33 plasmid pNDM-TJ33, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

373. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN915012 (Escherichia coli strain GD-33 plasmid pNDM33-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

374. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN915013 (Escherichia coli strain TD-33 plasmid pNDM-TD33, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

375. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP028315 (Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067217 plasmid pSC-31-1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

376. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP019249 (Escherichia coli strain Combat13F7 plasmid pCombat13F7-4, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

377. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_023329 (Escherichia coli strain B3804 plasmid pIFM3804, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

378. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP022060 (Salmonella enterica strain FDAARGOS_312 plasmid unnamed1 sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

379. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP022064 (Salmonella enterica strain FDAARGOS_312 plasmid unnamed4, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

380. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP022064 (Salmonella enterica strain FDAARGOS_312 plasmid unnamed4, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

381. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP022065 (Salmonella enterica strain FDAARGOS_312 plasmid unnamed5 sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

382. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP027374 (Escherichia coli strain 05-3629 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

383. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP016572 (Salmonella enterica subsp. enterica serovar Heidelberg strain AMR588-04-00320 plasmid pAMR588-04-00320_99, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

384. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CM019852 (Escherichia coli strain CVM N17EC0326 plasmid pN17EC0326-2, complete sequence, whole genome shotgun sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

385. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP038417 (Escherichia coli O157:H7 strain 3-5-1 plasmid pGM351-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

386. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP014662 (Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1783 plasmid pSAN1-2010K-2577, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

387. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP044183 (Salmonella enterica subsp. enterica serovar Heidelberg strain AR-0404 plasmid pAR-0404-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

388. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP045756 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000752 plasmid p2CFSAN000752, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

389. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP025239 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE2-1928, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

390. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MK181557 (Escherichia coli plasmid p14019095, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

391. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MK181558 (Escherichia coli plasmid p15076331, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

392. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MK181559 (Escherichia coli plasmid p199, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

393. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MK181560 (Escherichia coli plasmid p14006165, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

394. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MK181561 (Escherichia coli plasmid p14011252, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

395. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MK181562 (Escherichia coli plasmid p15090172, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

396. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MK181563 (Escherichia coli plasmid p15095941, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

397. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MK181564 (Escherichia coli plasmid p15124679, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

398. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MK181565 (Escherichia coli plasmid pESBL20140131, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

399. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MK181566 (Escherichia coli plasmid p15078279, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

400. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MK181567 (Escherichia coli plasmid pESBL20150097, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

401. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MK181568 (Escherichia coli plasmid pESBL20150178, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

402. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP034252 (Salmonella enterica subsp. enterica serovar Derby strain Sa64 plasmid pSa64-96, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

403. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP030000 (Salmonella enterica subsp. enterica serovar Brandenburg strain SA20113174 plasmid pSA20113174.1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

404. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP027333 (Escherichia coli strain 2013C-3277 plasmid unnamed2) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

405. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MF152729 (Escherichia coli plasmid pCTXM1-MU2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

406. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_024979 (Escherichia coli strain ESBL-305 plasmid pESBL-305, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

407. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_024980 (Escherichia coli strain ESBL-315 plasmid pESBL-315, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

408. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP042618 (Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-3_MCR3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

409. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_024975 (Escherichia coli strain E17.16 plasmid pE17.16, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

410. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_024977 (Escherichia coli strain ESBL-12 plasmid pESBL-12, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

411. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_024978 (Escherichia coli strain ESBL-283 plasmid pESBL-283, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

412. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP040548 (Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-p3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

413. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_019043 (Escherichia coli plasmid pND11_107, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

414. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP029110 (Escherichia coli strain AR436 plasmid unnamed2) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

415. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP052382 (Klebsiella pneumoniae strain D16KP0008 plasmid pD16KP0008-1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

416. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP053867 (Salmonella enterica subsp. enterica serovar Typhimurium strain SL7207 plasmid pSL7202-2a, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

417. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP053868 (Salmonella enterica subsp. enterica serovar Typhimurium strain SL7207 plasmid pSL7202-2b, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

418. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024854 (Escherichia coli strain AR_0006 plasmid tig00000311, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

419. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP045519 (Salmonella enterica subsp. enterica serovar Anatum strain Sal-5091 plasmid pSal-5091_CMY, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

420. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP045467 (Salmonella enterica subsp. enterica serovar Anatum strain Sal-3973 plasmid pSal-3973_DHA_CMY, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

421. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP021208 (Escherichia coli strain strain Z247 plasmid p2474-3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

422. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_005014 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid R64, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

423. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_023290 (Salmonella enterica subsp. enterica serovar Typhimurium strain 9134 plasmid p9134dT, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

424. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP040270 (Escherichia coli strain 1500 plasmid pEc1500_CTX, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

425. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_LT985231 (Escherichia coli strain 730 genome assembly, plasmid: RCS37_pII) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

426. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_023275 (Salmonella enterica subsp. enterica serovar Typhimurium strain 9134 plasmid p9134, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

427. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_023276 (Salmonella enterica subsp. enterica serovar Typhimurium strain 9134 plasmid p9134dAT, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

428. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP039490 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000752 plasmid pCFSAN000752, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

429. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP039490 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000752 plasmid pCFSAN000752, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

430. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP031615 (Klebsiella pneumoniae strain ZYST1 plasmid pZYST1C2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

431. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP023376 (Escherichia coli strain 1283 plasmid p92, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

432. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024822 (Escherichia coli strain CREC-591 plasmid pCREC-591_1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

433. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024976 (Escherichia coli strain CV839-15 plasmid pCV839-15-p2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

434. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP030191 (Salmonella enterica strain SA20104250 plasmid pSA20104250.1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

435. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to KU932026 (Escherichia coli plasmid pEC14II_1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

436. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to KU932027 (Escherichia coli plasmid pEC14II_2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

437. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to KU932032 (Escherichia coli plasmid pEC16I_1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

438. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to KU932033 (Escherichia coli plasmid pEC16I_2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

439. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MG516908 (Escherichia coli plasmid pEc42, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

440. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_025142 (Escherichia coli plasmid pC60-108, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

441. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_025147 (Escherichia coli plasmid pV404, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

442. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP016533 (Salmonella enterica subsp. enterica serovar Heidelberg strain SA01AB09084001 plasmid pSA01AB09084001_92, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

443. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP024146 (Escherichia coli strain 14EC029 plasmid p14EC029e, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

444. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_019123 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH1148_107, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

445. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_019131 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH146_87, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

446. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_019137 (Salmonella enterica subsp. enterica serovar Derby plasmid pSD107, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

447. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_019099 (Salmonella enterica plasmid pNF1358, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

448. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KJ406378 (Shigella sonnei strain SS084469 plasmid pSH4469, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

449. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP030025 (Salmonella enterica subsp. enterica serovar Ohio strain SA20120345 plasmid pSA20120345.1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

450. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP042944 (Escherichia fergusonii strain ATCC 35471 plasmid pATCC-35472_2) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

451. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP016516 (Salmonella enterica subsp. enterica serovar Heidelberg strain 11-004736-1-7 plasmid p11-004736-1-7_99, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

452. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP025751 (Escherichia coli strain CV839-06 plasmid pCV839-06-p1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

453. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP051282 (Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Junco_ST-35 plasmid pST35-95663.1B, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

454. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP014972 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY1-1898, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

455. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP032495 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_118, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

456. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP012936 (Salmonella enterica subsp. enterica serovar Heidelberg strain N13-01290 plasmid pN13-01290_98, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

457. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_014234 (Escherichia coli ETEC 1392/75 plasmid p746, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

458. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_019097 (Escherichia coli plasmid Plm, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

459. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP023370 (Escherichia coli strain 1428 plasmid p96, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

460. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP023385 (Escherichia coli strain 1223 plasmid p87, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

461. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP012923 (Salmonella enterica subsp. enterica serovar Heidelberg strain SA02DT10168701 plasmid pSA02DT10168701_99, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

462. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_011419 (Escherichia coli SE11 plasmid pSE11-1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

463. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP012929 (Salmonella enterica subsp. enterica serovar Heidelberg strain 12-4374 plasmid p12-4374_96, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

464. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP040542 (Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-p3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

465. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_002122 (Shigella sonnei plasmid P9 DNA, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

466. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP023382 (Escherichia coli strain 127 plasmid p95, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

467. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN419434 (Escherichia coli strain 2016-40-21249 plasmid p21249, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

468. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN419435 (Escherichia coli strain 2016-40-14263 plasmid p14263, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

469. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN419438 (Escherichia coli strain 2016-40-24003 plasmid p24003, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

470. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP025279 (Salmonella enterica subsp. enterica serovar Montevideo str. USDA-ARS-USMARC-1913 plasmid pSLU-1913, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

471. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP053560 (Escherichia coli strain EC1 plasmid pEC1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

472. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP053677 (Escherichia coli strain EC38 plasmid pEC38, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

473. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_011081 (Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 plasmid pSL476_91, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

474. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP023356 (Escherichia coli strain 746 plasmid p95, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

475. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP041679 (Escherichia coli strain ESBL 15 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

476. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP015916 (Escherichia coli strain 210205630 isolate 210205630 plasmid pSLy4, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

477. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP049876 (Salmonella enterica subsp. enterica serovar Adjame strain 388789 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

478. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to LC480203 (Escherichia coli B64 plasmid pB64 DNA, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

479. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP016585 (Salmonella enterica subsp. enterica serovar Heidelberg strain SH14-009 plasmid pSH14-009_99, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

480. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP043947 (Escherichia coli strain AR202.2 plasmid pMPTEM-30, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

481. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP029837 (Salmonella enterica subsp. enterica serovar Typhimurium strain 10ST07093 plasmid p10ST07093A, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

482. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP016522 (Salmonella enterica subsp. enterica serovar Heidelberg strain SA02DT09004001 plasmid pSA02DT09004001_101, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

483. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to LC485173 (Escherichia coli B1 plasmid pColBM-B1 DNA, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

484. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP049611 (Escherichia coli strain 06-3538 plasmid p06-3538-2) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

485. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP016865 (Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2010K-1587 isolate USDA-ARS-USMARC-1908 plasmid pSTY2-2010K-1587, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

486. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP053678 (Escherichia coli strain EC28 plasmid pEC28, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

487. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_007635 (Escherichia coli plasmid pCoo, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

488. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP018104 (Escherichia coli strain MRSN352231 plasmid pMR0716_tem1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

489. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP032888 (Escherichia coli strain SCEC020022 plasmid pCTXM14_020022, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

490. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_024955 (Escherichia coli strain AHC4 plasmid pHNAH4-1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

491. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP043943 (Escherichia coli strain AR216.2b plasmid pMPTEM-30, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

492. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP027415 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_320 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

493. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP027415 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_320 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

494. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP027409 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_317 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

495. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_023915 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTM709 DNA, complete genome) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

496. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP028312 (Salmonella enterica subsp. enterica serovar Heidelberg strain CFSAN067218 plasmid pSH-04-1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

497. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_AP014805 (Escherichia coli O119:H6 strain EC404/03 plasmid pEC404/03-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

498. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to CP054413 (Escherichia coli strain SCU-204 plasmid pSCU-204-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

499. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_LT985248 (Escherichia coli strain 720 plasmid RCS48_pI, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

500. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP026941 (Escherichia coli strain CFS3313 plasmid pCFS3313-2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

501. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP041441 (Escherichia coli strain YPE12 plasmid pYPE12-122k, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

502. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_LT985273 (Escherichia coli strain 03-235 plasmid RCS72_pI, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

503. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_LT985280 (Escherichia coli strain 13947 plasmid RCS75_pI, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

504. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_LT985286 (Escherichia coli strain 13948 plasmid RCS76_pI, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

505. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_LT985256 (Escherichia coli strain 580 plasmid RCS49_p, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

506. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_LT985268 (Escherichia coli strain 699 plasmid RCS58_p, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

507. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_LT985235 (Escherichia coli strain 654 plasmid RCS34_p, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

508. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MH674341 (Escherichia coli strain EC07 plasmid pUR-EC07, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

509. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MN540570 (Escherichia coli strain E.coli4feg plasmid pIV_IncI1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

510. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP041394 (Escherichia coli strain ECOL-18-VL-LA-PA-Ryan-0026 plasmid p45407_2) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

511. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP045951 (Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00010529 plasmid pAUSMDU00010529_02, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

512. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN262643 (Escherichia coli strain EC009 plasmid pEC009.2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

513. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN124285 (Escherichia coli strain RKI3099 plasmid pRKI3099a, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

514. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP053081 (Escherichia coli strain HB37 plasmid pHB37-1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

515. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MH847038 (Escherichia coli strain 04-021 plasmid p04-021, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

516. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MG948334 (Escherichia coli strain 2305 plasmid p2305, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

517. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MH847571 (Escherichia coli strain 17-461F plasmid p17-461F, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

518. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MH257955 (Escherichia coli strain 104 plasmid pHXH-3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

519. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MH422553 (Escherichia coli strain L-I1 plasmid pIncI1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

520. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KY748189 (Escherichia coli strain EC007 plasmid pEC007, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

521. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KY865323 (Escherichia coli strain SY286M plasmid pECM13, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

522. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MG764547 (Escherichia coli strain 14E509 plasmid p14E509-CTXM, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

523. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MH472638 (Escherichia coli strain ESBL20160056 plasmid pESBL20160056, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

524. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MF344577 (Klebsiella pneumoniae strain N201205880 plasmid p205880-NR2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

525. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KY748188 (Escherichia coli strain EC006 plasmid pEC006, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

526. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MG825376 (Escherichia coli strain 1108 plasmid p1108-CMY2, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

527. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_KY748190 (Escherichia coli strain EC008 plasmid pEC008, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

528. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MG844436 (Escherichia coli strain EC13 plasmid pCMY-136, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

529. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP016568 (Salmonella enterica subsp. enterica serovar Heidelberg strain AMR588-04-00318 plasmid pAMR588-04-00318_99, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

530. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_MG948333 (Escherichia coli strain 2454 plasmid p2454, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

531. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NC_019104 (Salmonella enterica subsp. enterica serovar Kentucky plasmid pCS0010A_95, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

532. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MF554637 (uncultured bacterium clone AA-100 plasmid pPIMMR, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

533. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP048361 (Escherichia coli strain 53 plasmid p53_B, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

534. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to MN548042 (Klebsiella pneumoniae strain QD23 plasmid pQD23-1, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

535. spacer 3.4|424044|33|NZ_CP006803|PILER-CR,CRT matches to NZ_CP040536 (Klebsiella pneumoniae strain CR-HvKP1 plasmid pCR-HvKP1-p3, complete sequence) position: , mismatch: 10, identity: 0.697

cttttttagctgcttgataatctttatcgcatt	CRISPR spacer
gtccttttgctgctggataatctttatcaacca	Protospacer
 *..*** ****** *************.  . 

536. spacer 4.10|434907|32|NZ_CP006803|CRISPRCasFinder,CRT matches to MN694044 (Marine virus AFVG_250M514, complete genome) position: , mismatch: 10, identity: 0.688

tgctacaccaagcatttcagcaccatcttgta	CRISPR spacer
agctgcaccaagcatttcaacaccccaagggt	Protospacer
 ***.**************.**** .   *  

537. spacer 4.13|435090|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP024789 (Nostoc flagelliforme CCNUN1 plasmid pNFSY04, complete sequence) position: , mismatch: 10, identity: 0.688

actgctaaggctcgaaatttagctgatgtgaa	CRISPR spacer
tctgtgaaggctcgaaatttagctttagcttc	Protospacer
 ***. ******************   *.   

538. spacer 4.18|435396|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_CP041669 (Legionella israelensis strain L18-01051 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

agaatcaaatagaatcataagaattattaata	CRISPR spacer
cttggcaaatagaatcatatgaattttttctt	Protospacer
   . ************** ***** **  * 

539. spacer 4.19|435457|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 10, identity: 0.688

aaaaatcatggatttatcagaattagaaaagg	CRISPR spacer
ttgaatcatagatttaacagaattaggcagaa	Protospacer
  .******.****** *********. *...

540. spacer 4.47|435883|33|NZ_CP006803|PILER-CR matches to NC_014841 (Pantoea sp. At-9b plasmid pPAT9B04, complete sequence) position: , mismatch: 10, identity: 0.697

tgaaaaagaagcctgacgatgaaaaacaatttg	CRISPR spacer
atcagtgaaaacctgacgatgaataacaatttc	Protospacer
   *. ..**.************ ******** 

541. spacer 4.3|434480|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_030948 (Ralstonia phage RSP15 DNA, complete genome) position: , mismatch: 11, identity: 0.656

accgtattcccaattagcataggttgaaagtc	CRISPR spacer
gttgtattcccaatttgcaaaggttgccttat	Protospacer
...************ *** ******     .

542. spacer 4.21|435579|32|NZ_CP006803|CRISPRCasFinder,CRT matches to NC_049857 (Lactococcus phage P1048, complete genome) position: , mismatch: 11, identity: 0.656

aagactcaatctgaagaagtaaaagatgaagt	CRISPR spacer
tttgacaaatcagaagacgtaaaagatgaacg	Protospacer
   . . **** ***** ************  

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site
DBSCAN-SWA_1	663789 : 674147	9	Erwinia_phage(16.67%)	tRNA,protease	NA

Sequences of DBSCAN-SWA_1

Nucleotide sequences of DBSCAN-SWA_1

>NZ_CP006803|663789:674147|DBSCAN-SWA
ATTACAAAATAAATTTTGTTAAGTCCTTATTGATAATTATATCACTCAATTTTTGGTCAACATACTTTTGAGTAATAGTAATTTCGCCCATGTTCATATCTGGTCCCTCATAAAGCACATCTTCAAGCAGCTTTTCTAAGATAGTTGCTAAACGACGAGCACCGATGTTGTCAGTACCTTGATTTACTTCAAAGGCAATTTGAGCAATACGATCAATTGCTTCTTGAGTAAAGACTAGCTTAATGCCATCAGCCTTAAGAAGTGCAATATATTGTTTCAAAAGTGAATTTTGAGGATCCTTCAAGATCTTGACGAAATCTTCTTGAGTTAAGGCGTTTAATTCAACCCGAATTGGAAAACGACCTTGCAATTCTGGAATCAAATCACTTGGCTTACTTTCAGCAAAGGCGCCAGCTGCAATAAAGAGAATATGATCAGTTGATACAGGGCCATACTTAGTTGAAACGGTTGATCCTTCAACAATTGGCAAGATATCTCTTTGAACACCTTCACGAGAAACTTCACCAGAAGTCTTCTTGTTACCAGCGGTAATCTTGTCAATTTCATCGATAAAGATAATTCCATTTTGCTGAGTACGCTCTATTGCTCGTTGGTAGAGAGAATCGTAATTAATTAACTTCTTAGATTCTTCTTGAATTAAAACTTCACGTGCATCTGACACCTTCAAAGTACGCTTAACAGTCTTCTTAGGCATTAAGTCACCCATCAAGCTCGACATATCAATTCCCATTTGGCCCATCATGTCGCCCATTGGGTTAACCTTAGGTGCTTGTTCAACTTCAATTGTTACTTCACGATTTTCAAGTAAGCCCTTATTAAGTTGATCAGCTACGCTAAGACGTTCATTGCGAATATCGTCAGTTACCTCTTCATTATCTTGAGCTTGATTCATGTTGAAATTGCCAGAAAGCATCTGCATCATTTGCTGCATTGAATTTTCGCGGTTTTCACGCTTAATACCTGGAACAATTAACTTAACTAAACGGTTATTTGCTTTCTTAGTTGCTTGCAACTTAACACGATCGAATTGTTCTTTTTCTTCCATGCGAACTGCTTCTTCAACTAAGTCACGAACCATTGACTCAACATCACGTCCAACATAACCTACTTCAGTAAACTTAGTTGCTTCTACTTTTACAAAAGGTGCGTCAACAATTTTAGCCAAGCGACGTGCAATTTCAGTCTTACCAACACCGGTAGGACCAGCCATTAACATGTTCTTGGGAGTAATGTCTTGTTGCATTTGCTTAGGTAGTTGCAAACGACGGTAACGGTTATATAAGGCTACCGCAACAGACTTTTTAGCTTCATTTTGGCCAATAATATATTTATCAAGTAATTCTACAATTTGTTTTGGAGTTTTTTCTTCAGTCAAAATATTTCACCTAGATTTCATCAGTAGTAATGTGGTCATCAGTAAAGACATCAATTCCAGAAGCAATCTTAACTGCTTCTTTGGCAATTTCACTTGCGCTCATCCCGCTACTGTGGCGAGTCATTGCAATTGCTGCTGCTTGTGCAAAGTTACCGCCTGAACCAATAGCTACCACATCTTCATCTGGTTCAAGAACTTCACCATTACCAGAAATCAATAATAAATCCTTGTCATTAAAGGCAATTACCATCGCTTGCAATTTAGCTAAAGTTGGATCCTTTCTCCAGCTTTGTGCCATTTCAACAGCAGCTCTACGTAAATCACCTGAATAAGTTTCAAGCTTTCCTTCAAGCATATCTTGTAAGCTAACTGCATCTGCCACACCACCGGCAAAACCAATTACTACTTGATCGTGGTAAATTCTTCTGATCTTTTTGGCAGTTGCCTTAGCAATTACCTTTTCACCTAAGGTAACTTGACCATCGCCTGCGATGGCTGTTTGATTGTTGTATCTAACAGAACAAATTGTCGTCATATTATTATGCCTCGTCTTTCTTATCTTTTCTTGGGAAAAATTTTTGATAATCAGCTTGTAAATGCTTCATCGTAACGTGCGTATAAATCTGCGTCGTAGATAAAGATTCATGCCCTAATAATTCCTGAACACTTCTCAGGTCTGCCCCATTATTGAGCATTTCAGTCGCAAAAGAGTGTCTAAGCATATGGGGATGAACCTTTCCTCCAACTCCAGCCTTAATGAAAACTTGCTGCATAATGTATTCAATCCCGCGACCAGTTAATTTTTGACCGCGATTATTCAAAAATACATAGCCCCAATCTTCATTTTGACCAAGTAGAGCTGGCCGAACATCATCACGATATTCTCTTAAAGCATCAAATGCATCTTTTCCAAAAGGAACATAGCGATCTTTATTACCCTTCCCATGAACTAAGATAATCTTTAAATCAAAATCAATCTGATCTAGCTTCAAAGAAGCCATCTCACTTAACCGCATCCCTGTAGCATAAAAAAGCTCAAACATGGCGCGATTTCTCACTACCAACTTATCATGACCAGCAAGACTATCAAAGACTTGTCGCATCTCTTTTTCATAGAAGAACTGTGGTAGCTTCTTCTCTCCTAATCTTAAGCTAATTGTCTGCATGGGATCATTTTCTAACACTTCTCGCTTAACAAGGAAGCGATAAAAAGATCTCAAGCTCGACATCTTACGTGCCTGGGTTGTTCTAGACCTATTCTGTGCAGCTAAACTTTGTAAGAAAATCTCGACATCGCGACTTTTTACTTTATCCCAGCCGCCAAAGCCACCATTTTCTTTAAAAAATTGTTTTGCTTCATCTAGATCATTTAAGTAAGAGCTTACAGTATTTTTACTATAATTACGTTCATAGTTCAAGTAATCTTGAAATTGTTCGATTAACTTATCATTTTCTTTAGACATTATTAATCAAGCTTCTTTTCTTCCTTAAAGGTTTCAAGATCTTTCAATGCTCGTTTAGAAATTTCCAAGTGTCTTTCTTGTTTATTTCTAACCTTATAATCTAATTTTGGTAATAATGCATAAGATGCGTTCATTGGCTGGAAGTGTTTAGCACTAGTAGTTGTGATGTAATGAGCCATTGAGCCTAAGGCTGTTGACTTAGGGAAAACTAATGTTTCTTCGCCTAAGGCTTCTCTAGCTGCATTAATTCCGGCAATTAGTCCAGAACCTGCACTTTCTACATAGCCCTCTACTCCAGTCATTTGTCCCGCAAAAAACAAACCAGCTTGTTTTCTAGCCTCATAATTTGCATTTAAAACTTCTGGACTAGCAATGTAAGTATTGCGGTGCATTTTACCATAACGGACAAATTTTGCATTCTCAAGACCTGGAATCATTGAAAAGACTCTCTTTTGCTCGCCATATTTCAGGTGGGTTTGGAAACCAACAATGTTGTACATCGTGCTTGCCGCATTATCTTGGCGCAACTGCACAACTGCGTAAGGAGTCTTCCCGGTCTTAGGATCTTCTAAGCCAACAGGCTTAAGTGGTCCAAAGAGCATCGTTTTTTCTCCTCTTTTAGCCATAACTTCAATTGGCATGCAGCCTTCAAAGACATTTTTATCTTCAAAGCCGTGCAAAGTAGCTGTTTCCGCACTGACTAAGTTTTTATAGAAATTAAAGAATTCTTCCTTAGTCATTGGACAGTTCAAATAAGCTGCTTCACCCTTGTCATAGCGCGATTTCTTATAAACAATGTCGTGATCAATTGAGCTTGCAGCTACAATTGGCGCCGCAGCATCAAAGAAGTGAAGTGAATCAGTACCACAGAATTCCTTAATCTGTTCTGCTAATGTATCTGAAGTGAGCGGACCAGTTGCAATAATAGTGATTCCATCTTTTGGTATCTTAGTAATCTCTTCTTCATGAACATGTACATTTGGCAAGTCTTTGAGAGTTTGTGTTACCACTGAACTAAACTTATCCCGATCAACTGCTAGAGCTCCACCAGCAGGTACAGCTGTTTCATCAGCAGCTTTCATAATTAAAGAATCAAGCTGACGCATTTCCTCTTTTAACAAACCAACAGCGTTTGAGAGTTGGTTAGATCTCATTGAATTAGTACATACTAATTCGGCAAAATTAGCAGTTTCATGAGCAGGTGTAGTTTTCTTTGGTCGCATTTCATATAACTCTACTTCAATGCCACGCTTAGCTAATTGCCATGCAGCTTCACTTCCTGCAAGGCCACCGCCAATTACGGTTACATTCTTTACCATGCAATCTTTCCTTTCTGCTCGACTCTTTCAAGTCTATATAAAAATGATATCATTAAACCGCTTTCGTTTTAATGATATCATTGATTTTTATACTAATTTAATTTTCTTCTGGTTCTTCACGATAATCGCCGTTTGGACAAAGAATAACTAAGCCCTTCTTATTCTTCTTTTGAACTAAGAAATGGCCATCATTTGGACAATTGCGACCAATTGGTTGATCCCAAGATACAAAGTCACAATCTGGATAACGAGAGCAGCCATAGAACTTACGATTACGTTTAGACTTCTTTTCAATAACTTCTCCCTTACCACACTTAGGACAAGTTACGCCAACTTTTTTAACAATTGGCTTAGTGTTACGGCAATCTGGAAAGCGCGAGCAAGCATAAAACTTACCATAACGTCCCATCTTAATCACCATCGGTGCACCACAAATGTCGCAGTTAAAACCAGCTGGTTCATCCTTAATTTGAACTTTTTCAATTTGTTGATCAGCCTTGTCTAATTCTTTAGAAAATGGCTTGTAGTATTCATCTACTACTTTGATCCAGTTCTTCTTTCCTACTTCAACGCCGTCAAGATCATCTTCTAGTTGAGCGGTGAAATCGACGTTAACAATATCTGGGAAGAATTCTTCGATTAACTTATCGACAATTTCACCTAATTCAGTCGGTACAATTGATCTTCCTTCAAGTTTTACGTAATAACGTTTTTGAATCGTATCAATTGTTGGTGCATAAGTTGATGGACGACCAACGCCATTTTCTTCAAGAGCTCTAACTAAACTGGCTTCAGTATATCTTGCTGGTGGCTGAGTAAAGTGCTGACGATCATCGGTCTTTTTAAGCTTAACCTTATCGCCTTCATTTAACTCAGGTAATTCATTATTCTTTTCTTTTTGGTTATCGTAAACCTTAGTAAAACCAGCAAACTTAAGTTTTGAACCAGTTGTTCTAAAGGTAACGTCATTTTGTTCAATATCAGCTCTTACTGTATCGTAAACAGCTGGAGTCATTTGACTAGCAATAAATCTTGACCAAATTAAGGTGTAGAGACGATATTCTTCAGTAGTCAAATATTCTTTAACTGAAGCTGGTGTTCTGAAAGCTGAAGTTGGACGAATTGCTTCGTGAGCATCTTGAGCATCAGCATCGTTTTTAAAATGTTGCGGCTTGATTGCTGCATAATTTGCACCATATTCTTCATGGATGAATTTTGAAGCTTCATGCTTAGCAACATTAGCAATACGTTTAGAATCAGTACGCATATAAGTAATTAAACCAACTGATCCCTTACCCAGGTTAACCCCTTCATAAAGAGATTGAGCAATTCTCATTGTTCGACGAGTACGATATCCTAAACGCTTGTTAGCTTCTTGCTGCATAGTTGAAGTAGTAAAAGGCGCAGCAGGCTGACGTCTTCTTTCTTTTTTAACTACTTTGGTAACTTCAAAGTTCTTACGCTTATCAATCTGTTTTAAAATATCTTGAACTGCTTCATTATTTGGTAAGTCTTGTTTCTTACCCTTAATGCCATAAAAGGCTCCCTTGAACTTTTCCTTACCCTTTTCAAAATCAGCATCAATTGTCCAGTATTCTTCTGGCTTAAAGTTCTTAATTTCGTTTTCACGGTCAATTACTAACTTCAAGGCAATTGATTGAACACGTCCAGCAGATAAGCCCTTCTTAACTTTTTGCCACAAGATAGGACTAATTGAATAACCCACCAAGCGGTCCAGAACACGGCGTGCTTGTTGAGCATCTACAATATCCATATCAATGGTTCTTGGATTCTTAAAGGCATTTTTAACCGCATCTTTAGTAATTTCGTTAAAAGCAACACGGTTGTGCTCTTTAGGATCTAAATTCAAAGCATGAGCAACGTGCCAGGCAATAGCTTCTCCTTCACGATCGGGGTCGGAAGCGAGATAAACATACTTTGCCTTTTTGGCTTCGCTCTTTAATTCTTTAATCGTATCGCCTTTTCCGCGAATAGAAATATACTTTGGTTCATAATCGTGTTCGACGTCAACACCCATTTGGGACTTGGGTAAATCGCGAATATGACCTTTTGAAGCGATAACATGATAATTTCTACCTAAATATTTTTCAATTGTCTTAGCCTTATGTGGAGACTCGACAATAACTAAATTCTTTTTATTTTTTCGTTTAGTAGGCATAGAATGCCCCTTCCTTGCACAATTTCTACCAAATTCTAAAATACCAAAAATTTCACTCTTGTCAACTAAAGCAAGTTTCTAAAATCGGCATTGACTAGTGGATATGCACCAGCAGCAATTAGCTCGTTAGGCCCTTCAGACAAAGGACTTGAGACTGGTCCAGGAACTGCAAAAATATTTCGATTTTCATCTAAAGCAATATTTGCAGTTATTAAAGAACCAGATCTTTTTCTAGCTTCAGTGACAATAATATTTTTACTTAAACCCGCCAGGATACGATTTCGCTCAGGAAAACGATAAGGACGCGGCGGTGTATCTGGCAAATATTCACTAATTAATAAGCCTTTAGCCACAATTTCTTCTTGCAGCTCCTTGTTTTCTTGCGGATAAAAATGATTCAATCCGTTCCCAACCACAGCAATTGTTTTACCGTGATTCTTTAAGGTTTCTTGATGGGCAATTCCATCAACTCCGCGAGCTAGACCGCTAGCAATTACAAAATCTTGTTCTATTAGCTGCGGAATTAACTGCTTTAAAACAAACCGGCTGTAATTTGTCGGCTGTCTTGCGCCAACTATAGTCGTAATTTCTTTTTTAAGCAAGGATAAATTTCCTCTAGTAAAAAGAATCGTTGGTGCATTATACATCTCACGCAATCCTTCTGGATAAATTGAATCAAAGATAGTGATAACATCGCGCTGCAATTCAATTCTTTCAATCCAAGAATTAAATTTGTCATTTCTCATCGCAGTCAAAACAAGATTTTGGATATTTGATTTTAATGATAAACTTTCTATTTTGTCAACTGTTACTTCTTCACCAGCTGTAAAATTTTCAGCTATTTTACCCAAAGTTGCAGTACCGACGCCATGTTGCAATTTTAATCTTAAGCAAAATTCTTTTAAATTCATAAAATAAAACCTCCACTATCAAGTACGCAAAAGTGAAGGTTTATTTTTTATTTATTTCTCGTATTCGCTAACTGGTGCAAAAGATCGCCGGTGAATTGGCGTTGGACCGTACTTTTTCAAAGCTTCCATGTGCTCACGCGTTCCATATCCTGCATTATGCTTAAAGTCGTATTCTGGGTAAACCTCGCCATAAGCATCCATTAAATTGTCACGAAAAACTTTGGCTACAATACTAGCAGCTGCAATTGAATTAGACTTAGCATCCCCGTGAATTAATTTAACTTGCGGAATATTTAAAGGCACATTCATTGCATCAACTAATAAAGCATCTGGCTTTACTTTTAAGCCTTGAACTGCATGCGCCATTGCCAGGCGGTCAGCTTCATAAATATTAATCCGATCAATGACATCATTATTAGCTAAACCGACGCTAACGCTGACTGCTTTGGCTAAAATTTTAGGAAACAGTTCCTTTCTCTTTTTAGGAGATAGTTTCTTTGAATCGTTAACATCAATCAAATCAAAATTATGTGGCAAAATAACAGCAGCTGTAACTACAGGACCAGCAAGTGGTCCTCTTCCTACTTCATCTACTCCAGCAACGAGCTGACTTTTTTGCCAAAATTTTTTCTCATAAGAAAAACGATTTTGAAATTGGGCAACTGCTTGCGCACGTTTAGCTTGTCTTTTTTCATAGCTAATTAAGAGCTTTTGGACGCCCTTTCTTTCATCAGCACGTAATTCTTCTAATTGTTCACTACTTACTTCTCCTTGAAGTAAGCTTCTTATTTCAGTAATGGTCATCTAAGATCAAACGTAATCCTTCCCAATTTTCCTTTACGTAAACGTTGAAGCATAAAGAGTGAAAACTTGTCATAATCATCCCGCATGCCATATTTGTTAGTCATAGCTAGTAATAAATCCGGATTAGACATATTTTCAAGCTCTTCATTTGTTGCTTGTGCAAATTTGGTAAGATCTTTTTTATAGTTTTGCTTCAAAAATTCAATCACAAATAAGGCAACATCATCAGGATGGAAAACATCGGCCTTAATTGCGCCACAAGCTGCTAACTTATAGCCTACTTCTTGATCAGAAAACTTGGGCCACAAAATACCGGGTGTATCTAAAATTTGAACATTCGTCTTGGTCTTTAGCCAGCTTTGTCCACGCGTTACACCTGGCTTATCTCCTACGATTGCAGCATTTCTTCCAACCATTCGATTGATAATCGTTGATTTTCCGCAATTTGGAATTCCAGCAATTGCTACACGAATCATTGGGTTAGAAGCACCCTTTGCAATCAGCTTCTCTGTCTTTTTCTTACCAGCTAATTTAATAATCTTAAACAAACTCGTCATATTGGTATTATGCTGAGCATCCATTGAGATAACAAAATTGCCTTCATCTTGGAAATAACGAGTCCACTTTTTAGTTTGAATTGGATCAGCCAAATCAGACTTGTTCAAGATAATAATATGAGGTTTCTTCTTGGTTAACTGTCCAATCATTGGATTACGGGAAGAAACTGGAAGGCGCGCATCTAAAACTTCAATTAAGACGTCAATCAAATCTAAATTATCTTCAAGTTGATTTTTAGCCTTATTCATATGTCCTGGATACCACTGAATAGTTGCCATTTTTAGTCCTCCATATCCTTTAGATTTAAACTCAACGCTTTCTTTAAGGCAGGATTATCATCTTGCAATTTTTGAGCAACTGCTAAATAAAGTTGAGCTTGTACTTGCCCATTTACTATACCATCTGTTGTCAAGTCATGTTCCTTTTGGAATTTAATTACAGCATTCTTGGTTTCATCATCAAAAACTCCAGTAACATGCTTTGGTAAATAGCCTAAGGCAGTTAAGTATTGCTGCAAAGTGGCCACATCAACACCAGTCATTGATTTTTTCAAAATGCTCATACTTTGGAATTGTGGCAATTTTGCTAAAGGTGATTCAGAAACTGGATAAGTTGGTTTAAGCCCCTTTTGATTGATCCAGGTTCCATTTGGCGTCAACCATTTAGCAACGGTATATTTATACTCTGAATCCTCAGTTTGTCCAACTTGTTGAACAGTTCCTTTACCATAACTCGTCTGACCAACTGAGACACCGCAATGGTTTTGCACTAAAGCAGCTGTAAAAATTTCACTTGCACTAGCTGTATTTCCATTAATCAAAATAATTGGCTTGAGTGAAGTATGAAAGCCTCCTGAAAGTTTCTTATCAGAGCGAATCACTTCTTTTTCTTTGCGATCCTTGTACTGCATAATAATTTTGTTATTTGGCAAGAAATAAGAAGACGACTTTAAGGCCGCATTCATTTCGCCACCCGGATTATCCTGCAAATCAATAATTAACTTAGGATACTTTTTAGTATTAATTGACTTTAAAGCAACCTTCAAGTCTTTAGCAGTATTCACGTCAAACTGGGTAATTGTAATAATTGTCGCATTACCTTCTGTGCGCTTAGTTAGGCTCGATTGTGAAATTTTAGCGCGCTTTAAAGTAACACTAAAGGTTGAATTAGCACGCTTTAGTTTCAGTGTTACCTTGGTGCCAACCTTTCCCCTAACTAAAGAGGCAACTTTAGTGAACTGAGCCGCGCTGACTTTTTTATTATCAACAGCCACAATCTCATCGCCAGGCTTAATAGTACTCTTTGAAGCTGGAGAATTGGCAACAATAGAGTCCACAACAACTTTATTGTTGCGTACTGCCATCTGAATGCCAACTCCGCCAAAAGTCGAGCCTTCTAAGATGCTATTAACTTGCTCTTGATTAGCACCACTTAATCCTTCTGAAAAGGGATCATTAAGACTATCAAGCATCCCGTTAATTGCCCCTTGGCGCAATGTTTGCGATGAAACTTTTTTATAATATGAACCTTGTAATTGCTCATACACTTTTTCAACTTGATAAAAAGGCGACTTTAATTCCTTAACTTCCATAATTCCAAAGGTCAAACCTGCACCAATTGCCGCACCAGCTATACCAGTTAACAAAAATTGAGCATATTTGGGAAGATGTTTCTTTTTATTTTTTGTAGTCTTCTTTTGATGAGAATTATTGGGTTCTACTTCTGCCAT

Protein sequences of DBSCAN-SWA_1

>NZ_CP006803|663789:674147|668063_670145_-|WP_003647374.1|DBSCAN-SWA
MPTKRKNKKNLVIVESPHKAKTIEKYLGRNYHVIASKGHIRDLPKSQMGVDVEHDYEPKYISIRGKGDTIKELKSEAKKAKYVYLASDPDREGEAIAWHVAHALNLDPKEHNRVAFNEITKDAVKNAFKNPRTIDMDIVDAQQARRVLDRLVGYSISPILWQKVKKGLSAGRVQSIALKLVIDRENEIKNFKPEEYWTIDADFEKGKEKFKGAFYGIKGKKQDLPNNEAVQDILKQIDKRKNFEVTKVVKKERRRQPAAPFTTSTMQQEANKRLGYRTRRTMRIAQSLYEGVNLGKGSVGLITYMRTDSKRIANVAKHEASKFIHEEYGANYAAIKPQHFKNDADAQDAHEAIRPTSAFRTPASVKEYLTTEEYRLYTLIWSRFIASQMTPAVYDTVRADIEQNDVTFRTTGSKLKFAGFTKVYDNQKEKNNELPELNEGDKVKLKKTDDRQHFTQPPARYTEASLVRALEENGVGRPSTYAPTIDTIQKRYYVKLEGRSIVPTELGEIVDKLIEEFFPDIVNVDFTAQLEDDLDGVEVGKKNWIKVVDEYYKPFSKELDKADQQIEKVQIKDEPAGFNCDICGAPMVIKMGRYGKFYACSRFPDCRNTKPIVKKVGVTCPKCGKGEVIEKKSKRNRKFYGCSRYPDCDFVSWDQPIGRNCPNDGHFLVQKKNKKGLVILCPNGDYREEPEEN
>NZ_CP006803|663789:674147|665723_666647_-|WP_095669733.1|DBSCAN-SWA
MSKENDKLIEQFQDYLNYERNYSKNTVSSYLNDLDEAKQFFKENGGFGGWDKVKSRDVEIFLQSLAAQNRSRTTQARKMSSLRSFYRFLVKREVLENDPMQTISLRLGEKKLPQFFYEKEMRQVFDSLAGHDKLVVRNRAMFELFYATGMRLSEMASLKLDQIDFDLKIILVHGKGNKDRYVPFGKDAFDALREYRDDVRPALLGQNEDWGYVFLNNRGQKLTGRGIEYIMQQVFIKAGVGGKVHPHMLRHSFATEMLNNGADLRSVQELLGHESLSTTQIYTHVTMKHLQADYQKFFPRKDKKDEA
>NZ_CP006803|663789:674147|671107_671860_-|WP_095669736.1|DBSCAN-SWA
MTITEIRSLLQGEVSSEQLEELRADERKGVQKLLISYEKRQAKRAQAVAQFQNRFSYEKKFWQKSQLVAGVDEVGRGPLAGPVVTAAVILPHNFDLIDVNDSKKLSPKKRKELFPKILAKAVSVSVGLANNDVIDRINIYEADRLAMAHAVQGLKVKPDALLVDAMNVPLNIPQVKLIHGDAKSNSIAAASIVAKVFRDNLMDAYGEVYPEYDFKHNAGYGTREHMEALKKYGPTPIHRRSFAPVSEYEK
>NZ_CP006803|663789:674147|671856_672696_-|WP_003647377.1|DBSCAN-SWA
MATIQWYPGHMNKAKNQLEDNLDLIDVLIEVLDARLPVSSRNPMIGQLTKKKPHIIILNKSDLADPIQTKKWTRYFQDEGNFVISMDAQHNTNMTSLFKIIKLAGKKKTEKLIAKGASNPMIRVAIAGIPNCGKSTIINRMVGRNAAIVGDKPGVTRGQSWLKTKTNVQILDTPGILWPKFSDQEVGYKLAACGAIKADVFHPDDVALFVIEFLKQNYKKDLTKFAQATNEELENMSNPDLLLAMTNKYGMRDDYDKFSLFMLQRLRKGKLGRITFDLR
>NZ_CP006803|663789:674147|663789_665184_-|WP_003647371.1|protease|DBSCAN-SWA
MTEEKTPKQIVELLDKYIIGQNEAKKSVAVALYNRYRRLQLPKQMQQDITPKNMLMAGPTGVGKTEIARRLAKIVDAPFVKVEATKFTEVGYVGRDVESMVRDLVEEAVRMEEKEQFDRVKLQATKKANNRLVKLIVPGIKRENRENSMQQMMQMLSGNFNMNQAQDNEEVTDDIRNERLSVADQLNKGLLENREVTIEVEQAPKVNPMGDMMGQMGIDMSSLMGDLMPKKTVKRTLKVSDAREVLIQEESKKLINYDSLYQRAIERTQQNGIIFIDEIDKITAGNKKTSGEVSREGVQRDILPIVEGSTVSTKYGPVSTDHILFIAAGAFAESKPSDLIPELQGRFPIRVELNALTQEDFVKILKDPQNSLLKQYIALLKADGIKLVFTQEAIDRIAQIAFEVNQGTDNIGARRLATILEKLLEDVLYEGPDMNMGEITITQKYVDQKLSDIIINKDLTKFIL
>NZ_CP006803|663789:674147|672698_674147_-|WP_095669737.1|DBSCAN-SWA
MAEVEPNNSHQKKTTKNKKKHLPKYAQFLLTGIAGAAIGAGLTFGIMEVKELKSPFYQVEKVYEQLQGSYYKKVSSQTLRQGAINGMLDSLNDPFSEGLSGANQEQVNSILEGSTFGGVGIQMAVRNNKVVVDSIVANSPASKSTIKPGDEIVAVDNKKVSAAQFTKVASLVRGKVGTKVTLKLKRANSTFSVTLKRAKISQSSLTKRTEGNATIITITQFDVNTAKDLKVALKSINTKKYPKLIIDLQDNPGGEMNAALKSSSYFLPNNKIIMQYKDRKEKEVIRSDKKLSGGFHTSLKPIILINGNTASASEIFTAALVQNHCGVSVGQTSYGKGTVQQVGQTEDSEYKYTVAKWLTPNGTWINQKGLKPTYPVSESPLAKLPQFQSMSILKKSMTGVDVATLQQYLTALGYLPKHVTGVFDDETKNAVIKFQKEHDLTTDGIVNGQVQAQLYLAVAQKLQDDNPALKKALSLNLKDMED
>NZ_CP006803|663789:674147|666649_667966_-|WP_095669734.1|tRNA|DBSCAN-SWA
MVKNVTVIGGGLAGSEAAWQLAKRGIEVELYEMRPKKTTPAHETANFAELVCTNSMRSNQLSNAVGLLKEEMRQLDSLIMKAADETAVPAGGALAVDRDKFSSVVTQTLKDLPNVHVHEEEITKIPKDGITIIATGPLTSDTLAEQIKEFCGTDSLHFFDAAAPIVAASSIDHDIVYKKSRYDKGEAAYLNCPMTKEEFFNFYKNLVSAETATLHGFEDKNVFEGCMPIEVMAKRGEKTMLFGPLKPVGLEDPKTGKTPYAVVQLRQDNAASTMYNIVGFQTHLKYGEQKRVFSMIPGLENAKFVRYGKMHRNTYIASPEVLNANYEARKQAGLFFAGQMTGVEGYVESAGSGLIAGINAAREALGEETLVFPKSTALGSMAHYITTTSAKHFQPMNASYALLPKLDYKVRNKQERHLEISKRALKDLETFKEEKKLD
>NZ_CP006803|663789:674147|670210_671056_-|WP_095669735.1|DBSCAN-SWA
MNLKEFCLRLKLQHGVGTATLGKIAENFTAGEEVTVDKIESLSLKSNIQNLVLTAMRNDKFNSWIERIELQRDVITIFDSIYPEGLREMYNAPTILFTRGNLSLLKKEITTIVGARQPTNYSRFVLKQLIPQLIEQDFVIASGLARGVDGIAHQETLKNHGKTIAVVGNGLNHFYPQENKELQEEIVAKGLLISEYLPDTPPRPYRFPERNRILAGLSKNIIVTEARKRSGSLITANIALDENRNIFAVPGPVSSPLSEGPNELIAAGAYPLVNADFRNLL
>NZ_CP006803|663789:674147|665194_665719_-|WP_003647372.1|protease|DBSCAN-SWA
MTTICSVRYNNQTAIAGDGQVTLGEKVIAKATAKKIRRIYHDQVVIGFAGGVADAVSLQDMLEGKLETYSGDLRRAAVEMAQSWRKDPTLAKLQAMVIAFNDKDLLLISGNGEVLEPDEDVVAIGSGGNFAQAAAIAMTRHSSGMSASEIAKEAVKIASGIDVFTDDHITTDEI

Homologous phage analysis in the prophage region

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003647371.1|663789_665184_-|protease	ATP-dependent protease ATPase subunit HslU	A0A1B2IB03	Erwinia_phage	8.0e-30	25.8
WP_003647372.1|665194_665719_-|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_095669733.1|665723_666647_-	tyrosine recombinase XerC	S5W9T9	Leptospira_phage	1.8e-22	28.5
WP_095669734.1|666649_667966_-|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
WP_003647374.1|668063_670145_-	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	4.2e-99	36.5
WP_095669735.1|670210_671056_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	2.8e-30	36.8
WP_095669736.1|671107_671860_-	ribonuclease HII	D2TEQ2	Emiliania_huxleyi_virus	9.3e-25	38.1
WP_003647377.1|671856_672696_-	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_095669737.1|672698_674147_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	2.5e-10	28.4

2. NZ_CP008839

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP008839_1

• CRISPR_ID: NZ_CP008839_1
• CRISPR_location: 33331-33436
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 1 spacers

Consensus repeat of NZ_CP008839_1

Consensus_repeat	Method
GGTCTTGGCGGTCACCATTTCAGAACCCAATAATACAAGT	CRISPRCasFinder

spacers of NZ_CP008839_1

>1.1|33371|26|NZ_CP008839|CRISPRCasFinder
CTAAAGTTAAAATATAAGCAATTTGC

CRISPR arrays and Neighbor proteins around NZ_CP008839_1

CRISPR arrays

The CRISPR arrays of NZ_CP008839_1

>merge|NZ_CP008839|1|33331-33436|CRISPRCasFinder
GGTCTTGGCGGTCACCATTTCAGAACCCAATAATACAAGTCTAAAGTTAAAATATAAGCAATTTGCGGTCTTGGCGGTCACCATTTCAGAACCCAATAATACAAGT

>NZ_CP008839|1|1|33331-33436|CRISPRCasFinder
GGTCTTGGCGGTCACCATTTCAGAACCCAATAATACAAGT	CTAAAGTTAAAATATAAGCAATTTGC
GGTCTTGGCGGTCACCATTTCAGAACCCAATAATACAAGT

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP008839.1|WP_005728422.1|35408_36194_-|AAA-family-ATPase	unknown	unknown	gnl|CDD|379293
NZ_CP008839.1|WP_011241756.1|39196_39406_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP008839.1|WP_020807741.1|42230_42614_+|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl|CDD|234795
NZ_CP008839.1|WP_020807701.1|36772_37876_+|replication-initiator-protein-A	unknown	unknown	gnl|CDD|375483
NZ_CP008839.1|WP_003625296.1|24035_24668_+|hypothetical-protein	unknown	unknown	gnl|CDD|376405
NZ_CP008839.1|WP_003625298.1|24669_25686_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP008839.1|WP_095670436.1|38591_38906_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP008839.1|WP_003649870.1|23011_23245_+|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	unknown	unknown	gnl|CDD|273688
NZ_CP008839.1|WP_020807712.1|23244_23565_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl|CDD|226194
NZ_CP008839.1|WP_020807742.1|39674_41735_+|MobA/MobL-family-protein	unknown	unknown	gnl|CDD|367473
NZ_CP008839.1|WP_095670315.1|30423_31650_+|IS110-family-transposase	unknown	unknown	gnl|CDD|376564
NZ_CP008839.1|WP_020807710.1|25700_26717_+|ThiF-family-adenylyltransferase	unknown	unknown	gnl|CDD|366360
NZ_CP008839.1|WP_020807700.1|38128_38410_+|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl|CDD|274102
NZ_CP008839.1|WP_020807713.1|22031_22838_-|AAA-family-ATPase	unknown	unknown	gnl|CDD|379293
NZ_CP008839.1|WP_020807740.1|42986_44183_-|ATP-binding-protein	unknown	unknown	gnl|CDD|224292
NZ_CP008839.1|WP_020807702.1|35186_35402_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP008839.1|WP_095670433.1|26749_27592_+|hypothetical-protein	unknown	unknown	gnl|CDD|224855
NZ_CP008839.1|WP_020807708.1|27602_29189_+|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl|CDD|224055
NZ_CP008839.1|WP_095670435.1|38895_39174_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP008839.1|WP_003649872.1|21736_22039_-|hypothetical-protein	unknown	unknown	gnl|CDD|375154

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NZ_CP008839.1|WP_005728422.1|35408_36194_-|AAA-family-ATPase	gnl|CDD|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	1.88809e-36
NZ_CP008839.1|WP_020807741.1|42230_42614_+|large-conductance-mechanosensitive-channel-protein-MscL	gnl|CDD|234795	PRK00567, mscL, large-conductance mechanosensitive channel protein MscL.	7.16112e-59
NZ_CP008839.1|WP_020807700.1|38128_38410_+|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl|CDD|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	1.7372e-12
NZ_CP008839.1|WP_003649870.1|23011_23245_+|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	gnl|CDD|273688	TIGR01552, Hypothetical_protein_Rv3357/MT3465/Mb3392., prevent-host-death family protein. This model recognizes a region of about 55 amino acids toward the N-terminal end of bacterial proteins of about 85 amino acids in length. The best-characterized member is prevent-host-death (phd) of bacteriophage P1, the antidote partner of death-on-curing (doc) (TIGR01550) in an addiction module. Addiction modules prevent plasmid curing by killing the host cell as the longer-lived killing protein persists while the gene for the shorter-lived antidote is lost. Note, however, that relatively few members of this family appear to be plasmid or phage-encoded. Also, there is little overlap, except for phage P1 itself, of species with this family and with the doc family. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	2.81056e-06
NZ_CP008839.1|WP_020807742.1|39674_41735_+|MobA/MobL-family-protein	gnl|CDD|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	2.85556e-97
NZ_CP008839.1|WP_020807712.1|23244_23565_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl|CDD|226194	COG3668, ParE, Plasmid stabilization system protein [General function prediction only].	7.87529e-06
NZ_CP008839.1|WP_003649872.1|21736_22039_-|hypothetical-protein	gnl|CDD|375154	pfam17363, DUF5388, Family of unknown function (DUF5388). This is a family of unknown function found in Lactobacillales.	1.30945e-15
NZ_CP008839.1|WP_095670315.1|30423_31650_+|IS110-family-transposase	gnl|CDD|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	1.7801e-39
NZ_CP008839.1|WP_020807710.1|25700_26717_+|ThiF-family-adenylyltransferase	gnl|CDD|366360	pfam00899, ThiF, ThiF family. This domain is found in ubiquitin activating E1 family and members of the bacterial ThiF/MoeB/HesA family. It is repeated in Ubiquitin-activating enzyme E1.	7.48672e-27
NZ_CP008839.1|WP_020807713.1|22031_22838_-|AAA-family-ATPase	gnl|CDD|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	2.75232e-45
NZ_CP008839.1|WP_020807740.1|42986_44183_-|ATP-binding-protein	gnl|CDD|224292	COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only].	8.56931e-80
NZ_CP008839.1|WP_003625296.1|24035_24668_+|hypothetical-protein	gnl|CDD|376405	pfam00881, Nitroreductase, Nitroreductase family. The nitroreductase family comprises a group of FMN- or FAD-dependent and NAD(P)H-dependent enzymes able to metabolize nitrosubstituted compounds.	0.00234308
NZ_CP008839.1|WP_095670433.1|26749_27592_+|hypothetical-protein	gnl|CDD|224855	COG1944, COG1944, Uncharacterized conserved protein [Function unknown].	0.000141829
NZ_CP008839.1|WP_020807708.1|27602_29189_+|ABC-transporter-ATP-binding-protein	gnl|CDD|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.41012e-54
NZ_CP008839.1|WP_020807701.1|36772_37876_+|replication-initiator-protein-A	gnl|CDD|375483	pfam18008, Bac_RepA_C, Replication initiator protein A C-terminal domain. This is the C-terminal domain (CTD) that can be found in the conserved replication initiator, RepA,essential for staphylococcal propagation. RepA CTD shared the strongest structural homology to the Enterococcus faecalis DnaD CTD, yet perform distinct functions. RepA CTD shows strong sequence homology between RepA_N plasmids in genus-specific clusters, suggesting that it may perform host-specific functions necessary for replication. The RepA CTD interacts with the host DnaG primase, which binds the replicative helicase. Structural data indicate that the RepA CTD exists as a monomeric entity, flexibly tethered to the DNA-bound NTD.	4.92407e-44

Protein sequences

>NZ_CP008839.1|WP_095670315.1|30423_31650_+|IS110-family-transposase
MQVTFGIDVSKSTSAVCELIGESKNELTIANNRPGFIQLLKELAAFSKHPQIIFEATGVYSRRLQAFLEDYGYEYVILNPLKAKKEMDMGLRHNKTDKTDAYHLALTQRLHHHPVNQLQSQTYKQLNSLSRFYDQLTSDLVMAKNRLHQSLQSTFPEIETLFCSAKGKNYWQIVLHYPHCDLVRKDNQKQIIDWLMQLKGIGFKHAQKTADKLIELAHKAYPVVSSDSVEVEQVQYYAHRLLGLSEQRKQIIKRMVKLANSLPNNDLKNLESIPGFAQTTAVRVLAELGDLRRFSNPNKINAFIGIDPGRYQSGEMDSSLSITKHGNAVARKLLYRAIGQIDNASKTNLCHIADYYESKKLSSQTKGFKKIAIASIHKLIRTMYALISNDQLYDYNVAKHNQKDFSRN
>NZ_CP008839.1|WP_020807708.1|27602_29189_+|ABC-transporter-ATP-binding-protein
MSFQKLIKTNLLLFIVIIVLELLFAAGSAISSYIIQFAYNQLVKNILLGFLLIIASSVFLSFISYILSSLATYLFSKQTQKYIHSIRHKLISEYYHDKAPKVAEMENELNSNLQVLTKNYADQSLSIIQSGFLLVTSISSLLLMNWMLTLLAIILSVITLYIPRFTRQKASNATQKVASRNSKYLLVIEEWFNGLEELRKYTAFNQLDLVMQKVSQNLETSFVERKKVISVADFLNGCANSFSQIAITLLAAILFFNHQVTFGVIIAAGNFSSMILNCLLTITTSLTRIQSVQGLNKQIIESQKLVPFHKEINTDEICSISTHNLSISFKNGETIYFPDIHIKKGEKVLLSGDSGTGKSTLFKLILNKLQPTNGQVIFEDKYGKEISPDYAQIGYIPQDGKLFPTSIINNIIMFNNKLKKLSKNAVENNDLSKDIASMPNGLETEIDLDTNNFSGGQKQKIILARNEIHNFSIILADEATSAIDSKSSYRILKNLVSSNKTVIVIAHNLTPAMEKLFSRKISLGSNKR
>NZ_CP008839.1|WP_095670433.1|26749_27592_+|hypothetical-protein
MKIYKWKLSKLQVLKLSKVKVQGNLVAVTSDGNKSIPFGGIDSLYETAYKKAISELNERAAWFTMYSLHPSIVPNTTGFAAHTDKEKAIQSSIYEVIERKAFHYFIKLIMNNKIDEIYSNFHIQNKKDFLLFSKPYLTQAGELWITFAFDLGRKIIPVGMGKQNNLAESIDDAIDECIMVNHSIEKYLISHSNKQSTQSMSQEELLSFINLGKSTLLQDNLEKLSIENNYYENVKTKNIESLLTLNVTRYIPKFLSLTNRYVYLSVPLEKADSIKNNYRI
>NZ_CP008839.1|WP_020807710.1|25700_26717_+|ThiF-family-adenylyltransferase
MEYMFKYDVYGKVENKEIKILELIPIKRRYVIKLKDDEVSSAKQLIDLLNHGTTLQELEKLFAKKETMNNIFVFLKKQYLLANYFGDNHPDDPFARQIEMLDSFNRSSVSTSKLQSDLSQKSVLIIGAGGVGTALSNLLNSCGIGHIFIVDADIIENTNLSRQFLYNRDDVGKPKVEVLSQKLNKRGLGKVTGINAMLTLSNYKDILKDVGNVDLITGMPFPFSSSLNKLYKDILTLGYTMYAIGEHDAGPLFTKSNEIDKVANSIIAKYPATNFLNQRRDNPARHDRHPSFLPEIQITSSLAAAEIVKYFTQITTMNTENAMYSLHSDNYTVSLVKF
>NZ_CP008839.1|WP_003625298.1|24669_25686_+|hypothetical-protein
MRKISIQFGTNNNHSVNGYFTCINLSNSHHNVQQRITKSNLKEIFAQVNLLDLLYPALSLIDSLNILLANYHFKWIELILSIKEEKCKSSLEYVYLGGILTCCGITRPIGIKQRNINFLSANLTKLISLAIEGINSLNFVDLNSVGLSFDSFSAGILFHELFGHLSEGDVKDIRESFIPALKRNFNVYDVPFYPNQQDDACIKGHSVNLLNSRLNYDTGNLFIYIDRDNVQNNIGIIRQRKLIATRFGLAEVINPNVVISFGGVNIQKHALHIRLGLQKIKKLDLKIPLEDIKEVYTSDNSPIEYSTICQKISYPAVVSFKLPNVYMRLKRPIKFYIQ
>NZ_CP008839.1|WP_003625296.1|24035_24668_+|hypothetical-protein
MPSSNFYEALSLKTRVIHRNELNKIKESEIHDEEINSFSENFIFKNRYSYRGNLSSLSYTELKEFIEDLSRRKDYHPIPYAGNISPVISFCLNDSNLYYCNFINGSLKRYQSDSLRKYVKKQTDRADIRGSGGTIILLALDFSVLKTKYLQQSEILSWVDLGCILEGMSILASVKQYNCCIHFFMKDPRNILFDEKSYTPVCLFRIGHKA
>NZ_CP008839.1|WP_020807712.1|23244_23565_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MFSLELSTPAKEYFENLKQYLLINFGETVQRESLTKEEQKLENLKSFPYIGIKASKFSELLDGYYVLLDKNEYIFYQVDEKEKTIYIELVLSTKEDLIQKIRKYFQ
>NZ_CP008839.1|WP_003649870.1|23011_23245_+|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin
MLQIQPVSELRNYNKVLDKVKKDSPVFLTKNGYGKFALVDIEEYDEFTAALELVNKLKRAEKSKHYNFDDIKGDLFS
>NZ_CP008839.1|WP_020807713.1|22031_22838_-|AAA-family-ATPase
MTEIITFGNFKGGVGKTTNATQAAYELSKRGKKTLLLDLDPQANATNIMLKTKVNLTDEIFQFDSSLMSAIQSKDLTKALVNITKNLDLIGSSADFSLFPRVMERQFSKYIDRVTHLNKLLKPIAQKYDYVIIDVPPTISLITDAALYASDWCVIVMQTQQQALDGASAFIQYMQKEVIDTYHAPRLDLVGILPVLIQPGAPVDNLTLQNAVEEFGQANILPTSIHQMQRLKRYGVTGITDDSRYDKKVFEVYKQVVNDILSRIEANE
>NZ_CP008839.1|WP_003649872.1|21736_22039_-|hypothetical-protein
MSNLINSNKRKLNLKPKHEVSIDEIENKESNQTFNVNIKIDNTVRNSLIAISNLGIAPNQKEAVAYLVQQFRDNLDPDNQRLFDLQVDVLNKKDAKLHEK
>NZ_CP008839.1|WP_020807702.1|35186_35402_-|hypothetical-protein
MAEDFLNKVSKKASEQLKNLKSPYQFETERTKTVQLRMSTYKEVKRIAFENDEKIVDVLEKIIREGLAKRR
>NZ_CP008839.1|WP_005728422.1|35408_36194_-|AAA-family-ATPase
MNGKTLLNFNFKGGVGKTTLTVMETYLLGQEGKKVLLIDFDPQGNATEIMKETYKADLKPELSLYEGLLGGNLSKSIVSVTNQIDMIPTDWTLSLWIGAVEKVSRVKRNILLPQMLSKLKQNYDYIFIDVPPTINVFTNNAIMASDFISIVLQTQKQSYTSSLKTATHLGELREQYNGSFQLVGVILYLMKPRAKVDTEISAQAKDFFGEGVFSNSIRTQERVKTFANEGIRNKDHWDKRAIQMYQMVLNEQLLRIQQLEE
>NZ_CP008839.1|WP_020807701.1|36772_37876_+|replication-initiator-protein-A
MTKSTNFNYYEADNVYGALFFQFPKVLMYGEQYKHLSSDAKLAYMVLKDRLEYSLRNNWVDEKGHVYFIFTVKELQDLFNCATEKAVKIKKELQTANLLKQIQMGFNPKTKKNEPNRLYLSKLDVKATDVYLRGEYGQKEPETLATSGISKIESPHDFVETLATSGISKIESPHDFVDDNPQTLATSGISKIESNLYKDYKNNIDTNRYDIDTQKLDFSTANFSPAEIEAQNRDLVKHADEFLTDEDNGLPVFLEPEAVQLLSFWCRTPQQMRRFIGIILNAKYAVEKEHKDLGVWILLDDPDLKKMMTKTLRRYFNALRSDEKHIKNVENYLYGTMQNLFDVWWNQQAARDYAAKDQNIDNEHTWD
>NZ_CP008839.1|WP_020807700.1|38128_38410_+|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MAVKEKKRVQVKIDKDLADDTEAVLSELGLNPTTAINMFYKRIVANGALPFKASLSEEERANLRFLKATEGTPVTEFKDAKEVADWLNDPDED
>NZ_CP008839.1|WP_095670436.1|38591_38906_+|hypothetical-protein
MKKPSWVDLGNIYCFPKAGLNFKEIGHLSKLDQNKISDFTLDLKSKRRGKGQKIIQQRSSKRKYKESEAELTQRIQKQLKDFAKHNPEIKPKNNPENKNDRPSY
>NZ_CP008839.1|WP_095670435.1|38895_39174_-|hypothetical-protein
MSNQYEKLVEQQARLKQKSEREDFKLRQSKYYENRQARKARSRRLIQKGALLEKYFQADKLSVEQTEELLKIFANYVNAHKPNKFKNDQPNN
>NZ_CP008839.1|WP_011241756.1|39196_39406_-|hypothetical-protein
MSQSNLEKQEAKLKALNQKIKDEKNKIEQRLGKQIISQANLDYANLSNDQIKLLAQQFSEFLKVKSVDH
>NZ_CP008839.1|WP_020807742.1|39674_41735_+|MobA/MobL-family-protein
MAIFHMSFSNISAGKGRSAIASAAYRSGEKLFDDKEGRSYFYARSVMPESFILTPKNAPKWANDRQKLWNEVEKKDRKANSRYAKEFNVALPVELTNEEQKALITKFVQETFVDKGMVADVAIHRDHEENPHAHVMLTNRPFNPDGSWGLKSKTQYVLDKNGKQLLTKNGNPKQRKIWLVDWDKPGKVEEWRHAWAEEVNSLFQAKGMPERISEKSYEEQGIEKTPTKHEGHNSQTKERKAFNEAVKEQDRTKKQYQNNQEKINNQKHFDALSQHFSFNEKRLIKELSHELRTYVSLESLDDKRRMLFNWKNSVLIKHAVGEDIRKELLTINRQSQSLEKADRLLEKVTNRVIERLYPELKLDEITPAERQELIKETNSEQKVFKGEELHDRLLMIREDLINRQLLTFTKRPYISWQLLSKQETRDKEKLTQILSKHGNSLEELETANRGVLVNYSPAEQGQIKQAVKDLRTIKAVKEIVQTQYQAVLKQAFPDTPIDKAPIEKQEQVYTALMYYNPSLKACQLETIKAWQKEPPVVFTHEEHEQGLAYLTGKKALNDLTNKQLQRVMKYDGTRQLFLGECENDPAIKDSRIKTVRQEIANGQNQDDQKRQSQLSDYEPFNYKEVTPSYYLETAFSDALLGILYSRSEDRRRSKQAKGLRETEWKMTRKQRQHQTRNRHDDFGLHM
>NZ_CP008839.1|WP_020807741.1|42230_42614_+|large-conductance-mechanosensitive-channel-protein-MscL
MVKEFKEFISRGNMMDLAVGVIIGSAFTAIVNSLVKNLINPLIGLFIGKIDLSNLKLTIGEATFRYGSFLNAVINFLIIALVVFILMKLVNKFTIKKEAEKETPAPSNEEIYLRQIRDALQEKKILR
>NZ_CP008839.1|WP_020807740.1|42986_44183_-|ATP-binding-protein
MNYINRPQYMQFLEDFRDNEAIKVITGIRRSGKTFLMNMFIQKLKGDGIQDDQIIHINFENFAFINIRNAKDLYDYVHQHQNHHKKNYLFFDEIQYVKEWEKAINSFRVDMDADIYITGSNAFLLSSELATLLTGRYVQLKVYPLSFKEYYDFKNGSPEKVYQLFKDYLLEGGFPAVDVAPNTNLKDALKRGIFDSIILSDVSSRLKANSDQALLAVCDYLMSEIGNLVSATKIANTLRSNGFKISTSTVINYLDLLQQSFLFYKTNRYDLRGKKWLSTQHKYYFVDNGLRNTLLNKDAIDNLGHQLENVVYIELLRRGYSIDVGKYNDKEIDFIARKGSTIEYYQITQQIPDANKRETDNLRFIPDGYKKVVLTLNQFDAGDINGINVEYVLDWLLR

Crispr_ID: NZ_CP008839_2

• CRISPR_ID: NZ_CP008839_2
• CRISPR_location: 37197-37353
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 1 spacers

Consensus repeat of NZ_CP008839_2

Consensus_repeat	Method
AAACCCTTGCTACGAGCGGAATTTCGAAAATCGAAAG	CRISPRCasFinder

spacers of NZ_CP008839_2

>2.1|37234|83|NZ_CP008839|CRISPRCasFinder
TCCGCATGACTTCGTTGAAACCCTTGCTACGAGCGGAATTTCGAAAATCGAAAGTCCGCATGACTTCGTTGACGACAATCCTC

CRISPR arrays and Neighbor proteins around NZ_CP008839_2

CRISPR arrays

The CRISPR arrays of NZ_CP008839_2

>merge|NZ_CP008839|2|37197-37353|CRISPRCasFinder
AAACCCTTGCTACGAGCGGAATTTCGAAAATCGAAAGTCCGCATGACTTCGTTGAAACCCTTGCTACGAGCGGAATTTCGAAAATCGAAAGTCCGCATGACTTCGTTGACGACAATCCTCAAACCCTTGCTACGAGCGGAATTTCGAAAATCGAAAG

>NZ_CP008839|2|2|37197-37353|CRISPRCasFinder
AAACCCTTGCTACGAGCGGAATTTCGAAAATCGAAAG	TCCGCATGACTTCGTTGAAACCCTTGCTACGAGCGGAATTTCGAAAATCGAAAGTCCGCATGACTTCGTTGACGACAATCCTC
AAACCCTTGCTACGAGCGGAATTTCGAAAATCGAAAG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP008839.1|WP_005728422.1|35408_36194_-|AAA-family-ATPase	unknown	unknown	gnl|CDD|379293
NZ_CP008839.1|WP_011241756.1|39196_39406_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP008839.1|WP_020807741.1|42230_42614_+|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl|CDD|234795
NZ_CP008839.1|WP_020807737.1|47004_47877_+|IS256-family-transposase	unknown	unknown	gnl|CDD|307151
NZ_CP008839.1|WP_020807738.1|45481_46813_+|FAD-dependent-oxidoreductase	unknown	unknown	gnl|CDD|180907
NZ_CP008839.1|WP_095670435.1|38895_39174_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP008839.1|WP_003625296.1|24035_24668_+|hypothetical-protein	unknown	unknown	gnl|CDD|376405
NZ_CP008839.1|WP_020807700.1|38128_38410_+|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl|CDD|274102
NZ_CP008839.1|WP_020807712.1|23244_23565_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl|CDD|226194
NZ_CP008839.1|WP_020807742.1|39674_41735_+|MobA/MobL-family-protein	unknown	unknown	gnl|CDD|367473
NZ_CP008839.1|WP_020807740.1|42986_44183_-|ATP-binding-protein	unknown	unknown	gnl|CDD|224292
NZ_CP008839.1|WP_095670315.1|30423_31650_+|IS110-family-transposase	unknown	unknown	gnl|CDD|376564
NZ_CP008839.1|WP_020807710.1|25700_26717_+|ThiF-family-adenylyltransferase	unknown	unknown	gnl|CDD|366360
NZ_CP008839.1|WP_020807739.1|44393_44996_-|recombinase-family-protein	unknown	unknown	gnl|CDD|239737
NZ_CP008839.1|WP_095670434.1|32974_33835_+|alpha/beta-hydrolase	unknown	unknown	gnl|CDD|223669
NZ_CP008839.1|WP_020807702.1|35186_35402_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP008839.1|WP_003625298.1|24669_25686_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP008839.1|WP_020807708.1|27602_29189_+|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl|CDD|224055
NZ_CP008839.1|WP_095670433.1|26749_27592_+|hypothetical-protein	unknown	unknown	gnl|CDD|224855
NZ_CP008839.1|WP_095670436.1|38591_38906_+|hypothetical-protein	unknown	unknown	unknown

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NZ_CP008839.1|WP_005728422.1|35408_36194_-|AAA-family-ATPase	gnl|CDD|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	1.88809e-36
NZ_CP008839.1|WP_020807741.1|42230_42614_+|large-conductance-mechanosensitive-channel-protein-MscL	gnl|CDD|234795	PRK00567, mscL, large-conductance mechanosensitive channel protein MscL.	7.16112e-59
NZ_CP008839.1|WP_020807737.1|47004_47877_+|IS256-family-transposase	gnl|CDD|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	7.62557e-39
NZ_CP008839.1|WP_020807738.1|45481_46813_+|FAD-dependent-oxidoreductase	gnl|CDD|180907	PRK07251, PRK07251, FAD-containing oxidoreductase.	5.80732e-162
NZ_CP008839.1|WP_095670433.1|26749_27592_+|hypothetical-protein	gnl|CDD|224855	COG1944, COG1944, Uncharacterized conserved protein [Function unknown].	0.000141829
NZ_CP008839.1|WP_020807712.1|23244_23565_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl|CDD|226194	COG3668, ParE, Plasmid stabilization system protein [General function prediction only].	7.87529e-06
NZ_CP008839.1|WP_020807742.1|39674_41735_+|MobA/MobL-family-protein	gnl|CDD|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	2.85556e-97
NZ_CP008839.1|WP_095670315.1|30423_31650_+|IS110-family-transposase	gnl|CDD|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	1.7801e-39
NZ_CP008839.1|WP_020807710.1|25700_26717_+|ThiF-family-adenylyltransferase	gnl|CDD|366360	pfam00899, ThiF, ThiF family. This domain is found in ubiquitin activating E1 family and members of the bacterial ThiF/MoeB/HesA family. It is repeated in Ubiquitin-activating enzyme E1.	7.48672e-27
NZ_CP008839.1|WP_020807739.1|44393_44996_-|recombinase-family-protein	gnl|CDD|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	8.91856e-53
NZ_CP008839.1|WP_095670434.1|32974_33835_+|alpha/beta-hydrolase	gnl|CDD|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.84904e-27
NZ_CP008839.1|WP_003625296.1|24035_24668_+|hypothetical-protein	gnl|CDD|376405	pfam00881, Nitroreductase, Nitroreductase family. The nitroreductase family comprises a group of FMN- or FAD-dependent and NAD(P)H-dependent enzymes able to metabolize nitrosubstituted compounds.	0.00234308
NZ_CP008839.1|WP_020807700.1|38128_38410_+|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl|CDD|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	1.7372e-12
NZ_CP008839.1|WP_020807708.1|27602_29189_+|ABC-transporter-ATP-binding-protein	gnl|CDD|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.41012e-54
NZ_CP008839.1|WP_020807740.1|42986_44183_-|ATP-binding-protein	gnl|CDD|224292	COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only].	8.56931e-80

Protein sequences

>NZ_CP008839.1|WP_005728422.1|35408_36194_-|AAA-family-ATPase
MNGKTLLNFNFKGGVGKTTLTVMETYLLGQEGKKVLLIDFDPQGNATEIMKETYKADLKPELSLYEGLLGGNLSKSIVSVTNQIDMIPTDWTLSLWIGAVEKVSRVKRNILLPQMLSKLKQNYDYIFIDVPPTINVFTNNAIMASDFISIVLQTQKQSYTSSLKTATHLGELREQYNGSFQLVGVILYLMKPRAKVDTEISAQAKDFFGEGVFSNSIRTQERVKTFANEGIRNKDHWDKRAIQMYQMVLNEQLLRIQQLEE
>NZ_CP008839.1|WP_020807702.1|35186_35402_-|hypothetical-protein
MAEDFLNKVSKKASEQLKNLKSPYQFETERTKTVQLRMSTYKEVKRIAFENDEKIVDVLEKIIREGLAKRR
>NZ_CP008839.1|WP_095670434.1|32974_33835_+|alpha/beta-hydrolase
MFNARTKSIVINGYSMDYISFGKGNKWLILIPGLSINRIRGHALQMSFMYRQFARKYKVLMFDRRDHLTPSYSIGQMADELYSALRKLGIYKIDVVGVSEGGMIAQKLAINQPDIVHKLVLAVTISEPNNTSLKLKYKQFAVLAVTISEPNNTSNTTIKQWISLAKNNQLKELVWDSFQRSYSTHYIHKHHHLLKLLATITKVKEVDRFIILAQAILNFNVAAQLTKIKCPVFVIGAQQDQVLSVEGTKTIAKILHAPLYIYPHYGHAVYIEAKDFNQRIYNFLMS
>NZ_CP008839.1|WP_095670315.1|30423_31650_+|IS110-family-transposase
MQVTFGIDVSKSTSAVCELIGESKNELTIANNRPGFIQLLKELAAFSKHPQIIFEATGVYSRRLQAFLEDYGYEYVILNPLKAKKEMDMGLRHNKTDKTDAYHLALTQRLHHHPVNQLQSQTYKQLNSLSRFYDQLTSDLVMAKNRLHQSLQSTFPEIETLFCSAKGKNYWQIVLHYPHCDLVRKDNQKQIIDWLMQLKGIGFKHAQKTADKLIELAHKAYPVVSSDSVEVEQVQYYAHRLLGLSEQRKQIIKRMVKLANSLPNNDLKNLESIPGFAQTTAVRVLAELGDLRRFSNPNKINAFIGIDPGRYQSGEMDSSLSITKHGNAVARKLLYRAIGQIDNASKTNLCHIADYYESKKLSSQTKGFKKIAIASIHKLIRTMYALISNDQLYDYNVAKHNQKDFSRN
>NZ_CP008839.1|WP_020807708.1|27602_29189_+|ABC-transporter-ATP-binding-protein
MSFQKLIKTNLLLFIVIIVLELLFAAGSAISSYIIQFAYNQLVKNILLGFLLIIASSVFLSFISYILSSLATYLFSKQTQKYIHSIRHKLISEYYHDKAPKVAEMENELNSNLQVLTKNYADQSLSIIQSGFLLVTSISSLLLMNWMLTLLAIILSVITLYIPRFTRQKASNATQKVASRNSKYLLVIEEWFNGLEELRKYTAFNQLDLVMQKVSQNLETSFVERKKVISVADFLNGCANSFSQIAITLLAAILFFNHQVTFGVIIAAGNFSSMILNCLLTITTSLTRIQSVQGLNKQIIESQKLVPFHKEINTDEICSISTHNLSISFKNGETIYFPDIHIKKGEKVLLSGDSGTGKSTLFKLILNKLQPTNGQVIFEDKYGKEISPDYAQIGYIPQDGKLFPTSIINNIIMFNNKLKKLSKNAVENNDLSKDIASMPNGLETEIDLDTNNFSGGQKQKIILARNEIHNFSIILADEATSAIDSKSSYRILKNLVSSNKTVIVIAHNLTPAMEKLFSRKISLGSNKR
>NZ_CP008839.1|WP_095670433.1|26749_27592_+|hypothetical-protein
MKIYKWKLSKLQVLKLSKVKVQGNLVAVTSDGNKSIPFGGIDSLYETAYKKAISELNERAAWFTMYSLHPSIVPNTTGFAAHTDKEKAIQSSIYEVIERKAFHYFIKLIMNNKIDEIYSNFHIQNKKDFLLFSKPYLTQAGELWITFAFDLGRKIIPVGMGKQNNLAESIDDAIDECIMVNHSIEKYLISHSNKQSTQSMSQEELLSFINLGKSTLLQDNLEKLSIENNYYENVKTKNIESLLTLNVTRYIPKFLSLTNRYVYLSVPLEKADSIKNNYRI
>NZ_CP008839.1|WP_020807710.1|25700_26717_+|ThiF-family-adenylyltransferase
MEYMFKYDVYGKVENKEIKILELIPIKRRYVIKLKDDEVSSAKQLIDLLNHGTTLQELEKLFAKKETMNNIFVFLKKQYLLANYFGDNHPDDPFARQIEMLDSFNRSSVSTSKLQSDLSQKSVLIIGAGGVGTALSNLLNSCGIGHIFIVDADIIENTNLSRQFLYNRDDVGKPKVEVLSQKLNKRGLGKVTGINAMLTLSNYKDILKDVGNVDLITGMPFPFSSSLNKLYKDILTLGYTMYAIGEHDAGPLFTKSNEIDKVANSIIAKYPATNFLNQRRDNPARHDRHPSFLPEIQITSSLAAAEIVKYFTQITTMNTENAMYSLHSDNYTVSLVKF
>NZ_CP008839.1|WP_003625298.1|24669_25686_+|hypothetical-protein
MRKISIQFGTNNNHSVNGYFTCINLSNSHHNVQQRITKSNLKEIFAQVNLLDLLYPALSLIDSLNILLANYHFKWIELILSIKEEKCKSSLEYVYLGGILTCCGITRPIGIKQRNINFLSANLTKLISLAIEGINSLNFVDLNSVGLSFDSFSAGILFHELFGHLSEGDVKDIRESFIPALKRNFNVYDVPFYPNQQDDACIKGHSVNLLNSRLNYDTGNLFIYIDRDNVQNNIGIIRQRKLIATRFGLAEVINPNVVISFGGVNIQKHALHIRLGLQKIKKLDLKIPLEDIKEVYTSDNSPIEYSTICQKISYPAVVSFKLPNVYMRLKRPIKFYIQ
>NZ_CP008839.1|WP_003625296.1|24035_24668_+|hypothetical-protein
MPSSNFYEALSLKTRVIHRNELNKIKESEIHDEEINSFSENFIFKNRYSYRGNLSSLSYTELKEFIEDLSRRKDYHPIPYAGNISPVISFCLNDSNLYYCNFINGSLKRYQSDSLRKYVKKQTDRADIRGSGGTIILLALDFSVLKTKYLQQSEILSWVDLGCILEGMSILASVKQYNCCIHFFMKDPRNILFDEKSYTPVCLFRIGHKA
>NZ_CP008839.1|WP_020807712.1|23244_23565_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MFSLELSTPAKEYFENLKQYLLINFGETVQRESLTKEEQKLENLKSFPYIGIKASKFSELLDGYYVLLDKNEYIFYQVDEKEKTIYIELVLSTKEDLIQKIRKYFQ
>NZ_CP008839.1|WP_020807700.1|38128_38410_+|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MAVKEKKRVQVKIDKDLADDTEAVLSELGLNPTTAINMFYKRIVANGALPFKASLSEEERANLRFLKATEGTPVTEFKDAKEVADWLNDPDED
>NZ_CP008839.1|WP_095670436.1|38591_38906_+|hypothetical-protein
MKKPSWVDLGNIYCFPKAGLNFKEIGHLSKLDQNKISDFTLDLKSKRRGKGQKIIQQRSSKRKYKESEAELTQRIQKQLKDFAKHNPEIKPKNNPENKNDRPSY
>NZ_CP008839.1|WP_095670435.1|38895_39174_-|hypothetical-protein
MSNQYEKLVEQQARLKQKSEREDFKLRQSKYYENRQARKARSRRLIQKGALLEKYFQADKLSVEQTEELLKIFANYVNAHKPNKFKNDQPNN
>NZ_CP008839.1|WP_011241756.1|39196_39406_-|hypothetical-protein
MSQSNLEKQEAKLKALNQKIKDEKNKIEQRLGKQIISQANLDYANLSNDQIKLLAQQFSEFLKVKSVDH
>NZ_CP008839.1|WP_020807742.1|39674_41735_+|MobA/MobL-family-protein
MAIFHMSFSNISAGKGRSAIASAAYRSGEKLFDDKEGRSYFYARSVMPESFILTPKNAPKWANDRQKLWNEVEKKDRKANSRYAKEFNVALPVELTNEEQKALITKFVQETFVDKGMVADVAIHRDHEENPHAHVMLTNRPFNPDGSWGLKSKTQYVLDKNGKQLLTKNGNPKQRKIWLVDWDKPGKVEEWRHAWAEEVNSLFQAKGMPERISEKSYEEQGIEKTPTKHEGHNSQTKERKAFNEAVKEQDRTKKQYQNNQEKINNQKHFDALSQHFSFNEKRLIKELSHELRTYVSLESLDDKRRMLFNWKNSVLIKHAVGEDIRKELLTINRQSQSLEKADRLLEKVTNRVIERLYPELKLDEITPAERQELIKETNSEQKVFKGEELHDRLLMIREDLINRQLLTFTKRPYISWQLLSKQETRDKEKLTQILSKHGNSLEELETANRGVLVNYSPAEQGQIKQAVKDLRTIKAVKEIVQTQYQAVLKQAFPDTPIDKAPIEKQEQVYTALMYYNPSLKACQLETIKAWQKEPPVVFTHEEHEQGLAYLTGKKALNDLTNKQLQRVMKYDGTRQLFLGECENDPAIKDSRIKTVRQEIANGQNQDDQKRQSQLSDYEPFNYKEVTPSYYLETAFSDALLGILYSRSEDRRRSKQAKGLRETEWKMTRKQRQHQTRNRHDDFGLHM
>NZ_CP008839.1|WP_020807741.1|42230_42614_+|large-conductance-mechanosensitive-channel-protein-MscL
MVKEFKEFISRGNMMDLAVGVIIGSAFTAIVNSLVKNLINPLIGLFIGKIDLSNLKLTIGEATFRYGSFLNAVINFLIIALVVFILMKLVNKFTIKKEAEKETPAPSNEEIYLRQIRDALQEKKILR
>NZ_CP008839.1|WP_020807740.1|42986_44183_-|ATP-binding-protein
MNYINRPQYMQFLEDFRDNEAIKVITGIRRSGKTFLMNMFIQKLKGDGIQDDQIIHINFENFAFINIRNAKDLYDYVHQHQNHHKKNYLFFDEIQYVKEWEKAINSFRVDMDADIYITGSNAFLLSSELATLLTGRYVQLKVYPLSFKEYYDFKNGSPEKVYQLFKDYLLEGGFPAVDVAPNTNLKDALKRGIFDSIILSDVSSRLKANSDQALLAVCDYLMSEIGNLVSATKIANTLRSNGFKISTSTVINYLDLLQQSFLFYKTNRYDLRGKKWLSTQHKYYFVDNGLRNTLLNKDAIDNLGHQLENVVYIELLRRGYSIDVGKYNDKEIDFIARKGSTIEYYQITQQIPDANKRETDNLRFIPDGYKKVVLTLNQFDAGDINGINVEYVLDWLLR
>NZ_CP008839.1|WP_020807739.1|44393_44996_-|recombinase-family-protein
MKYGYARVSTSDQKLENQIDLLKSAGADKIFQEKYTGTTTQRPEFQKLLNELKVNDTLIVTKLDRFARNTTEALELIQKLFKQNIKVNILNMGVIDNTPTGQLIFTIFSAFAQFERDMIVTRTQEGKMYAKAHDPNFREGRPQTYSDEQIQLAYELRQQGMTYKMIERKTGISIATQKRRFKKFKKLRIRLSSSKTNSQD
>NZ_CP008839.1|WP_020807738.1|45481_46813_+|FAD-dependent-oxidoreductase
MRHFKNIIIGFGKAGKTLAGSLTSHGEEVLLIEKDPMMYGGTCINIACLPTKNLVINSQRGVKYEEAFETKEAMTAKLRNKNYHKVADQDLATVLDASAEFIDDKIIKVTDESGTEELTFDRLFINTGAESNVPNIDGLKIDDKILTSTEMLAKKELAKNLVILGGGPIGLEFASMYAGFGSKVTVIEPMPSILGRFEPEIAQAAKADMEADGVTFMLKSSLTKVEETEAGLNLTVETEDGVKDLQADVMLVSVGRHPATAALHLEKTSLEVGQRGEIVVNDKLETSVPNIYAMGDVAGSLQFTYISLDDWRIMDNQLFGDKTRTKKNRPVFANSIFIKPAISSAGLTESELKAQGKAYKVLTMPAAGVPKAQVIGNPRGSYKALIDPETHEILGATIYAEEAYETINVITLAMQHHLKAEDLRDQIYAHPTMTEALNDLFKF
>NZ_CP008839.1|WP_020807737.1|47004_47877_+|IS256-family-transposase
MNQFNKDIIAALSSDKDITLNEVLRRQIEVTANQFLQNELTAVLGYEPHTRIDRSKDDVNYRNGTYTRTIDTEYGEINLTIPRDRLNKFQNALFPPYVRRTDGLEKMVIKMYSKGVTTREIADMVERMYGHYYSPTTVSNITKRTKHLVEEFHERNLLGYVRKNDLREIITDFKTIRQAESLQAAKERLAAFSAKWESSYKRRIKNLVQMEELFTFFSFPTAIRQTIYSTSLIESFNKSLKKMVRRKEQFPNEGALDRFIMTQVMEYNDKFENRAHRGFKDCHDTLDSMF

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	NZ_CP008839	Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence	33371-33396	0	1.0
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	NZ_KF831355	Staphylococcus aureus strain A960649 plasmid pBU108a, complete sequence	15869-15894	4	0.846
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	NC_013327	Staphylococcus aureus plasmid pWBG749, complete sequence	18868-18893	4	0.846
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	NZ_CP012594	Staphylococcus aureus strain HOU1444-VR plasmid pVR-MSSA_01, complete sequence	1860-1885	4	0.846
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	NZ_CP042347	Staphylococcus aureus strain BSN9S plasmid pSaBSN9, complete sequence	25121-25146	4	0.846
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	NZ_AP018563	Staphylococcus argenteus strain 58113 plasmid p1, complete sequence	25717-25742	4	0.846
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	CP030569	Staphylococcus aureus strain ER01892.3 plasmid unnamed1, complete sequence	20246-20271	4	0.846
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	CP030458	Staphylococcus aureus strain ER04013.3 plasmid unnamed1, complete sequence	22958-22983	4	0.846
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	NZ_AP017923	Staphylococcus aureus strain JP02758 plasmid pJP080, complete sequence	25141-25166	4	0.846
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	NC_013325	Staphylococcus aureus plasmid pWBG745, complete sequence	20394-20419	4	0.846
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	CP030710	Staphylococcus aureus strain ER01174.3 plasmid unnamed1, complete sequence	14853-14878	4	0.846
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	NZ_CP047857	Staphylococcus aureus strain UP_1435 plasmid unnamed1, complete sequence	34188-34213	4	0.846
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	NZ_MH587574	Staphylococcus aureus strain WBG10514 plasmid pWBG731, complete sequence	25148-25173	4	0.846
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	CP030603	Staphylococcus aureus strain ER00484.3 plasmid unnamed1, complete sequence	4797-4822	4	0.846
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	NZ_CP014916	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-1, complete sequence	31539-31564	6	0.769
NZ_CP008839_1	1.1|33371|26|NZ_CP008839|CRISPRCasFinder	33371-33396	26	NZ_CP014627	Lactobacillus backii strain TMW 1.1988 plasmid L11988-3, complete sequence	15194-15219	6	0.769
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NZ_CP044414	Lactobacillus sp. JM1 plasmid unnamed2, complete sequence	25960-26042	23	0.723
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NZ_CP008839	Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence	37234-37316	23	0.723
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NC_011352	Lactobacillus paracasei plasmid plca36, complete sequence	462-544	23	0.723
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NZ_KR052811	Lactobacillus crispatus strain L6 plasmid pLc17, complete sequence	11740-11822	24	0.711
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NZ_CP046312	Lactobacillus crispatus strain FDAARGOS_743 plasmid unnamed1, complete sequence	3882-3964	24	0.711
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NZ_CP026504	Lactobacillus crispatus strain AB70 plasmid pLcAB70, complete sequence	5455-5537	24	0.711
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NZ_CP045730	Lactobacillus gastricus strain LG045 plasmid unnamed1, complete sequence	3542-3624	24	0.711
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NZ_CP044413	Lactobacillus sp. JM1 plasmid unnamed1, complete sequence	16706-16788	24	0.711
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NZ_CP012279	Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-4, complete sequence	3450-3532	24	0.711
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NZ_CP014889	Lactobacillus backii strain TMW 1.1991 plasmid pL11991-8, complete sequence	6175-6257	25	0.699
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NZ_CP014631	Lactobacillus backii strain TMW 1.1988 plasmid L11988-7, complete sequence	25032-25114	25	0.699
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NZ_CP029972	Lactobacillus kefiri strain DH5 plasmid pDH5, complete sequence	20634-20716	25	0.699
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NZ_CP029972	Lactobacillus kefiri strain DH5 plasmid pDH5, complete sequence	20688-20770	25	0.699
NZ_CP008839_2	2.1|37234|83|NZ_CP008839|CRISPRCasFinder	37234-37316	83	NZ_CP031183	Lactobacillus brevis strain UCCLB95 plasmid pUCCLB95_A, complete sequence	816-898	25	0.699

1. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to NZ_CP008839 (Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence) position: , mismatch: 0, identity: 1.0

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ctaaagttaaaatataagcaatttgc	Protospacer
**************************

2. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to NZ_KF831355 (Staphylococcus aureus strain A960649 plasmid pBU108a, complete sequence) position: , mismatch: 4, identity: 0.846

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ttaaagttaaaatataagccaattgt	Protospacer
.****************** * ***.

3. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to NC_013327 (Staphylococcus aureus plasmid pWBG749, complete sequence) position: , mismatch: 4, identity: 0.846

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ttaaagttaaaatataagccaattgt	Protospacer
.****************** * ***.

4. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to NZ_CP012594 (Staphylococcus aureus strain HOU1444-VR plasmid pVR-MSSA_01, complete sequence) position: , mismatch: 4, identity: 0.846

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ttaaagttaaaatataagccaattgt	Protospacer
.****************** * ***.

5. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to NZ_CP042347 (Staphylococcus aureus strain BSN9S plasmid pSaBSN9, complete sequence) position: , mismatch: 4, identity: 0.846

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ttaaagttaaaatataagccaattgt	Protospacer
.****************** * ***.

6. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to NZ_AP018563 (Staphylococcus argenteus strain 58113 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.846

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ttaaagttaaaatataagccaattgt	Protospacer
.****************** * ***.

7. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to CP030569 (Staphylococcus aureus strain ER01892.3 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ttaaagttaaaatataagccaattgt	Protospacer
.****************** * ***.

8. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to CP030458 (Staphylococcus aureus strain ER04013.3 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ttaaagttaaaatataagccaattgt	Protospacer
.****************** * ***.

9. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to NZ_AP017923 (Staphylococcus aureus strain JP02758 plasmid pJP080, complete sequence) position: , mismatch: 4, identity: 0.846

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ttaaagttaaaatataagccaattgt	Protospacer
.****************** * ***.

10. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to NC_013325 (Staphylococcus aureus plasmid pWBG745, complete sequence) position: , mismatch: 4, identity: 0.846

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ttaaagttaaaatataagccaattgt	Protospacer
.****************** * ***.

11. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to CP030710 (Staphylococcus aureus strain ER01174.3 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ttaaagttaaaatataagccaattgt	Protospacer
.****************** * ***.

12. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to NZ_CP047857 (Staphylococcus aureus strain UP_1435 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ttaaagttaaaatataagccaattgt	Protospacer
.****************** * ***.

13. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to NZ_MH587574 (Staphylococcus aureus strain WBG10514 plasmid pWBG731, complete sequence) position: , mismatch: 4, identity: 0.846

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ttaaagttaaaatataagccaattgt	Protospacer
.****************** * ***.

14. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to CP030603 (Staphylococcus aureus strain ER00484.3 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

ctaaagttaaaatataagcaatttgc	CRISPR spacer
ttaaagttaaaatataagccaattgt	Protospacer
.****************** * ***.

15. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to NZ_CP014916 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-1, complete sequence) position: , mismatch: 6, identity: 0.769

ctaaagttaaaatataagcaatttgc	CRISPR spacer
tggaacttaaaatataagcaatttag	Protospacer
. .** ******************. 

16. spacer 1.1|33371|26|NZ_CP008839|CRISPRCasFinder matches to NZ_CP014627 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-3, complete sequence) position: , mismatch: 6, identity: 0.769

ctaaagttaaaatataagcaatttgc	CRISPR spacer
tggaacttaaaatataagcaatttag	Protospacer
. .** ******************. 

17. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NZ_CP044414 (Lactobacillus sp. JM1 plasmid unnamed2, complete sequence) position: , mismatch: 23, identity: 0.723

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
************************************************************

18. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NZ_CP008839 (Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence) position: , mismatch: 23, identity: 0.723

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
************************************************************

19. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NC_011352 (Lactobacillus paracasei plasmid plca36, complete sequence) position: , mismatch: 23, identity: 0.723

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
************************************************************

20. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NZ_KR052811 (Lactobacillus crispatus strain L6 plasmid pLc17, complete sequence) position: , mismatch: 24, identity: 0.711

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttgaatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
******************* ****************************************

21. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NZ_CP046312 (Lactobacillus crispatus strain FDAARGOS_743 plasmid unnamed1, complete sequence) position: , mismatch: 24, identity: 0.711

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttgaatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
******************* ****************************************

22. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NZ_CP026504 (Lactobacillus crispatus strain AB70 plasmid pLcAB70, complete sequence) position: , mismatch: 24, identity: 0.711

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttgaatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
******************* ****************************************

23. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NZ_CP045730 (Lactobacillus gastricus strain LG045 plasmid unnamed1, complete sequence) position: , mismatch: 24, identity: 0.711

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttgaatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
******************* ****************************************

24. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NZ_CP044413 (Lactobacillus sp. JM1 plasmid unnamed1, complete sequence) position: , mismatch: 24, identity: 0.711

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttgaatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
******************* ****************************************

25. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NZ_CP012279 (Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-4, complete sequence) position: , mismatch: 24, identity: 0.711

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttgaatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
******************* ****************************************

26. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NZ_CP014889 (Lactobacillus backii strain TMW 1.1991 plasmid pL11991-8, complete sequence) position: , mismatch: 25, identity: 0.699

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
*****************.* ****************************************

27. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NZ_CP014631 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-7, complete sequence) position: , mismatch: 25, identity: 0.699

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
*****************.* ****************************************

28. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NZ_CP029972 (Lactobacillus kefiri strain DH5 plasmid pDH5, complete sequence) position: , mismatch: 25, identity: 0.699

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
*****************.* ****************************************

29. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NZ_CP029972 (Lactobacillus kefiri strain DH5 plasmid pDH5, complete sequence) position: , mismatch: 25, identity: 0.699

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
*****************.* ****************************************

30. spacer 2.1|37234|83|NZ_CP008839|CRISPRCasFinder matches to NZ_CP031183 (Lactobacillus brevis strain UCCLB95 plasmid pUCCLB95_A, complete sequence) position: , mismatch: 25, identity: 0.699

tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
*****************.* ****************************************