CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_AP014856	Escherichia albertii strain CB9786	2 crisprs	DinG,cas3,DEDDh,csa3	0	1	11	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP014856_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014856_1

310065-310161

Orphan

Consensus_repeat	Method
GTGACCTAGGGGGTAGGTCACTGTGAACTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP014856_1

>merge|NZ_AP014856|1|310065-310161|CRISPRCasFinder
GTGACCTAGGGGGTAGGTCACTGTGAACTAGGGGGGTAGTTCACTATGAGCTAGGGGGTAGGTCACTATGAGCTAGGGGGTAGGTCATAGTGAGCTA

>NZ_AP014856|1|1|310065-310161|CRISPRCasFinder
GTGACCTAGGGGGTAGGTCACTGTGAACTA	GGGGGGTAGTTCACTATGAGCTAGGGGGTAGGTCACT
ATGAGCTAGGGGGTAGGTCATAGTGAGCTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014856.1\|WP_072794540.1\|301566_302169_+\|tail-fiber-assembly-protein	unknown	unknown	gnl\|CDD\|367075
NZ_AP014856.1\|WP_021560779.1\|314079_314292_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014856.1\|WP_088213470.1\|313391_313730_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014856.1\|WP_000005469.1\|311604_311775_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014856.1\|WP_095575515.1\|311828_312557_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|379352
NZ_AP014856.1\|WP_095575510.1\|300826_301567_+\|tail-fiber-protein	unknown	unknown	gnl\|CDD\|377845
NZ_AP014856.1\|WP_095575511.1\|303007_303562_+\|site-specific-DNA-recombinase	unknown	unknown	gnl\|CDD\|239737
NZ_AP014856.1\|WP_075826105.1\|312568_312847_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014856.1\|WP_095575513.1\|308731_309271_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_AP014856.1\|WP_095575516.1\|314669_315698_+\|major-capsid-protein	unknown	unknown	gnl\|CDD\|377147
NZ_AP014856.1\|WP_089618264.1\|302585_302981_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014856.1\|WP_000452041.1\|315784_315988_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014856.1\|WP_001333214.1\|304897_305317_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014856.1\|WP_000355479.1\|303619_304393_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226205
NZ_AP014856.1\|WP_089618265.1\|302140_302584_-\|tail-fiber-assembly-protein	unknown	unknown	gnl\|CDD\|367075
NZ_AP014856.1\|WP_095575512.1\|305632_307099_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014856.1\|WP_016159682.1\|312979_313390_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014856.1\|WP_172843344.1\|311405_311582_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014856.1\|WP_001570993.1\|314288_314651_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014856.1\|WP_000788777.1\|308144_308303_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_AP014856.1\|WP_095575516.1\|314669_315698_+\|major-capsid-protein	gnl\|CDD\|377147	pfam03864, Phage_cap_E, Phage major capsid protein E. Major capsid protein E is involved with the stabilisation of the condensed form of the DNA molecule in phage heads.	3.76859e-05
NZ_AP014856.1\|WP_072794540.1\|301566_302169_+\|tail-fiber-assembly-protein	gnl\|CDD\|367075	pfam02413, Caudo_TAP, Caudovirales tail fibre assembly protein, lambda gpK. This family contains bacterial and phage tail fibre assembly proteins. E.coli contains several members of this family although the function of these proteins is uncertain. Using the lambda phage members as examples, there are both gptfa and gpK tail proteins here. GpK forms part of the TTC or tail-tip complex that is located at the distal end of the tail. TTCs form the platform on which the tail-tube proteins self-assemble and are also the attachment point for fibers or receptor-binding proteins that mediate phage-adsorption to the surface of the host cell. TTC assembly starts with gpJ, which is also known as the central tail fibre and is involved in host-cell adsorption. It is the C-terminus of gpJ that interacts with the lamB receptor on host cells. A number of intermediates including gpK then interact with gpJ during tail morphogenesis.	5.38646e-33
NZ_AP014856.1\|WP_000355479.1\|303619_304393_-\|hypothetical-protein	gnl\|CDD\|226205	COG3680, COG3680, Uncharacterized protein conserved in bacteria [Function unknown].	2.36153e-146
NZ_AP014856.1\|WP_095575510.1\|300826_301567_+\|tail-fiber-protein	gnl\|CDD\|377845	pfam07484, Collar, Phage Tail Collar Domain. This region is occasionally found in conjunction with pfam03335. Most of the family appear to be phage tail proteins; however some appear to be involved in other processes. For instance a member from Rhizobium leguminosarum may be involved in plant-microbe interactions. A related protein MrpB is involved in the pathogenicity of Microcystis aeruginosa. The finding of this family in a structural component of the phage tail fibre baseplate suggests that its function is structural rather than enzymatic. Structural studies show this region consists of a helix and a loop and three beta-strands. This alignment does not catch the third strand as it is separated from the rest of the structure by around 100 residues. This strand is conserved in homologs but the intervening sequence is not. Much of the function of phage T4 appears to reside in this intervening region. In the tertiary structure of the phage baseplate this domain forms part of the 'collar'. The domain may bind SO4, however the residues accredited with this vary between the PDB file and the Swiss-Prot entry. The long unconserved region maybe due to domain swapping in and out of a loop or reflective of rapid evolution.	1.58537e-14
NZ_AP014856.1\|WP_089618265.1\|302140_302584_-\|tail-fiber-assembly-protein	gnl\|CDD\|367075	pfam02413, Caudo_TAP, Caudovirales tail fibre assembly protein, lambda gpK. This family contains bacterial and phage tail fibre assembly proteins. E.coli contains several members of this family although the function of these proteins is uncertain. Using the lambda phage members as examples, there are both gptfa and gpK tail proteins here. GpK forms part of the TTC or tail-tip complex that is located at the distal end of the tail. TTCs form the platform on which the tail-tube proteins self-assemble and are also the attachment point for fibers or receptor-binding proteins that mediate phage-adsorption to the surface of the host cell. TTC assembly starts with gpJ, which is also known as the central tail fibre and is involved in host-cell adsorption. It is the C-terminus of gpJ that interacts with the lamB receptor on host cells. A number of intermediates including gpK then interact with gpJ during tail morphogenesis.	2.9761e-28
NZ_AP014856.1\|WP_095575515.1\|311828_312557_+\|transcriptional-regulator	gnl\|CDD\|379352	pfam13730, HTH_36, Helix-turn-helix domain.	0.000400988
NZ_AP014856.1\|WP_095575511.1\|303007_303562_+\|site-specific-DNA-recombinase	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	2.36371e-66
NZ_AP014856.1\|WP_095575513.1\|308731_309271_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	3.85402e-50

>NZ_AP014856.1|WP_095575513.1|308731_309271_-|recombinase-family-protein
MSNIGYKRVSTVDQNTDRQLAGVTLDKVFEDKLSGKDTNRPGLQACLAYLREGDTLHVHSLDRLGRNTLDILALVEQLNNRGVIVRFHKEGIIADITSAMGKMMLTMLSAVATCERELMLERKREAQAVNPTKRGNGKAVDREGIKKALSDGLSVRKTAEIFNVAPSTVQRIKKEEEEA
>NZ_AP014856.1|WP_000788777.1|308144_308303_+|hypothetical-protein
MKNIAAIKRNNRKIHARKFLSTPEGKAWLERKQRENEERKLLSELKWLREDF
>NZ_AP014856.1|WP_095575512.1|305632_307099_+|hypothetical-protein
MKKISDEQINIEAQSGYRPWTIDSGIGLLPFSELGDREFELLCYLLVKNEIEDGKHKNISSISLMQGVSERGRDCVLYHNGVVSGLIQCKKMQGRITRPQALREIIKFLLFSIIDNSLLPAPDCFEYKLYVSNDIAETTNSLIHSYSTEVEVEIKSDTISKYIKDVVSEYESFKIFENSLPISKVIDLLRRINVTASNATDLTLRVHKYDSLLSLFFNVKTVIDLESADKVIRNALDDYGLKYLTDEDLKQLQIRISNTKEENRINLGFVDFFGYNKEFFKSLKGEPFKQVIEAVVSVTLSLDKYLMEFINSKINELVFENVTIKLLNLGRIHPFSVGVVAPYLFQRLSIKVVSRKLPTELVTKFYEQASLSKKELIDSIAIQLFETSERVMKGDFSQLVGNPEDIQFKKRIFTHIHNGFNSIEDAKTTFSRDIQIIMPTLDFIEEKIGELLQEERTVVIKDASFLDNDDEIKKIAKTLSMIEPNPGA
>NZ_AP014856.1|WP_001333214.1|304897_305317_+|hypothetical-protein
MKYCYLIILSLTISSAQAETFPAKLTCNTGEQITLKVTGPEQRLIYTSSLYGTFHGYLDVFKGLSPERQYEVLANIHGIARYRDSPLHFTLLMKRTNGEMDNGSIIYRYTYLKDEQLIDEEGHCSPIKDGGFIEGSKSY
>NZ_AP014856.1|WP_000355479.1|303619_304393_-|hypothetical-protein
MDITEFPSGVIEHLGWYVYRLIDPRDGSTFYVGKGKGNRVFAHMRGEVAAADDDELLSNKLKQIREIRLAGLEVIHVIHRHGMTDEKTAYEVEAALIDAYPGLTNIMNGAGSNEFGAAHVKELIATYQPETITFHHKALMISVNRSAKDSELYDAVRFSWRINVSRASQAEVILATVRGIVRGVFIADKWLKSTRENFPTMKYWDEDPDFEATQSSRYGFEGREAPPEIANLYLGKKIPDELRKKGAMSPVRYSPNF
>NZ_AP014856.1|WP_095575511.1|303007_303562_+|site-specific-DNA-recombinase
MLIGYVRVSTNDQNTDLQRNALNCAGCELIFEDKISGTKSERPGLKKLLRTLSAGDTLVVWKLDRLGRSMRHLVVLVEELRERGINFRSLTDSIDTSTPMGRFFFHVMGALAEMERELIVERTKAGLETARAQGRIGGRRPKLTPEQWAQAGRLIAAGTPRQKVAIIYDVGVSTLYKKFPVGDK
>NZ_AP014856.1|WP_089618264.1|302585_302981_-|hypothetical-protein
MMPFACYFFIFINVGLGEAAKRNVGTGSGQIPDMSSFSGSIASKGYQKLPGGLIIQWGAGDAGTGYVGSTGNEMNFPIAFPSQCFQVVTSYDNGGGKIVAGAAGNMTRTGFLLRCDASGGNYNFRWFAIGC
>NZ_AP014856.1|WP_089618265.1|302140_302584_-|tail-fiber-assembly-protein
MSNYYFSRTTLAFYPVDMLELYRSYDSLPDDITPVSDEIFLTYSGTPPEGKARGANDDGQPKWVDILPMAPEEAMLLATAQKQNLIDNANEYMNSKQWPGKAAIGRLKGEELAQYNLWLDYLDALELVDTSSAPDIEWPTPPAVQAR
>NZ_AP014856.1|WP_072794540.1|301566_302169_+|tail-fiber-assembly-protein
MDNAVLNSELIATKAGNITVYNYDGETREYISTSNEYLAIGVGIPAYSCLDAPVTHKAGYAICRSADFNSWEYVPDHRGEIVYNTETGDAKEITAPGDYPEKTTTLAPLTPYDKWDGEKWVTDTEAQHSAAVEAAEAQRQSLIDAAMASISLIQLKLQAGRKLTQTENTRLNAVLDYIDAVTATDTSTAPDVIWPELPEA
>NZ_AP014856.1|WP_095575510.1|300826_301567_+|tail-fiber-protein
MHRIDTKTAQKDKFGAGKNGFTRGNPQTGTPATDLDDDYFDMLQEELCSVVEASGASLEKARHDQLLTALRALLLSRKNPFGDIKSDGTVKTALENLGLGEGSALPVGVPVPWPSATPPTGWLKCNGAAFSAEEYPELAKAYPTNKLPDLRGEFIRGWDDGRGIDTGRALLSIQSDEVRKLALKYWGPASNSSPSKTFALSDSAGGGLYTDGISQASGGIINAFQLPGGSETRPRNIAFNYIVRAA
>NZ_AP014856.1|WP_172843344.1|311405_311582_+|hypothetical-protein
MKWFTPEHVVQAFKKGELTRHQVVMNRNMARSRGYPERAACFNEALKIIDELRKNEKE
>NZ_AP014856.1|WP_000005469.1|311604_311775_+|hypothetical-protein
MSETTEKKRQPRTCFHIPDEVFQVLFKEARSRRITVTDYILDMLKREAETLSNKSK
>NZ_AP014856.1|WP_095575515.1|311828_312557_+|transcriptional-regulator
MINQLTFTKHYDTFDNVSKIYSDKFPQGKDLDLLHIVLYFRFLSYQENNLNCYESHETLAKIFKSSASTIKRKINDLKEMGLLETSPHPDPYISSLIYNALPLTDAHITAPREAKASVNAEKPQTEQVSTVKAVPDQLPPTEDNKQPSFDVLDDDWDAPLPWETEETPVSSSEKVANDNEEDVLENFASLIITQKNTRTGGASFIEFANSLAYRHGLKRPNGIEAYFAKKHPKVYEDFDIPF
>NZ_AP014856.1|WP_075826105.1|312568_312847_+|hypothetical-protein
MIQYLVKNQVDRIQCNDTGKRIYETLAYLYKGKPTPLKYSDVLHRAACSEDGLKFWLKQLSNFGVIEIKELSFSTFNLKRLDKEIEFIYSTL
>NZ_AP014856.1|WP_016159682.1|312979_313390_+|hypothetical-protein
MAKRKNNVVKKIGDSASLLSKPKSILRRKDFKELVTLTKQNSAPGEWKTEIIEHSPSVPCGDEYIALQEILSSTPGVFWKPRKRKEYIVDSSDLRKYQILGFEDYNHYVGYLATNGLNNLVPEFQILDNADHYGDF
>NZ_AP014856.1|WP_088213470.1|313391_313730_+|hypothetical-protein
MNKNTYDTIYSLINYYEDDYLLPLNRAELEAYKENTPGALNEAFKHWDLAVNAFEHLSKRVEMLCKRENAYLTADQIWELSNWIEDIESDVRYVGDGLVELAQRLGATITEE
>NZ_AP014856.1|WP_021560779.1|314079_314292_+|hypothetical-protein
MLFLNDKEQIIKYKDEMLKINPQITEMVAKYAGCSVEEVERCVEKYFSPSTPSTPSLNELIKLKAKEITK
>NZ_AP014856.1|WP_001570993.1|314288_314651_+|hypothetical-protein
MIIDLDTLFPVRKTFTDIVSYCTDPFASVESKVFASLPADVECGDLITSTGAKYESGDDIYVVMSEFVTAGENKPVDVLRSNAGLVCIKADALNAVSEAAKTALIKKGFQLEGFHSVFTS
>NZ_AP014856.1|WP_095575516.1|314669_315698_+|major-capsid-protein
MILGNDYVDLAPLFQAHSTRNFLLSTLDFTDPVGVSSHKVAVSQLVESNESLFNKETSRFSSEHNVTKREQGKEWLIEIPYFLREDVIRPSDVQGKRKPGTDFQETLTDIYAEYIAKHHVAYQRTKESVLAASLFSGKTYTPKTDDVLIEWSKLFNVAPMKATLNASSTDTTKIFKEFDQIATNIFEITQSQASAVERIVVFCKPEAFSAIRFSAGMANAFQYVSPLEEGNVVYQRRDLLPGVTAFTIPGTNIDVIKLVDPLHLAHMTADAVAVPKFAKGSNVYQNIYGAASSTFELINAAPAEVYSYSYESSRGDAVNVVTENSQMVVNHGVGFSVQITVK
>NZ_AP014856.1|WP_000452041.1|315784_315988_+|hypothetical-protein
MEVILKSKNGVHVHLDANDSRGLLNLKYLCSLLDVPYEGVKARMFRLNESIDQALHHFLSKEGGKND

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_AP014856_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014856_2

2805891-2806039

Orphan

I-E

Consensus_repeat	Method
CCGGTTTATCCCCGCTGACGCGGGGAACCCCA	PILER-CR
TTATCCCCGCTGACGCGGGGAAC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_AP014856_2

>merge|NZ_AP014856|2|2805891-2806039|PILER-CR,CRISPRCasFinder
TTATCCCCGCTGACGCGGGGAACTCCAACTGATCGCGTCTTCTGGCGATTGCGAGTCCGGTTTATCCCCGCTGACGCGGGGAACCCCACGGCAAGTCGCGTAGTAACGTCTGGATGACCGGTTTATCCCCGCTGACGCGGAGAACCCTC

>NZ_AP014856|2|1|2805891-2806039|PILER-CR
TTATCCCCGCTGACGCGGGGAACTCCAACTGA	TCGCGTCTTCTGGCGATTGCGAGTCCGGT
TTATCCCCGCTGACGCGGGGAACCCCACGGCA	AGTCGCGTAGTAACGTCTGGATGACCGGT
TTATCCCCGCTGACGCGGAGAACCCTC

>NZ_AP014856|2|2|2805891-2806035|CRISPRCasFinder
TTATCCCCGCTGACGCGGGGAAC	TCCAACTGATCGCGTCTTCTGGCGATTGCGAGTCCGGT
TTATCCCCGCTGACGCGGGGAAC	CCCACGGCAAGTCGCGTAGTAACGTCTGGATGACCGGT
TTATCCCCGCTGACGCGGAGAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014856.1\|WP_000059308.1\|2800430_2801885_-\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_AP014856.1\|WP_095575974.1\|2809905_2810799_+\|YgcG-family-protein	unknown	unknown	gnl\|CDD\|224429
NZ_AP014856.1\|WP_059221010.1\|2798245_2799022_-\|electron-transfer-flavoprotein-subunit-beta/FixA-family-protein	unknown	unknown	gnl\|CDD\|224997
NZ_AP014856.1\|WP_059221023.1\|2817444_2818746_-\|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD	unknown	unknown	gnl\|CDD\|237291
NZ_AP014856.1\|WP_001071676.1\|2814109_2814901_-\|nucleoside-triphosphate-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|236569
NZ_AP014856.1\|WP_059221017.1\|2804362_2805841_+\|sugar-kinase	unknown	unknown	gnl\|CDD\|212662
NZ_AP014856.1\|WP_000210886.1\|2812244_2813882_-\|CTP-synthase-(glutamine-hydrolyzing)	unknown	unknown	gnl\|CDD\|235437
NZ_AP014856.1\|WP_001130256.1\|2796545_2797121_+\|glycerol-3-phosphate-responsive-antiterminator	unknown	unknown	gnl\|CDD\|224865
NZ_AP014856.1\|WP_000036723.1\|2810858_2812157_-\|phosphopyruvate-hydratase	unknown	unknown	gnl\|CDD\|234617
NZ_AP014856.1\|WP_054412444.1\|2801954_2802740_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187605
NZ_AP014856.1\|WP_059221021.1\|2815162_2817397_-\|GTP-diphosphokinase	unknown	unknown	gnl\|CDD\|182797
NZ_AP014856.1\|WP_001199973.1\|2806375_2807047_-\|7-carboxy-7-deazaguanine-synthase-QueE	unknown	unknown	gnl\|CDD\|275126
NZ_AP014856.1\|WP_059216800.1\|2807218_2807821_+\|LemA-family-protein	unknown	unknown	gnl\|CDD\|224618
NZ_AP014856.1\|WP_171002511.1\|2797388_2798282_-\|electron-transfer-flavoprotein-subunit-alpha/FixB-family-protein	unknown	unknown	gnl\|CDD\|224936
NZ_AP014856.1\|WP_059221015.1\|2803058_2804336_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|349949
NZ_AP014856.1\|WP_072243589.1\|2798999_2800409_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_AP014856.1\|WP_095575973.1\|2808751_2809900_+\|TPM-domain-containing-protein	unknown	unknown	gnl\|CDD\|224429
NZ_AP014856.1\|WP_059221006.1\|2795006_2796278_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|182194
NZ_AP014856.1\|WP_095575972.1\|2807834_2808737_+\|YgcG-family-protein	unknown	unknown	gnl\|CDD\|224429
NZ_AP014856.1\|WP_000109510.1\|2796268_2796529_+\|ferredoxin-family-protein	unknown	unknown	gnl\|CDD\|225289

Protein	Function_ID	Function_description	E-value
NZ_AP014856.1\|WP_000059308.1\|2800430_2801885_-\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	7.53117e-83
NZ_AP014856.1\|WP_095575974.1\|2809905_2810799_+\|YgcG-family-protein	gnl\|CDD\|224429	COG1512, COG1512, Beta-propeller domains of methanol dehydrogenase type [General function prediction only].	1.48517e-102
NZ_AP014856.1\|WP_059221010.1\|2798245_2799022_-\|electron-transfer-flavoprotein-subunit-beta/FixA-family-protein	gnl\|CDD\|224997	COG2086, FixA, Electron transfer flavoprotein, beta subunit [Energy production and conversion].	1.8585e-62
NZ_AP014856.1\|WP_059221023.1\|2817444_2818746_-\|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD	gnl\|CDD\|237291	PRK13168, rumA, 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD.	0
NZ_AP014856.1\|WP_001071676.1\|2814109_2814901_-\|nucleoside-triphosphate-pyrophosphohydrolase	gnl\|CDD\|236569	PRK09562, mazG, nucleoside triphosphate pyrophosphohydrolase; Reviewed.	1.93278e-158
NZ_AP014856.1\|WP_059221017.1\|2804362_2805841_+\|sugar-kinase	gnl\|CDD\|212662	cd07779, FGGY_ygcE_like, uncharacterized ygcE-like proteins. This subfamily consists of uncharacterized hypothetical bacterial proteins with similarity to Escherichia coli sugar kinase ygcE , whose functional roles are not yet clear. Escherichia coli ygcE is recognized by this model, but is not present in the alignment as it contains a deletion relative to other members of the group. These proteins belong to the FGGY family of carbohydrate kinases, the monomers of which contain two large domains, which are separated by a deep cleft that forms the active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain.	1.02161e-107
NZ_AP014856.1\|WP_000210886.1\|2812244_2813882_-\|CTP-synthase-(glutamine-hydrolyzing)	gnl\|CDD\|235437	PRK05380, pyrG, CTP synthetase; Validated.	0
NZ_AP014856.1\|WP_001130256.1\|2796545_2797121_+\|glycerol-3-phosphate-responsive-antiterminator	gnl\|CDD\|224865	COG1954, GlpP, Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription].	1.33799e-87
NZ_AP014856.1\|WP_000036723.1\|2810858_2812157_-\|phosphopyruvate-hydratase	gnl\|CDD\|234617	PRK00077, eno, enolase; Provisional.	0
NZ_AP014856.1\|WP_054412444.1\|2801954_2802740_-\|SDR-family-oxidoreductase	gnl\|CDD\|187605	cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs. Ga5DH catalyzes the NADP-dependent conversion of carbon source D-gluconate and 5-keto-D-gluconate. This SDR subgroup has a classical Gly-rich NAD(P)-binding motif and a conserved active site tetrad pattern. However, it has been proposed that Arg104 (Streptococcus suis Ga5DH numbering), as well as an active site Ca2+, play a critical role in catalysis. In addition to Ga5DHs this subgroup contains Erwinia chrysanthemi KduD which is involved in pectin degradation, and is a putative 2,5-diketo-3-deoxygluconate dehydrogenase. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107,15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	3.30347e-139
NZ_AP014856.1\|WP_059221021.1\|2815162_2817397_-\|GTP-diphosphokinase	gnl\|CDD\|182797	PRK10872, relA, (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional.	0
NZ_AP014856.1\|WP_001199973.1\|2806375_2807047_-\|7-carboxy-7-deazaguanine-synthase-QueE	gnl\|CDD\|275126	TIGR04322, organic_radical_activating_enzyme, putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE. Members of this radical SAM domain protein family appear to be the E. coli form of the queuosine biosynthesis protein QueE. QueE is involved in making preQ0 (7-cyano-7-deazaquanine), a precursor of both the bacterial/eukaryotic modified tRNA base queuosine and the archaeal modified base archaeosine. Members occur in species that lack known forms of QueE but usually are not found in queuosine biosynthesis operons. Members of this family tend to form bi-directional best hit matches to members of known (TIGR03365) and putative (TIGR03963) QueE families from other lineages.	3.98248e-155
NZ_AP014856.1\|WP_059216800.1\|2807218_2807821_+\|LemA-family-protein	gnl\|CDD\|224618	COG1704, LemA, Uncharacterized conserved protein [Function unknown].	5.76753e-77
NZ_AP014856.1\|WP_171002511.1\|2797388_2798282_-\|electron-transfer-flavoprotein-subunit-alpha/FixB-family-protein	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	1.36093e-82
NZ_AP014856.1\|WP_059221015.1\|2803058_2804336_+\|MFS-transporter	gnl\|CDD\|349949	cd06174, MFS, Major Facilitator Superfamily. The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.	1.01506e-28
NZ_AP014856.1\|WP_072243589.1\|2798999_2800409_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.37491e-50
NZ_AP014856.1\|WP_095575973.1\|2808751_2809900_+\|TPM-domain-containing-protein	gnl\|CDD\|224429	COG1512, COG1512, Beta-propeller domains of methanol dehydrogenase type [General function prediction only].	5.86892e-51
NZ_AP014856.1\|WP_059221006.1\|2795006_2796278_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|182194	PRK10015, PRK10015, oxidoreductase; Provisional.	5.97805e-123
NZ_AP014856.1\|WP_095575972.1\|2807834_2808737_+\|YgcG-family-protein	gnl\|CDD\|224429	COG1512, COG1512, Beta-propeller domains of methanol dehydrogenase type [General function prediction only].	3.13583e-88
NZ_AP014856.1\|WP_000109510.1\|2796268_2796529_+\|ferredoxin-family-protein	gnl\|CDD\|225289	COG2440, FixX, Ferredoxin-like protein [Energy production and conversion].	1.46365e-41

>NZ_AP014856.1|WP_059221017.1|2804362_2805841_+|sugar-kinase
MSKKYIIGIDGGSQSTKVVMYDLEGNVVCEGKGLLQPMHTPDANTAEHPDDDLWASLCFAGHDLMSQFAGNKEDIVGIGLGSIRCCRALLKADSTPAAPLISWQDARVTRPYEHTNSDVAYVTSFSGYLTHRLTGEFKDNIANYFGQWPVDYKTWAWSEDAAVMEKFNIPRQMLFDVQMPGTVLGHITPQAALATHFPAGLPVVCTTSDKPVEALGAGLLDDETAVISLGTYIALMMNGKALPKAPVAYWPIMSSIPETLLYEGYGIRKGMWTVSWLRDMLGESLIQDAKALDLSPEDLLNKKASCVPPGCNGLMTVLDWLTNPWEPYKRGIMIGFDSSMDYAWIYRSILESVALTLKNNYDNMCNEMNHFAKHVIITGGGSNSDLFMQIFADVFNLPARRNAINGCASLGAAINTAVGLGLYPDYATAVDKMVRVKDVFMPVESNAKRYDAMNKGIFKDLTKHTDVILKKSYEVMHGELGNADSIQSWSNA
>NZ_AP014856.1|WP_059221015.1|2803058_2804336_+|MFS-transporter
MQHNSYRRWITLAIISFSGGVSFDLAYLRYIYQIPMAKFMGFSNTEIGLIMSTFGIAAIILYAPSGVIADKFSHRKMITSAMVITGLLGLLMATYPPLWVMLCIQVAFAITTILMLWSVSIKAASLLGDHSEQGKIMGWMEGLRGVGVMSLAVFTMWVFSRFAPDDSASLKTVIIIYSVVYILLGILCWFFVSDNNNLRSANNEEKQSFQLSDILAVLRISTTWYCSMVIFGVFTIYAILSYSTNYLTEMYGMSLVAASYMGIVINKIFRALCGPLGGIITTYSKVKSPTRVVQILSIIGLLALTALLITNSNPQSVAMGIGLILLLGFTCYASRGLYWACPGEARTPSYIMGTTVGICSVIGFLPDVFVYPIIGYWQDTLPAAEAYRNMWLMGMAALAMVIVFTFLLFQKIRTADSASVMASSK
>NZ_AP014856.1|WP_054412444.1|2801954_2802740_-|SDR-family-oxidoreductase
MSIESLNAFSMDFFSLKGKTAIVTGGNSGLGQAFAMALAKAGANLFIPSFVKDNGETKEMIEKQGVEVDFMQVDITAKGAPQKIIAACCERFGTVDILVNNAGICKLNKVLDFGRADWDPMIDVNLTAAFELSYEAAKIMIPQKSGKIINICSLFSYLGGQWSPAYSATKHALAGFTKAYCDELGQYNIQVNGIAPGYYATDITLATRSNPETNQRVLDHIPANRWGDTQDLMGAAVFLASPASNYVNGHLLVVDGGYLVR
>NZ_AP014856.1|WP_000059308.1|2800430_2801885_-|FAD-binding-oxidoreductase
MSLSRAAIVDQLKEIVGADRVITDETVLKKNSIDRFRKFPDIHGIYTLPIPAAVVKLGSTEQVSRVLNFMNAHKINGVPRTGASATEGGLETVVENSVVLDGSAMNQIINIDIENMQATAQCGVPLEVLENALREKGYTTGHSPQSKPLAQMGGLVATRSIGQFSTLYGAIEDMVVGLEAVLADGTVTRIKNVPRRAAGPDIRHIIIGNEGALCYITEVTVKIFKFTPENNLFYGYILEDMKTGFNILREIMVEGYRPSIARLYDAEDGTQHFTHFADGKCVLIFMAEGNSRIAKATGEGIAEIVARYPQCQRVDSKLIETWFNNLNWGPDKVAAERVQILKTGNMGFTTEVSGCWSCIHEIYESVINRIRTEFPHADDITMLGGHSSHSYQNGTNMYFVYDYNVVDCKPEEEIDKYHNPLNKIICEETIRLGGSMVHHHGIGKHRVHWSKLEHGSAWALLEGLKKQFDPNGIMNTGTIYPIEK
>NZ_AP014856.1|WP_072243589.1|2798999_2800409_-|MFS-transporter
MTGRCLFGFSGEKPFLLPDNEGVKMNTSPVRMDDLPLNRFHCRIAALTFGAHLTDGYVLGVIGYAIIQLTPAMQLTPFMAGMIGGSALLGLFLGSLVLGWISDHIGRQKIFTFSFLLITLASFLQFFATTPEHLIGLRILIGIGLGGDYSVGHTLLAEFSPRRHRGILLGAFSVVWTVGYVLASIAGHHFISENPEAWRWLLASAALPALLITLLRWGTPESPRWLLRQGRFAEAHAIVHRYFGPHVLLGDEVATATHKHIKTLFSSRYWRRTAFNSVFFVCLVIPWFVIYTWLPTIAQTIGLEDALTASLMLNALLIVGALLGLVLTHLLAHRRFLLGSFLLLAVTLMVMACLPSGSSLTLLLFVLFSTTISAVSNLVGILPAESFPTDIRSLGVGFATAMSRLGAAVSTGLLPWVLAQWGMQVTLLLLATVLLVGFVVTWLWAPETKALPLVAAGNVGGANEHSVSV
>NZ_AP014856.1|WP_059221010.1|2798245_2799022_-|electron-transfer-flavoprotein-subunit-beta/FixA-family-protein
MNILLAFKAEPDAGMLVEKEWQAAQGNSGPDVSLLRSLLGADEQAAAAILLAQRKNGTPMSLTALSMGNERALHWLRYLMALGFEEAVLLETAADLRFAPEFVARHIAEWQYQNSLDLIITGCQSSEGQNGQTPFLLAEMLGWPCFTQVERFTLDAPFITLEQRTEHGLRCCRVRLPAVIAVRQCGEVALPVPGMRQRMAAGKAEITRETLVAESPAIQCLRLARPEQRRSATLIDGQTVEEKAQKLWQDYLRQRIQP
>NZ_AP014856.1|WP_171002511.1|2797388_2798282_-|electron-transfer-flavoprotein-subunit-alpha/FixB-family-protein
MAGLFTPEDTAMNIAIVTINQDHAAMANWLAEQDFSGCTLTHWQIEPQPMVAEQVLDALVEQWQRTPAEVVLFPPGVFGDELATRLAWRVHGASICQVISCDISTVSVRKSHWGNALMATLQTEKRPLCLSLARQAGAAKNATLPSGMQQLNIVPGALPDWLVSIEDLKNVTRDPLVEARWVLVVGQGGEADSHEIAMLAEKLGAEVGYSRARVMNGGFDAEKVIGISGHLLAPDVCIVAGASGAAALMAGVRNSQFVVAINHDASAAVFSQADVGVVDDWKTVLEALVTNIHADCL
>NZ_AP014856.1|WP_001130256.1|2796545_2797121_+|glycerol-3-phosphate-responsive-antiterminator
MPLLHLLRQNPVIAAVKDNASLQLAIDSECQFISVLYGNICTISHIVKKIKSAGKYAFIHVDLLEGASNKEVVIQFLKLVTEADGIISTKASMLKAARAEGFFCIHRLFIVDSISFHNIDKQVAQSNPDCIEILPGCMPKVLGWVTEKIRQPLIAGGLVCDEEDARNAINAGVVALSTTNTGVWTLAKKLL
>NZ_AP014856.1|WP_000109510.1|2796268_2796529_+|ferredoxin-family-protein
MSVARNLWRAADAPHIVPADSVERQTAQRLINACPAGLFSLTPEGDLRVDYRGCLECGTCRLLCDEKNLQQWRYPPSGFGITYRFG
>NZ_AP014856.1|WP_059221006.1|2795006_2796278_+|FAD-dependent-oxidoreductase
MEDDCDIIIIGAGIAGTACALRCARAGLSVLLLERAEIPGSKNLSGGRLYTHALAELLPQYHLTAPLERRITHESLSLLTPDGATTFSSLQPGGESWSILRARFDPWLVAEAEKEGVECIPGATVDTLYEENGRICGVICGDDILRARYVVLAEGANSILAEQHGLVTRPAGEAMALGIKEVLALEASSIEERFHLENNEGAALLFSGGICDDLPGGAFLYTNQQTLSLGIVCPLSSLTQSRVPASELLARFKTHPAVRPLIKNTESLEYGAHLVPEGGLHSMPVQYGGNGWLLVGDALRSCVNTGISVRGMDMALTGAQAAAQTLISACQHREPQNLFPLYHHNVERSLQWDVLQRYQHVPALLQRPGWYRAWPALMQDISRDLWDQGDKPVPPLRQLLWRHLRRHGLWHLAGDVIRSLRCL
>NZ_AP014856.1|WP_001199973.1|2806375_2807047_-|7-carboxy-7-deazaguanine-synthase-QueE
MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWEKLEDREVSLFSILAKTKESDKWGAASSEDLLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRVRDIEALDELLATLTDDKPRVIALQPISQKDDATRLCIETCIARNWRLSMQTHKYLNIA
>NZ_AP014856.1|WP_059216800.1|2807218_2807821_+|LemA-family-protein
MFKIFIIFILIFNLSGCGYNDIQTYDEQVNASWSEVLNQYQRRADLIPNLVASIKGYSSHEKEVLEAVTLARSQANRASNDLQQAPGDEQKLQAWQQAQAQVSRTLGQLTIISERYPELKAQELYQNLMVQLEGSENRIAVARGRYIKAIEQYNVTIRKFPAVLTAKVMDYTPKKNYLPDDVAAVSKAPTIDFSQSANAH
>NZ_AP014856.1|WP_095575972.1|2807834_2808737_+|YgcG-family-protein
MRIFIFLLAFFCSSAFATQTPVPELPRYVNDLTDTLTNSEVNALTRQIKTLAQEKQAQVVVLVVETTGDETIEQYATRVFDSWKPGDKNRDDGVLLLVAWQDHSVRIEIGYGLEGVITDAQSGQIIRKSIIPAFKNGGLAGGLQKGISDIESRLARNNLATITPTDPPLPFSGWWALLVWAIVLMFIAARGYVKTLGLICFAAIILAFVLPIAGFSGSWGVLITLLCFATPFLAVAIAFTPFGKKVRDSMRNANQPSREGRNRSSSWHSSSSSSSSSSFDNDHFSGGGGSSGGGGASGRW
>NZ_AP014856.1|WP_095575973.1|2808751_2809900_+|TPM-domain-containing-protein
MRIFLLLLMLCGFPVSAEQTSSVTDLTGMLTTEEQTVLTQQLQTIEKQNHVQVAVLVTPTTEGKSIKLAASQAYGLYHWKPTEGQRYGEGILILVVWPEGLASMKIGHGLEQMLPPEQAAQIVRYHMQPEFEKNNLFAGLRGGIESIAQFTHIKANLSPLDALANHLFANPQLSLPCLAWTVLMIVAIIVLWRFTSRPGPGIWMISMITPTVWFFCFQDDVIIRRVSVVCFSLFFAAICWQRLAVVFNMCRAFPMMLAPQNKNAKVKKQKKTPQVRESGRNSLFVVLLIIVVGWCLVFASNNDIAFISTIIGLIDHFIGPITIAGIVLLIIVAKFTGNLKLGSGHKSNRKMGNRNAHSRSSSKNSFRGGGGSSGGGGSSGRW
>NZ_AP014856.1|WP_095575974.1|2809905_2810799_+|YgcG-family-protein
MRLILFLLTLWCLPVLAQQIAVPELRQQVIDITGTLSTSEQQSLTQQLQDITHKTQAQVAVLIVPSTGDDTIEQYATRVFDSWKLGDKQRNDGILLLVAWEDHAVRIEVGYGLEGVVTDLQAAKIIRDILIPAFKSDDLMGGLTLASENIGALLLNDELPEDRGNYYRINPPIPLSLAVILLLAVLSYFIVFTDPSNLLWIALTGAIYGMVFLYVAEPGPWTSLIVACGMLTPFAIIALLIFWLIVNKKLRAKYKKLGKERASRKSSSSSSSGGGSSGGGFSGGGGSSGGGGASGRW
>NZ_AP014856.1|WP_000036723.1|2810858_2812157_-|phosphopyruvate-hydratase
MSKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFLGKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVKEAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKAPYNGRKEIKGQA
>NZ_AP014856.1|WP_000210886.1|2812244_2813882_-|CTP-synthase-(glutamine-hydrolyzing)
MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKERRGDYLGATVQVIPHITNAIKERVLEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQMAVEIGREHTLFMHLTLVPYMAASGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERAKIALFCNVPEKAVISLKDVDSIYKIPGLLKSQGLDDYICKRFSLNCPEANLSEWEQVIFEEANPVSEVTIGMVGKYIELPDAYKSVIEALKHGGLKNRVSVNIKLIDSQDVETRGVEILKGLDAILVPGGFGYRGVEGMITTARYARENNIPYLGICLGMQVALIDYARHVANMENANSTEFVPDCKYPVVALITEWRDENGNVEVRSEKSDLGGTMRLGAQQCQLADDSLVRRLYNAPTIVERHRHRYEVNNMLLKQIEDAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAASEFQKRQAK
>NZ_AP014856.1|WP_001071676.1|2814109_2814901_-|nucleoside-triphosphate-pyrophosphohydrolase
MNQIDRLLTIMQRLRDPESGCPWDKEQTFSSIAPYTLEETYEVLDAIAREDFDDLRGELGDLLFQVVFYAQMAQEEGRFDFNDICAAISDKLERRHPHVFADGSAGSSREVLTRWEQIKTEERAQKAQHSALDDIPRSLPALMRAQKIQKRCANVGFDWTTLGPVVDKVYEEIDEVMYEARQAVVDQAKLEEEMGDLLFATVNLARHLGTKAEIALQKANEKFERRFREVERIVAARGLEMTGVDLETMEEVWQQVKRQEIDL
>NZ_AP014856.1|WP_059221021.1|2815162_2817397_-|GTP-diphosphokinase
MVAVRSAHINKAGEFDPQKWIASLGIASQKSCECLAETWAYCLQQTQGHPDASLLLWRGVEMVEILSTLSMDIDTLRAALLFPLADANVVSEDVLRESIGKSVVNLIHGVRDMAAIRQLKATHTDSVSSEQVDNVRRMLLAMVDDFRCVVIKLAERIAHLREVKDAPEDERVLAAKECTNIYAPLANRLGIGQLKWELEDYCFRYLHPTEYKRIAKLLHERRLDREHYIEEFVGHLRAEMKAEGVKAEVYGRPKHIYSIWRKMQKKNLAFDELFDVRAVRIVAERLQDCYAALGIVHTHYRHLPDEFDDYVANPKPNGYQSIHTVVLGPGGKTVEIQIRTKQMHEDAELGVAAHWKYKEGTASGGARSGHEDRIAWLRKLIAWQEEMADSGEMLDEVRSQVFDDRVYVFTPKGDVVDLPVGSTPLDFAYHIHSDVGHRCIGAKIGGRIVPFTYQLQMGDQIEIITQKQPNPSRDWLNPTLGYVTTSRGRSKIHAWFRKQDRDKNILAGRQILDDELEHLGISLKEAEKHLLPRYNFNDVDELLAAIGGGDIRLNQMVNFLQSQFNKPSAEEQDAAALKQLQQKNYTPQNRSKDNGRVVVEGVGNLMHHIARCCQPIPGDEIVGFITQGRGISVHRADCEQLAELRSHAPERIVDAVWGESYSAGYSLVVRVMANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS
>NZ_AP014856.1|WP_059221023.1|2817444_2818746_-|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD
MAQFYSAKRRVTTRQIITVSVNDLDSFGQGVARHNGKTLFIPGLLPQENAEVTVTEDKKQYARAKVVRRLSDSPERETPRCPHFGVCGGCQQQHASVELQQRSKSAALARLMKHDVSDVIADTPWGYRRRARLSLNYLPKTQQLLMGFRKSGTSDIVDIKQCPILVPQLEALLPKVRACLMSLQAIRHLGHVELVQATSGTLMILRHTAPLNSADREKLERFSHSEGLDLYLAPDSEILETVSGEMPWYDANGLRLTFSPRDFIQVNAGVNQKMVAQALEWLDVQSDDRVLDLFCGMGNFTLPVATRAASVVGVEGVPALVEKGQENARLNGLHNVTFYHENLEDDVTKQPWAKNGFDKVLLDPARAGAAGVMQQIIKLEPIRIVYVSCNPATLARDSEALLKAGYTIARLAMLDMFPHTGHLESMVLFSRVK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_AP014856_2	2.1\|2805923\|29\|NZ_AP014856\|PILER-CR	2805923-2805951	29	NZ_CP022220	Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence	329037-329065	4	0.862
NZ_AP014856_2	2.1\|2805923\|29\|NZ_AP014856\|PILER-CR	2805923-2805951	29	NZ_CP030052	Bradyrhizobium guangdongense strain CCBAU 51649 plasmid unnamed, complete sequence	921082-921110	4	0.862
NZ_AP014856_2	2.1\|2805923\|29\|NZ_AP014856\|PILER-CR	2805923-2805951	29	NZ_CP030054	Bradyrhizobium guangzhouense strain CCBAU 51670 plasmid unnamed1, complete sequence	121386-121414	4	0.862
NZ_AP014856_2	2.1\|2805923\|29\|NZ_AP014856\|PILER-CR	2805923-2805951	29	NZ_CP020081	Vibrio campbellii strain 20130629003S01 plasmid pVCGX4, complete sequence	74566-74594	6	0.793
NZ_AP014856_2	2.1\|2805923\|29\|NZ_AP014856\|PILER-CR	2805923-2805951	29	NZ_CP019297	Vibrio campbellii strain LMB29 plasmid pLMB99, complete sequence	82579-82607	6	0.793
NZ_AP014856_2	2.1\|2805923\|29\|NZ_AP014856\|PILER-CR	2805923-2805951	29	NZ_CP021661	Candidatus Fukatsuia symbiotica strain 5D plasmid p5D_Fsymbiotica-2	46680-46708	7	0.759

1. spacer 2.1|2805923|29|NZ_AP014856|PILER-CR matches to NZ_CP022220 (Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence) position: , mismatch: 4, identity: 0.862

-actgatcgcgtcttctggcgattgcgagt	CRISPR spacer
tactg-ccgcgtcgtctggcgatggcgagt	Protospacer
 **** .****** ********* ******

2. spacer 2.1|2805923|29|NZ_AP014856|PILER-CR matches to NZ_CP030052 (Bradyrhizobium guangdongense strain CCBAU 51649 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.862

-actgatcgcgtcttctggcgattgcgagt	CRISPR spacer
tactg-ccgcgtcgtctggcgatggcgagt	Protospacer
 **** .****** ********* ******

3. spacer 2.1|2805923|29|NZ_AP014856|PILER-CR matches to NZ_CP030054 (Bradyrhizobium guangzhouense strain CCBAU 51670 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.862

-actgatcgcgtcttctggcgattgcgagt	CRISPR spacer
tactg-ccgcgtcgtctggcgatggcgagt	Protospacer
 **** .****** ********* ******

4. spacer 2.1|2805923|29|NZ_AP014856|PILER-CR matches to NZ_CP020081 (Vibrio campbellii strain 20130629003S01 plasmid pVCGX4, complete sequence) position: , mismatch: 6, identity: 0.793

actgatcgcgtcttctggcgattgcgagt	CRISPR spacer
gttgatagcgtcttctggcgattgagaag	Protospacer
..**** ***************** **.

5. spacer 2.1|2805923|29|NZ_AP014856|PILER-CR matches to NZ_CP019297 (Vibrio campbellii strain LMB29 plasmid pLMB99, complete sequence) position: , mismatch: 6, identity: 0.793

actgatcgcgtcttctggcgattgcgagt	CRISPR spacer
gttgatagcgtcttctggcgattgagaag	Protospacer
..**** ***************** **.

6. spacer 2.1|2805923|29|NZ_AP014856|PILER-CR matches to NZ_CP021661 (Candidatus Fukatsuia symbiotica strain 5D plasmid p5D_Fsymbiotica-2) position: , mismatch: 7, identity: 0.759

actgatcgcgtcttctggcgattgcgagt	CRISPR spacer
tgagagcgcatcttctggcgattgcgtat	Protospacer
   ** ***.**************** .*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

241780 : 319948

Shigella_phage(44.26%)

plate,head,capsid,terminase,tail,transposase,integrase,lysis,holin,portal,protease

attL 267063:267084|attR 320092:320113

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_124866374.1\|241780_242946_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	3.7e-73	46.7
WP_059275978.1\|243798_244395_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_095575501.1\|244975_245746_-	amidohydrolase	NA	NA	NA	NA
WP_002430282.1\|245924_246371_+	C-lysozyme inhibitor	NA	NA	NA	NA
WP_095575502.1\|246412_248857_-	acyl-CoA dehydrogenase FadE	NA	NA	NA	NA
WP_000284050.1\|249096_249675_+	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	1.1e-14	32.0
WP_025237577.1\|249879_250647_+	class II glutamine amidotransferase	NA	NA	NA	NA
WP_001225662.1\|250617_251358_-	murein L,D-transpeptidase	NA	NA	NA	NA
WP_095575503.1\|251670_252420_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	1.2e-19	37.7
WP_095573642.1\|252596_253094_+\|transposase	REP-associated tyrosine transposase RayT	NA	NA	NA	NA
WP_059222204.1\|253209_254949_-	flagellar type III secretion system protein FlhA	NA	NA	NA	NA
WP_072243690.1\|254893_255661_+	putative lateral flagellar export/assembly protein LafU	NA	NA	NA	NA
WP_059217800.1\|255790_256846_+	DNA polymerase IV	NA	NA	NA	NA
WP_000554758.1\|256897_257191_+	type I toxin-antitoxin system antitoxin YafN	NA	NA	NA	NA
WP_001263500.1\|257193_257592_+	type II toxin-antitoxin system mRNA interferase toxin YafO	NA	NA	NA	NA
WP_095575504.1\|257601_258054_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_072249376.1\|258066_258666_+	peptide chain release factor H	NA	NA	NA	NA
WP_059222190.1\|258806_259049_-	hypothetical protein	NA	NA	NA	NA
WP_001292996.1\|259107_260565_-	cytosol nonspecific dipeptidase	NA	NA	NA	NA
WP_001291989.1\|260825_261284_+	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_059222189.1\|261376_262621_+	esterase FrsA	NA	NA	NA	NA
WP_000174680.1\|262678_263080_+	sigma factor-binding protein Crl	NA	NA	NA	NA
WP_000749853.1\|263179_264235_-	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	4.2e-116	59.5
WP_025237534.1\|264522_265626_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.1e-61	40.1
WP_059222188.1\|265637_266891_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.2e-96	47.2
267063:267084	attL	NA	NA	NA	NA
WP_000051887.1\|267095_268259_-\|integrase	site-specific integrase	U5P434	Shigella_phage	2.4e-229	100.0
WP_000206811.1\|268485_268791_-	hypothetical protein	U5P0J0	Shigella_phage	4.9e-49	96.0
WP_095575505.1\|268790_269153_-	hypothetical protein	U5P092	Shigella_phage	4.4e-65	96.7
WP_042962713.1\|269143_269680_-	5'-deoxynucleotidase	U5P0T3	Shigella_phage	2.4e-99	98.3
WP_000081287.1\|269808_270633_-	DUF2303 family protein	U5P439	Shigella_phage	6.0e-150	100.0
WP_000135680.1\|270698_271061_-	hypothetical protein	Q8SBF8	Shigella_phage	8.6e-61	100.0
WP_000016389.1\|271529_271964_+	hypothetical protein	U5P096	Shigella_phage	8.4e-79	100.0
WP_000549626.1\|271935_272142_-	hypothetical protein	NA	NA	NA	NA
WP_000450735.1\|272389_273016_-	LexA family transcriptional regulator	K7PM82	Enterobacteria_phage	5.5e-47	48.8
WP_000205494.1\|273113_273314_+	cell division protein	NA	NA	NA	NA
WP_001434539.1\|273351_273903_+	hypothetical protein	S5FXP0	Shigella_phage	7.6e-101	98.9
WP_001250269.1\|274078_274258_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	7.8e-15	68.5
WP_000104953.1\|274247_275189_+	helix-turn-helix domain-containing protein	S5FM81	Shigella_phage	5.6e-144	99.7
WP_094304485.1\|275185_275680_+	PerC family transcriptional regulator	A0A0P0ZCF0	Stx2-converting_phage	3.6e-86	98.1
WP_095575506.1\|275679_276333_+	phage N-6-adenine-methyltransferase	A5LH72	Enterobacteria_phage	2.1e-126	98.6
WP_000210154.1\|276329_276656_+	LexA family transcriptional regulator	A0A0N7KZF7	Stx2-converting_phage	2.7e-53	99.1
WP_000767113.1\|276652_277042_+	RusA family crossover junction endodeoxyribonuclease	A0A0P0ZD39	Stx2-converting_phage	7.1e-69	100.0
WP_023145982.1\|277061_277871_+	KilA-N domain-containing protein	A0A291AWU7	Escherichia_phage	5.3e-151	99.6
WP_024244661.1\|277878_278868_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	4.4e-192	98.2
WP_001205457.1\|278886_279231_+	antitermination protein Q	A0A0P0ZCW0	Stx2-converting_phage	7.2e-57	89.4
WP_000069423.1\|279256_279871_-	hypothetical protein	A0A2D1GNI4	Pseudomonas_phage	9.9e-33	36.4
WP_143370799.1\|279874_280219_-	hypothetical protein	NA	NA	NA	NA
WP_001524096.1\|280234_280984_-	TIGR04255 family protein	NA	NA	NA	NA
WP_001120496.1\|281384_281711_+\|holin	phage holin, lambda family	U5P0K7	Shigella_phage	1.2e-56	99.1
WP_001197760.1\|281714_282191_+	glycoside hydrolase family protein	K7PKV2	Enterobacteria_phage	2.5e-84	95.6
WP_001228695.1\|282407_282590_+\|lysis	prophage lysis lipoprotein RzoD	K7PHU6	Enterobacteria_phage	2.9e-17	98.3
WP_000738423.1\|282680_282974_-	increased serum survival lipoprotein Iss	K7PL54	Enterobacteria_phage	2.0e-44	91.8
WP_095575507.1\|283499_283850_+	HNH endonuclease	M1FQV2	Enterobacteria_phage	3.4e-62	94.8
WP_000929175.1\|283975_284470_+\|terminase	phage terminase small subunit P27 family	U5P067	Shigella_phage	3.9e-88	99.4
WP_148723663.1\|284703_286200_+\|terminase	terminase large subunit	A0A1C9IIA1	Salmonella_phage	4.8e-299	99.6
WP_000605613.1\|286211_286394_+	hypothetical protein	M1FJ83	Enterobacteria_phage	1.1e-24	96.7
WP_095575508.1\|286393_287635_+\|portal	phage portal protein	U5P411	Shigella_phage	1.7e-241	99.3
WP_001193631.1\|287612_288263_+\|head,protease	HK97 family phage prohead protease	U5P4H2	Shigella_phage	2.5e-119	100.0
WP_021575899.1\|288277_289483_+\|capsid	phage major capsid protein	U5P0G9	Shigella_phage	3.1e-224	99.8
WP_000601360.1\|289532_289733_+	hypothetical protein	S5FNU1	Shigella_phage	3.8e-26	97.0
WP_023568528.1\|289735_290059_+\|head,tail	phage gp6-like head-tail connector protein	U5P072	Shigella_phage	2.6e-56	98.1
WP_023147732.1\|290055_290466_+\|head	phage head closure protein	M1FJ87	Enterobacteria_phage	2.1e-71	96.3
WP_000213503.1\|290440_290947_+	hypothetical protein	M1FPE2	Enterobacteria_phage	3.2e-90	99.4
WP_023568527.1\|290943_291504_+	hypothetical protein	Q8SBH4	Shigella_phage	3.0e-105	98.9
WP_000497751.1\|291512_291683_+	DUF2635 domain-containing protein	Q8SBH3	Shigella_phage	9.3e-26	100.0
WP_016244983.1\|291666_293163_+\|tail	phage tail sheath subtilisin-like domain-containing protein	M1FN90	Enterobacteria_phage	5.4e-274	99.4
WP_000090998.1\|293162_293519_+\|tail	phage tail tube protein	U5P076	Shigella_phage	5.3e-63	100.0
WP_000661054.1\|293518_293788_+\|tail	phage tail assembly protein	M1FPE4	Enterobacteria_phage	3.5e-43	100.0
WP_023568526.1\|293929_295765_+\|tail	phage tail tape measure protein	S5FM63	Shigella_phage	5.9e-307	99.5
WP_157730575.1\|295825_297154_+	DNA circularization N-terminal domain-containing protein	Q8SBG8	Shigella_phage	1.1e-243	97.7
WP_000999527.1\|297150_298230_+\|plate	baseplate protein	U5P0H6	Shigella_phage	6.9e-207	99.7
WP_042106194.1\|298229_298778_+\|plate	phage baseplate assembly protein	U5P081	Shigella_phage	8.7e-97	98.9
WP_042004576.1\|298777_299203_+	phage GP46 family protein	U5P0R9	Shigella_phage	3.9e-81	99.3
WP_016244979.1\|299189_300248_+\|plate	baseplate J/gp47 family protein	Q8SBG4	Shigella_phage	2.1e-200	99.1
WP_073357865.1\|300238_300823_+	YmfQ family protein	O22003	Shigella_phage	1.4e-113	99.5
WP_095575510.1\|300826_301567_+\|tail	tail fiber protein	M1TAS6	Escherichia_phage	1.2e-77	92.2
WP_072794540.1\|301566_302169_+\|tail	tail fiber assembly protein	M1SV83	Escherichia_phage	1.1e-97	89.5
WP_089618265.1\|302140_302584_-\|tail	tail fiber assembly protein	A0A0F7LDZ0	Escherichia_phage	7.3e-46	62.6
WP_089618264.1\|302585_302981_-	hypothetical protein	F1BUP1	Erwinia_phage	1.2e-12	37.5
WP_095575511.1\|303007_303562_+	site-specific DNA recombinase	A0A1S6L009	Salmonella_phage	5.7e-88	89.0
WP_000355479.1\|303619_304393_-	hypothetical protein	G9IA57	Pseudomonas_phage	3.2e-36	38.5
WP_001333214.1\|304897_305317_+	hypothetical protein	NA	NA	NA	NA
WP_095575512.1\|305632_307099_+	hypothetical protein	NA	NA	NA	NA
WP_000788777.1\|308144_308303_+	hypothetical protein	NA	NA	NA	NA
WP_095575513.1\|308731_309271_-	recombinase family protein	Q2A092	Sodalis_phage	1.4e-27	43.8
WP_172843344.1\|311405_311582_+	hypothetical protein	NA	NA	NA	NA
WP_000005469.1\|311604_311775_+	hypothetical protein	NA	NA	NA	NA
WP_095575515.1\|311828_312557_+	transcriptional regulator	NA	NA	NA	NA
WP_075826105.1\|312568_312847_+	hypothetical protein	NA	NA	NA	NA
WP_016159682.1\|312979_313390_+	hypothetical protein	NA	NA	NA	NA
WP_088213470.1\|313391_313730_+	hypothetical protein	NA	NA	NA	NA
WP_021560779.1\|314079_314292_+	hypothetical protein	NA	NA	NA	NA
WP_001570993.1\|314288_314651_+	hypothetical protein	NA	NA	NA	NA
WP_095575516.1\|314669_315698_+\|capsid	major capsid protein	NA	NA	NA	NA
WP_000452041.1\|315784_315988_+	hypothetical protein	NA	NA	NA	NA
WP_088213467.1\|316002_317841_+	hypothetical protein	I7HJD8	Enterobacteria_phage	2.5e-31	29.8
WP_095575517.1\|317875_318589_+	hypothetical protein	I7I023	Enterobacteria_phage	2.5e-48	49.3
WP_172843345.1\|318670_319948_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
320092:320113	attR	NA	NA	NA	NA

DBSCAN-SWA_2

865973 : 899642

Salmonella_phage(84.44%)

plate,head,capsid,terminase,tail,integrase,lysis,portal

attL 864567:864591|attR 899709:899733

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
864567:864591	attL	NA	NA	NA	NA
WP_095575598.1\|865973_867023_-\|integrase	tyrosine-type recombinase/integrase	A0A218M4I3	Erwinia_phage	7.7e-102	55.8
WP_000900884.1\|867209_867401_-	hypothetical protein	A0A0R6PIH8	Moraxella_phage	2.4e-09	70.5
WP_033813112.1\|867416_867986_-	phage repressor protein CI	A0A1S6KZZ7	Salmonella_phage	2.5e-38	43.4
WP_001247707.1\|868111_868333_+	hypothetical protein	NA	NA	NA	NA
WP_000460891.1\|868365_868875_+	phage regulatory CII family protein	E5G6L3	Salmonella_phage	1.3e-86	98.2
WP_001504054.1\|868882_869083_+	DUF2724 domain-containing protein	E5G6L4	Salmonella_phage	4.6e-32	95.5
WP_095575599.1\|869046_869388_+	DUF5347 domain-containing protein	E5G6L5	Salmonella_phage	1.0e-55	98.2
WP_001244209.1\|869455_869689_+	DUF2732 family protein	E5G6L6	Salmonella_phage	2.4e-32	97.4
WP_095575600.1\|869688_869916_+	TraR/DksA family transcriptional regulator	E5G6L7	Salmonella_phage	1.0e-35	98.7
WP_095575601.1\|869912_870770_+	DNA adenine methylase	E5G6L8	Salmonella_phage	3.9e-160	96.8
WP_001154431.1\|873333_873522_+	hypothetical protein	E5G6M0	Salmonella_phage	1.6e-26	96.8
WP_001217575.1\|873532_873766_+	DinI family protein	E5G6M1	Salmonella_phage	4.7e-36	100.0
WP_001059831.1\|873958_874294_-	hypothetical protein	NA	NA	NA	NA
WP_095575602.1\|874803_875799_+	hypothetical protein	A0A1S6KZY1	Salmonella_phage	7.1e-182	91.2
WP_095575603.1\|875855_876410_-	HNH endonuclease	A0A1S6KZY3	Salmonella_phage	2.2e-87	87.0
WP_149479001.1\|876529_876826_-	hypothetical protein	A0A1S6KZY3	Salmonella_phage	9.6e-34	86.0
WP_095575605.1\|876883_877912_-\|portal	phage portal protein	A0A1S6KZW5	Salmonella_phage	6.4e-178	92.6
WP_095575606.1\|877911_879678_-\|terminase	terminase ATPase subunit family protein	A0A1S6KZW3	Salmonella_phage	0.0e+00	99.1
WP_095575607.1\|879820_880654_+\|capsid	GPO family capsid scaffolding protein	A0A1S6KZW9	Salmonella_phage	3.7e-123	90.6
WP_095575608.1\|880670_881729_+\|capsid	phage major capsid protein, P2 family	E5G6M6	Salmonella_phage	8.4e-181	93.1
WP_000059191.1\|881732_882383_+\|terminase	terminase endonuclease subunit	E5G6M7	Salmonella_phage	8.7e-112	96.3
WP_000673530.1\|882478_882943_+\|head	head completion/stabilization protein	A0A1S6KZW8	Salmonella_phage	1.9e-76	89.0
WP_000868169.1\|882942_883146_+\|tail	tail protein X	E5G6M9	Salmonella_phage	3.0e-31	91.0
WP_000171568.1\|883149_883365_+	hypothetical protein	E5G6N0	Salmonella_phage	1.8e-26	80.3
WP_172843346.1\|883345_883858_+	lysozyme	E5G6N1	Salmonella_phage	2.0e-87	91.1
WP_000730946.1\|883859_884237_+	hypothetical protein	A0A1S6KZZ2	Salmonella_phage	1.4e-16	40.8
WP_095575609.1\|884233_884662_+\|lysis	LysB family phage lysis regulatory protein	E5G6N2	Salmonella_phage	7.1e-46	74.5
WP_001039945.1\|884757_885189_+\|tail	phage tail protein	E5G6N3	Salmonella_phage	4.4e-72	94.4
WP_095575610.1\|885181_885631_+	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	1.8e-68	91.9
WP_095575611.1\|885645_886581_-	FRG domain-containing protein	A0A1S6KZX9	Salmonella_phage	5.3e-171	92.3
WP_095575612.1\|886666_887245_+\|plate	phage baseplate assembly protein V	A0A1S6KZX7	Salmonella_phage	1.0e-92	84.9
WP_000177574.1\|887241_887601_+	GPW/gp25 family protein	A0A1S6KZZ4	Salmonella_phage	4.2e-52	87.4
WP_095575613.1\|887587_888496_+\|plate	baseplate assembly protein	A0A1S6KZY6	Salmonella_phage	3.5e-143	90.7
WP_001086833.1\|888488_889094_+\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	4.4e-110	92.0
WP_095575614.1\|889090_890512_+\|tail	phage tail protein	A0A0F7LBW5	Escherichia_phage	1.9e-167	65.3
WP_001682747.1\|890532_890976_+\|tail	tail fiber assembly protein	A0A0F7LDZ0	Escherichia_phage	1.3e-79	97.3
WP_000639074.1\|890947_891343_-\|tail	tail fiber assembly protein	A0A0M4S6V4	Salmonella_phage	3.5e-15	43.5
WP_032144129.1\|891351_891756_-	hypothetical protein	M1FN94	Enterobacteria_phage	5.5e-16	43.1
WP_016237350.1\|891786_892353_+	recombinase family protein	A0A0F7LA37	Escherichia_phage	8.4e-87	86.3
WP_001682750.1\|892495_893668_+\|tail	phage tail sheath protein	A0A1S6KZY7	Salmonella_phage	5.1e-203	89.7
WP_001207660.1\|893677_894193_+\|tail	phage major tail tube protein	A0A1S6L002	Salmonella_phage	2.1e-89	95.3
WP_001682751.1\|894247_894550_+\|tail	phage tail assembly protein	A0A1S6KZZ9	Salmonella_phage	1.2e-39	88.0
WP_024194071.1\|894564_894684_+\|tail	GpE family phage tail protein	E5G6Q0	Salmonella_phage	1.8e-12	87.2
WP_095575615.1\|894676_897754_+\|tail	phage tail tape measure protein	E5G6Q1	Salmonella_phage	0.0e+00	61.3
WP_000980413.1\|897750_898236_+\|tail	phage tail protein	E5G6Q2	Salmonella_phage	6.3e-67	80.6
WP_095575616.1\|898232_899333_+	phage late control D family protein	E5G6Q3	Salmonella_phage	7.6e-177	85.2
WP_000972391.1\|899423_899642_+	ogr/Delta-like zinc finger family protein	Q53ZE7	Salmonella_virus	7.5e-20	69.0
899709:899733	attR	NA	NA	NA	NA

DBSCAN-SWA_3

934595 : 994005

Escherichia_phage(57.69%)

plate,protease,head,capsid,terminase,tail,integrase,lysis,holin,portal,tRNA

attL 943415:943431|attR 985599:985615

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000520793.1\|934595_934916_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	5.3e-14	45.6
WP_025237287.1\|934946_937223_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	3.3e-166	42.8
WP_001040187.1\|938132_938351_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_059219856.1\|938635_939340_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_095575619.1\|939384_941106_-	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	W8CYL7	Bacillus_phage	2.9e-21	25.2
WP_059268048.1\|941106_942873_-	cysteine/glutathione ABC transporter permease/ATP-binding protein CydD	W8CYL7	Bacillus_phage	4.1e-23	24.3
WP_000537396.1\|942993_943959_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	7.2e-62	44.3
943415:943431	attL	NA	NA	NA	NA
WP_000228473.1\|944503_944998_+	leucine-responsive transcriptional regulator Lrp	NA	NA	NA	NA
WP_095575620.1\|945132_949011_+	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	1.5e-86	48.4
WP_002462419.1\|949169_949781_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_059219851.1\|949791_951135_+	replication-associated recombination protein RarA	G3MBE0	Bacillus_virus	1.1e-79	40.3
WP_000886690.1\|951225_952518_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.9e-95	48.5
WP_059267994.1\|952756_955201_+	dimethylsulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	3.5e-222	50.1
WP_000213098.1\|955211_955829_+	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	5.0e-77	60.6
WP_000534713.1\|955830_956694_+	dimethyl sulfoxide reductase anchor subunit DmsC	NA	NA	NA	NA
WP_000165868.1\|956729_957356_-	hydrolase	NA	NA	NA	NA
WP_025237281.1\|957672_958821_+	MFS transporter	NA	NA	NA	NA
WP_059219845.1\|959030_960464_+	amino acid permease	NA	NA	NA	NA
WP_095575621.1\|960671_961469_-	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	2.3e-21	26.6
WP_000023390.1\|961500_962496_-\|integrase	tyrosine-type recombinase/integrase	A0A0F7LBR0	Escherichia_phage	5.4e-190	100.0
WP_001389238.1\|962589_962889_-	helix-turn-helix transcriptional regulator	Q1JS29	Enterobacteria_phage	3.0e-51	100.0
WP_001389237.1\|962997_963354_+	hypothetical protein	Q1JS28	Enterobacteria_phage	1.5e-62	99.2
WP_000217682.1\|963531_964032_+	hypothetical protein	A0A0F7LBQ6	Escherichia_phage	1.7e-91	99.4
WP_000557703.1\|964095_964320_+	DUF2732 family protein	S4TP68	Salmonella_phage	4.7e-33	100.0
WP_001277949.1\|964319_964622_+	DUF5405 family protein	Q7Y4C1	Escherichia_virus	4.2e-45	95.0
WP_001113270.1\|964621_964846_+	TraR/DksA family transcriptional regulator	A0A0F7LDI3	Escherichia_phage	3.8e-35	98.6
WP_000027662.1\|964842_965118_+	DUF5405 family protein	M1TAP2	Escherichia_phage	3.8e-45	100.0
WP_095575622.1\|965107_967384_+	replication endonuclease	A0A0F7LBQ2	Escherichia_phage	0.0e+00	98.3
WP_095575623.1\|967493_968825_+	HNH endonuclease	NA	NA	NA	NA
WP_086186067.1\|968916_969336_+	hypothetical protein	Q6K1E9	Salmonella_virus	5.0e-52	71.2
WP_000038194.1\|969652_970687_-\|portal	phage portal protein	Q858W8	Yersinia_virus	1.2e-200	99.1
WP_000156847.1\|970686_972459_-\|terminase	terminase ATPase subunit family protein	A0A0F7LCM8	Escherichia_phage	0.0e+00	100.0
WP_001085948.1\|972632_973487_+\|capsid	GPO family capsid scaffolding protein	Q94MB7	Escherichia_virus	1.7e-139	89.4
WP_095575624.1\|973545_974619_+\|capsid	phage major capsid protein, P2 family	U5N3E4	Enterobacteria_phage	1.9e-201	99.7
WP_001593490.1\|974622_975366_+\|terminase	terminase endonuclease subunit	A0A0F7LBP7	Escherichia_phage	3.5e-125	99.2
WP_000988633.1\|975465_975975_+\|head	head completion/stabilization protein	U5N0S3	Enterobacteria_phage	1.1e-90	100.0
WP_000846409.1\|975974_976178_+\|tail	tail protein X	A0A0F7LCN2	Escherichia_phage	3.0e-31	100.0
WP_000123123.1\|976181_976463_+\|holin	phage holin family protein	A0A0F7LA12	Escherichia_phage	1.3e-43	100.0
WP_001144101.1\|976462_976960_+	glycoside hydrolase family 104 protein	A0A0F7LBS0	Escherichia_phage	3.1e-93	100.0
WP_039022207.1\|976974_977400_+	hypothetical protein	A0A0F7LBP4	Escherichia_phage	9.5e-59	95.0
WP_001564788.1\|977387_977813_+\|lysis	LysB family phage lysis regulatory protein	U5N3W5	Enterobacteria_phage	4.7e-66	97.2
WP_000917188.1\|977920_978388_+\|tail	phage tail protein	Q7Y4E0	Escherichia_virus	1.1e-81	99.4
WP_001001786.1\|978380_978833_+	phage virion morphogenesis protein	A0A0F7LDR6	Escherichia_phage	8.2e-77	100.0
WP_064506788.1\|978899_979535_+\|plate	phage baseplate assembly protein V	U5N3F0	Enterobacteria_phage	2.2e-112	98.1
WP_001695636.1\|979531_979879_+	GPW/gp25 family protein	A0A0F7LDQ1	Escherichia_phage	2.9e-58	99.1
WP_021525816.1\|979883_980792_+\|plate	baseplate assembly protein	A0A0F7LCQ9	Escherichia_phage	5.7e-162	99.7
WP_001285341.1\|980784_981396_+\|tail	phage tail protein I	A0A0F7LA36	Escherichia_phage	2.9e-117	99.5
WP_095575625.1\|981392_982712_+\|tail	phage tail protein	M1TAS6	Escherichia_phage	2.7e-181	69.2
WP_095575626.1\|982711_983314_+\|tail	tail fiber assembly protein	A0A0F7LDQ5	Escherichia_phage	7.3e-97	91.0
WP_074468294.1\|983285_983729_-\|tail	tail fiber assembly protein	A0A0F7LDZ0	Escherichia_phage	3.2e-57	71.4
WP_062895573.1\|983730_984117_-	hypothetical protein	A0A0F7LBW5	Escherichia_phage	2.1e-09	70.0
WP_000905093.1\|984147_984741_+	recombinase family protein	A0A0F7LA37	Escherichia_phage	1.2e-104	98.0
WP_063270303.1\|984800_985991_+\|tail	phage tail sheath protein	A0A0F7LBW9	Escherichia_phage	1.4e-224	99.5
985599:985615	attR	NA	NA	NA	NA
WP_001251408.1\|986003_986522_+\|tail	phage major tail tube protein	A0A0F7LDZ1	Escherichia_phage	1.4e-93	100.0
WP_095575627.1\|986578_986854_+\|tail	phage tail assembly protein	A0A0F7LDQ8	Escherichia_phage	1.3e-40	98.9
WP_000785970.1\|986886_987006_+\|tail	GpE family phage tail protein	A0A0F7LCR6	Escherichia_phage	1.0e-15	100.0
WP_095575628.1\|986998_989446_+\|tail	phage tail tape measure protein	M1T2S3	Escherichia_phage	0.0e+00	99.1
WP_000978885.1\|989460_989940_+\|tail	phage tail protein	O64315	Escherichia_phage	1.5e-84	99.4
WP_095575629.1\|989939_991103_+	phage late control D family protein	A0A0F7LDZ2	Escherichia_phage	7.7e-204	98.7
WP_000468308.1\|991184_991403_+	prophage transcriptional regulator OgrK	A0A0F7LDQ9	Escherichia_phage	4.7e-38	100.0
WP_001292823.1\|991722_994005_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	1.0e-162	41.5

DBSCAN-SWA_4

1026558 : 1106442

Escherichia_phage(38.64%)

tRNA,head,capsid,terminase,tail,transposase,integrase,holin,portal,protease

attL 1059554:1059613|attR 1101690:1101754

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000117893.1\|1026558_1027959_-\|tRNA	asparagine--tRNA ligase	A0A2K9V902	Bandra_megavirus	3.1e-82	36.3
WP_095573812.1\|1028127_1029330_-	nicotinate phosphoribosyltransferase	NA	NA	NA	NA
WP_059227727.1\|1029595_1032208_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	3.5e-18	22.7
WP_002462366.1\|1032620_1033631_+	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_001220656.1\|1033804_1034347_+	cell division protein ZapC	NA	NA	NA	NA
WP_095575634.1\|1034343_1035453_-	MOSC domain-containing protein	NA	NA	NA	NA
WP_059219822.1\|1035696_1037805_+	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
WP_059239030.1\|1037816_1039724_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	9.2e-53	29.4
WP_000333197.1\|1039924_1041178_+	membrane integrity-associated transporter subunit PqiA	NA	NA	NA	NA
WP_025237261.1\|1041182_1042823_+	intermembrane transport protein PqiB	NA	NA	NA	NA
WP_000759093.1\|1042819_1043383_+	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
WP_000828648.1\|1043639_1043807_+	ribosome modulation factor	NA	NA	NA	NA
WP_002462364.1\|1043875_1044394_-	bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase	NA	NA	NA	NA
WP_095575635.1\|1044462_1046223_-\|protease	Lon protease family protein	NA	NA	NA	NA
WP_059219816.1\|1046408_1046861_+	macrodomain Ter protein MatP	NA	NA	NA	NA
WP_024164823.1\|1046935_1047988_-	porin OmpA	NA	NA	NA	NA
WP_000288703.1\|1048343_1048853_-	cell division inhibitor SulA	NA	NA	NA	NA
WP_059219814.1\|1049070_1049700_+	TfoX/Sxy family DNA transformation protein	NA	NA	NA	NA
WP_072248637.1\|1049659_1051825_-	TIGR01666 family membrane protein	NA	NA	NA	NA
WP_001261228.1\|1051834_1052281_-	YccF domain-containing protein	NA	NA	NA	NA
WP_095575636.1\|1052403_1054458_+	DNA helicase IV	A7KV33	Bacillus_phage	1.3e-20	27.6
WP_000424182.1\|1054489_1054948_-	methylglyoxal synthase	NA	NA	NA	NA
WP_000847777.1\|1055043_1055706_-	DUF2057 family protein	NA	NA	NA	NA
WP_002462360.1\|1055878_1056292_+	CoA-binding protein	NA	NA	NA	NA
WP_001295356.1\|1056336_1056654_-	heat shock protein HspQ	NA	NA	NA	NA
WP_000116313.1\|1056711_1057902_-	23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI	NA	NA	NA	NA
WP_000048219.1\|1057995_1058274_+	acylphosphatase	NA	NA	NA	NA
WP_024164819.1\|1058270_1058600_-	sulfurtransferase TusE	NA	NA	NA	NA
WP_000375136.1\|1058691_1059351_-\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	4.0e-48	55.3
1059554:1059613	attL	NA	NA	NA	NA
WP_001372523.1\|1059759_1060779_-\|integrase	tyrosine-type recombinase/integrase	A0A192Y7M7	Salmonella_phage	9.8e-86	49.7
WP_059278349.1\|1060747_1060999_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_095575637.1\|1061065_1063546_-	exonuclease	A0A192Y6E0	Salmonella_phage	2.2e-62	64.1
WP_001090221.1\|1063638_1063830_-	DUF1482 family protein	NA	NA	NA	NA
WP_000449200.1\|1063826_1064015_-	hypothetical protein	NA	NA	NA	NA
WP_123057874.1\|1064412_1064559_+	hypothetical protein	NA	NA	NA	NA
WP_024227554.1\|1064544_1064919_-	hypothetical protein	NA	NA	NA	NA
WP_059278976.1\|1064930_1065083_-	DUF1391 family protein	NA	NA	NA	NA
WP_000381213.1\|1065251_1065659_-	helix-turn-helix domain-containing protein	I6PD69	Cronobacter_phage	1.2e-31	51.9
WP_000921592.1\|1065739_1065967_+	transcriptional regulator	NA	NA	NA	NA
WP_095575638.1\|1065950_1066472_+	hypothetical protein	NA	NA	NA	NA
WP_123057873.1\|1066452_1067418_+	hypothetical protein	U5P0A0	Shigella_phage	1.5e-59	64.8
WP_059278970.1\|1067458_1067881_+	DUF977 family protein	A0A0U2QQN3	Escherichia_phage	5.0e-60	88.3
WP_059268374.1\|1068018_1068291_-	hypothetical protein	NA	NA	NA	NA
WP_095575640.1\|1069339_1070413_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0M3LR35	Mannheimia_phage	3.0e-08	23.8
WP_000813259.1\|1070484_1070640_+	type I toxin-antitoxin system Hok family toxin	A0A1I9LJU7	Stx_converting_phage	5.5e-17	96.1
WP_059259921.1\|1070915_1071176_+	hypothetical protein	NA	NA	NA	NA
WP_095575641.1\|1071242_1071521_+	hypothetical protein	I6PCV7	Cronobacter_phage	2.2e-11	48.4
WP_095575642.1\|1071522_1072578_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	2.6e-89	48.7
WP_095575643.1\|1072578_1072944_+	RusA family crossover junction endodeoxyribonuclease	V5URS4	Shigella_phage	9.3e-39	66.7
WP_095575644.1\|1072940_1073630_+	antiterminator	I6PDF8	Cronobacter_phage	2.5e-56	47.6
WP_095576268.1\|1073762_1074623_+	hypothetical protein	NA	NA	NA	NA
WP_095575645.1\|1074789_1075176_+\|holin	phage holin family protein	A0A192Y8P2	Salmonella_phage	1.2e-55	91.4
WP_073978423.1\|1075162_1075444_+\|holin	phage holin family protein	A0A0U2SHD1	Escherichia_phage	4.1e-18	47.8
WP_095575646.1\|1075443_1076058_+	glycoside hydrolase family 19 protein	Q8HA86	Salmonella_phage	8.0e-91	78.9
WP_023155120.1\|1076065_1076335_+	hypothetical protein	G8C7W1	Escherichia_phage	1.6e-19	65.5
WP_023155123.1\|1076745_1077285_-	YfbU family protein	NA	NA	NA	NA
WP_095575647.1\|1077423_1077774_+	HNH endonuclease	A0A1B5FP94	Escherichia_phage	3.6e-64	96.6
WP_095575648.1\|1077922_1078405_+\|terminase	phage terminase small subunit P27 family	A0A1B5FPA0	Escherichia_phage	2.5e-84	97.5
WP_095575649.1\|1078404_1080162_+\|terminase	terminase large subunit	A0A1B5FP96	Escherichia_phage	0.0e+00	99.1
WP_000478567.1\|1080173_1080356_+	hypothetical protein	A0A1B5FP99	Escherichia_phage	1.1e-24	96.7
WP_000466255.1\|1080355_1081597_+\|portal	phage portal protein	U5P411	Shigella_phage	2.0e-242	99.8
WP_001193631.1\|1081574_1082225_+\|head,protease	HK97 family phage prohead protease	U5P4H2	Shigella_phage	2.5e-119	100.0
WP_095575650.1\|1082239_1083445_+\|capsid	phage major capsid protein	M1FPN2	Enterobacteria_phage	1.7e-222	99.0
WP_000601355.1\|1083494_1083683_+	hypothetical protein	A0A1B5FP98	Escherichia_phage	7.2e-27	100.0
WP_095575651.1\|1083694_1084000_+\|head,tail	phage gp6-like head-tail connector protein	A0A1B5FP86	Escherichia_phage	7.8e-39	80.2
WP_095575652.1\|1084008_1084347_+\|head	phage head closure protein	A0A1B5FP90	Escherichia_phage	2.5e-54	96.4
WP_095575653.1\|1084343_1084793_+	HK97 gp10 family phage protein	S4TR46	Salmonella_phage	4.3e-62	79.9
WP_047627858.1\|1084789_1085134_+	DUF3168 domain-containing protein	A0A1B5FP84	Escherichia_phage	1.6e-56	99.1
WP_095575654.1\|1085194_1085899_+	immunoglobulin domain-containing protein	A0A1B5FP82	Escherichia_phage	3.0e-118	96.2
WP_095575655.1\|1085913_1086285_+\|tail	phage tail protein	A0A1B5FP91	Escherichia_phage	1.0e-61	96.7
WP_171002985.1\|1086308_1086587_+	DUF4035 domain-containing protein	A0A1B5FP87	Escherichia_phage	2.8e-43	98.9
WP_095575656.1\|1086633_1089861_+\|tail	phage tail tape measure protein	A0A1B5FPE2	Escherichia_phage	0.0e+00	94.3
WP_001114907.1\|1089853_1090195_+\|tail	phage tail protein	A0A0P0ZDL9	Stx2-converting_phage	1.2e-40	66.4
WP_095575657.1\|1090194_1090893_+\|tail	phage minor tail protein L	A0A1B5FP81	Escherichia_phage	7.6e-130	96.6
WP_095575658.1\|1090897_1091641_+\|tail	phage tail protein	K7PLW1	Enterobacteria_phage	8.6e-148	96.8
WP_095575659.1\|1091538_1092186_+\|tail	tail assembly protein	A5LH42	Enterobacteria_phage	1.4e-106	92.6
WP_095575660.1\|1092246_1095660_+	host specificity protein J	K7PKJ2	Enterobacteria_phage	0.0e+00	95.7
WP_095575661.1\|1095721_1097035_+\|tail	prophage tail fiber N-terminal domain-containing protein	A0A0P0ZE15	Stx2-converting_phage	3.4e-75	95.7
WP_095575662.1\|1097036_1097306_+\|tail	phage tail fiber C-terminal domain-containing protein	Q9EYE9	Enterobacteria_phage	1.6e-43	97.8
WP_095576270.1\|1097417_1098044_+	T3SS effector NleG family protein	B6DZC0	Enterobacteria_phage	1.7e-40	43.7
WP_095575663.1\|1098270_1099755_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_095575664.1\|1099941_1100892_-\|protease	omptin family outer membrane protease	NA	NA	NA	NA
WP_059219811.1\|1102223_1103342_+	hydrogenase 1 small subunit	NA	NA	NA	NA
1101690:1101754	attR	NA	NA	NA	NA
WP_059219810.1\|1103338_1105132_+	Ni/Fe-hydrogenase large subunit	NA	NA	NA	NA
WP_095573817.1\|1105150_1105858_+	Ni/Fe-hydrogenase b-type cytochrome subunit	NA	NA	NA	NA
WP_095575665.1\|1105854_1106442_+\|protease	hydrogenase 1 maturation protease	NA	NA	NA	NA

DBSCAN-SWA_5

1442820 : 1451351

Enterobacteria_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059268187.1\|1442820_1444194_+	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.1e-50	32.0
WP_059228647.1\|1444296_1445232_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	2.4e-147	99.2
WP_072248922.1\|1445728_1446364_+	T3SS effector NleG family protein	B6DZC0	Enterobacteria_phage	5.2e-45	47.4
WP_072243648.1\|1446833_1447469_+	T3SS effector NleG family protein	B6DZB9	Enterobacteria_phage	9.2e-34	53.0
WP_059221914.1\|1447927_1448368_+	hypothetical protein	NA	NA	NA	NA
WP_010340761.1\|1449408_1449654_+	hypothetical protein	NA	NA	NA	NA
WP_059268429.1\|1449657_1450092_-	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	1.2e-29	52.1
WP_095575712.1\|1450232_1451351_-	porin OmpC	Q1MVN1	Enterobacteria_phage	2.3e-112	56.4

DBSCAN-SWA_6

2039824 : 2081106

Enterobacteria_phage(45.9%)

head,capsid,terminase,tail,integrase,lysis,holin,portal

attL 2070029:2070043|attR 2085595:2085609

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172843351.1\|2039824_2040337_-\|tail	tail fiber domain-containing protein	A0A1X7QGH6	Escherichia_phage	6.9e-48	58.5
WP_095575816.1\|2043257_2043857_-	Ail/Lom family outer membrane beta-barrel protein	A5LH44	Enterobacteria_phage	1.9e-105	95.5
WP_095575817.1\|2043927_2047341_-	host specificity protein J	K7PKJ2	Enterobacteria_phage	0.0e+00	95.5
WP_071791559.1\|2047401_2048034_-\|tail	tail assembly protein	A0A2R9YJH6	Escherichia_phage	3.2e-95	98.1
WP_095575818.1\|2047970_2048714_-\|tail	phage tail protein	K7PLW1	Enterobacteria_phage	2.3e-148	96.8
WP_095575819.1\|2048719_2049418_-\|tail	phage minor tail protein L	A0A0K2FJ01	Enterobacteria_phage	5.4e-128	95.7
WP_095575820.1\|2049417_2049747_-\|tail	phage tail protein	A0A2R9YJM0	Escherichia_phage	3.1e-57	94.5
WP_095575821.1\|2049743_2052305_-\|tail	phage tail tape measure protein	A0A2R9YJM8	Escherichia_phage	0.0e+00	88.8
WP_059222279.1\|2052297_2052723_-\|tail	phage tail assembly protein T	A0A0K2FJB3	Enterobacteria_phage	4.8e-63	99.2
WP_032329098.1\|2052704_2053127_-\|tail	phage minor tail protein G	A0A0K2FIQ8	Enterobacteria_phage	1.4e-70	96.4
WP_059236901.1\|2053142_2053883_-\|tail	phage tail protein	A0A2I6TC77	Escherichia_phage	6.1e-130	97.6
WP_059217891.1\|2053890_2054286_-\|tail	phage tail protein	A0A0K2FIF4	Enterobacteria_phage	2.5e-69	96.9
WP_095575822.1\|2054282_2054861_-\|tail	phage tail protein	A0A2R9YJK4	Escherichia_phage	5.2e-76	96.9
WP_085456367.1\|2054872_2055226_-\|head,tail	head-tail joining protein	A0A2R9YJJ5	Escherichia_phage	1.1e-60	95.7
WP_085456368.1\|2055237_2055633_-	DNA-packaging protein FI	A0A2R9YJP4	Escherichia_phage	1.8e-56	93.9
WP_059219384.1\|2055674_2056700_-\|capsid	major capsid protein	C6ZCY2	Enterobacteria_phage	9.9e-187	96.8
WP_032285278.1\|2056755_2057088_-\|head	head decoration protein	A0A2R9YJN3	Escherichia_phage	2.9e-55	99.1
WP_059217886.1\|2057097_2058417_-	S49 family peptidase	A0A2I6TC87	Escherichia_phage	1.5e-224	95.0
WP_085456369.1\|2058397_2059999_-\|portal	phage portal protein	A0A0K2FJC0	Enterobacteria_phage	2.5e-309	99.1
WP_095575823.1\|2059995_2060202_-	gpW family protein	A0A2R9YJL2	Escherichia_phage	1.4e-28	95.6
WP_095575824.1\|2060198_2062124_-\|terminase	phage terminase large subunit family protein	A0A0K2FJ14	Enterobacteria_phage	0.0e+00	99.1
WP_000453611.1\|2062098_2062644_-	DNA-packaging protein	A0A0K2FIG2	Enterobacteria_phage	2.3e-94	98.3
WP_095575825.1\|2063137_2063755_-	Rha family transcriptional regulator	A0A1R3Y613	Salmonella_virus	3.5e-102	92.4
WP_095575826.1\|2063888_2064326_-\|lysis	lysis protein	K7PJY1	Enterobacterial_phage	3.6e-69	93.8
WP_001135262.1\|2064322_2064820_-	lysozyme RrrD	A0A1B5FP97	Escherichia_phage	1.1e-90	98.2
WP_000839574.1\|2064819_2065035_-\|holin	class II holin family protein	M1FN85	Enterobacteria_phage	2.4e-34	100.0
WP_000027554.1\|2065372_2065891_-	DUF1133 family protein	Q716B8	Shigella_phage	5.9e-95	99.4
WP_000994514.1\|2065887_2066076_-	protein ninH	A5VW84	Enterobacteria_phage	7.2e-27	98.4
WP_001008200.1\|2066072_2066435_-	RusA family crossover junction endodeoxyribonuclease	K7P6I9	Enterobacteria_phage	9.2e-63	100.0
WP_000002229.1\|2066431_2066722_-	DUF1364 domain-containing protein	A0A192Y6R9	Salmonella_phage	1.0e-51	99.0
WP_001283996.1\|2066722_2066941_-	hypothetical protein	S4TUE0	Salmonella_phage	4.3e-23	68.1
WP_021520333.1\|2066933_2067104_-	protein ninF	A0A2I6PIG4	Escherichia_phage	2.7e-25	98.2
WP_059222272.1\|2067100_2067283_-	NinE family protein	Q8H9Z6	Enterobacteria_phage	1.8e-27	96.7
WP_000153270.1\|2067279_2067807_-	phage N-6-adenine-methyltransferase	K7PJZ4	Enterobacterial_phage	9.5e-101	100.0
WP_024182569.1\|2067803_2068250_-	recombination protein NinB	A0A1I9LJP8	Stx_converting_phage	4.4e-75	92.6
WP_000344556.1\|2068206_2068584_-	hypothetical protein	K7PHN9	Enterobacterial_phage	9.0e-37	66.4
WP_000818848.1\|2068601_2068808_-	hypothetical protein	A0A2I6PIF1	Escherichia_phage	2.3e-26	94.1
WP_095575827.1\|2068880_2070257_-	AAA family ATPase	A0A0P0ZC27	Stx2-converting_phage	6.9e-252	99.3
2070029:2070043	attL	NA	NA	NA	NA
WP_095575828.1\|2070253_2071075_-	replication protein	K7PJZ3	Enterobacterial_phage	1.3e-152	98.9
WP_000166961.1\|2071061_2071223_-	hypothetical protein	Q76H53	Enterobacteria_phage	1.3e-21	100.0
WP_000251073.1\|2071255_2071549_-	hypothetical protein	K7P6Y2	Enterobacteria_phage	2.8e-46	100.0
WP_001194218.1\|2071668_2071884_-	helix-turn-helix transcriptional regulator	Q716D6	Shigella_phage	1.4e-31	100.0
WP_000028392.1\|2071992_2072625_+	LexA family transcriptional regulator	K7P850	Enterobacteria_phage	1.6e-118	99.5
WP_044809909.1\|2072621_2073026_+	hypothetical protein	Q716D7	Shigella_phage	3.3e-69	98.5
WP_095575829.1\|2073252_2073579_+	antitermination protein	K7PHQ7	Enterobacteria_phage	1.0e-52	99.1
WP_095575830.1\|2073587_2073776_+	hypothetical protein	K7PMF8	Enterobacteria_phage	7.2e-19	97.7
WP_095575831.1\|2073971_2074340_+	DUF2528 family protein	K7PGR6	Enterobacteria_phage	1.3e-64	97.5
WP_000972063.1\|2074415_2074550_+	hypothetical protein	K7PHK2	Enterobacteria_phage	3.1e-16	100.0
WP_001243355.1\|2074534_2074687_+	host cell division inhibitory peptide Kil	A5VWA5	Enterobacteria_phage	4.7e-21	100.0
WP_095575832.1\|2074941_2075649_+	recombinase	Q716E7	Shigella_phage	1.7e-137	99.6
WP_095575833.1\|2075649_2076111_+	single-stranded DNA-binding protein	K7PHK1	Enterobacteria_phage	1.3e-69	98.0
WP_136669547.1\|2076126_2076594_+	hypothetical protein	Q716E9	Shigella_phage	7.7e-38	47.9
WP_001111278.1\|2076607_2076901_+	DUF2856 family protein	G8C7L1	Escherichia_phage	2.5e-50	99.0
WP_032279487.1\|2076911_2077076_+	DUF2737 family protein	A0A2I6PID4	Escherichia_phage	4.2e-23	98.1
WP_095575834.1\|2077072_2077483_+	hypothetical protein	G8C7K9	Escherichia_phage	9.2e-43	61.2
WP_095575835.1\|2077479_2077779_+	hypothetical protein	A5VWB2	Enterobacteria_phage	1.4e-56	97.0
WP_172843349.1\|2077780_2078524_+	ead/Ea22-like family protein	K7PK20	Enterobacteria_phage	6.0e-85	79.4
WP_157730585.1\|2078516_2078798_+	ASCH domain-containing protein	A5VWB6	Enterobacteria_phage	1.1e-47	94.6
WP_095575837.1\|2078864_2079155_+	hypothetical protein	NA	NA	NA	NA
WP_095575838.1\|2079385_2079730_+	hypothetical protein	K7PJY7	Enterobacterial_phage	4.5e-59	98.2
WP_059225545.1\|2079836_2080055_+	excisionase	Q77WA4	Escherichia_phage	2.4e-34	98.6
WP_059258406.1\|2080032_2081106_+\|integrase	tyrosine-type recombinase/integrase	K7PHK0	Enterobacteria_phage	5.7e-193	95.5
2085595:2085609	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2090299 : 2098486

Escherichia_phage(42.86%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059275232.1\|2090299_2091703_+	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	4.1e-34	29.4
WP_000137865.1\|2091699_2092422_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	8.3e-31	32.7
WP_025238759.1\|2092609_2092942_+	YegP family protein	NA	NA	NA	NA
WP_095575841.1\|2093089_2094451_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	2.3e-215	98.4
WP_072179090.1\|2095110_2095887_+	cytolethal distending toxin type II subunit CdtA	G1BEM3	Escherichia_phage	1.1e-126	93.8
WP_095575842.1\|2095883_2096693_+	cytolethal distending toxin type II nuclease subunit CdtB	G1BEM4	Escherichia_phage	4.5e-142	94.8
WP_059219458.1\|2096707_2097253_+	cytolethal distending toxin type II subunit CdtC	M1SNM4	Escherichia_phage	8.3e-92	90.1
WP_095575843.1\|2097586_2098486_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	1.3e-12	28.2

DBSCAN-SWA_8

2138694 : 2148141

Enterobacteria_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059219476.1\|2138694_2139831_+	VWA domain-containing protein	Q9EYF7	Enterobacteria_phage	1.3e-158	93.8
WP_095575853.1\|2139827_2141825_+	SWIM zinc finger family protein	Q9EYF6	Enterobacteria_phage	0.0e+00	85.3
WP_000643193.1\|2141955_2142417_+	YehR family lipoprotein	Q9EYF5	Enterobacteria_phage	8.4e-69	89.5
WP_000950403.1\|2142459_2142930_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	2.2e-80	96.8
WP_002461811.1\|2142976_2143696_-	two-component system response regulator BtsR	NA	NA	NA	NA
WP_002461809.1\|2143692_2145378_-	two-component regulatory system sensor histidine kinase BtsS	Q9EYF3	Enterobacteria_phage	2.7e-298	97.7
WP_095575854.1\|2145599_2146331_+	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	1.7e-108	97.0
WP_001216963.1\|2146390_2146498_+	protein YohO	NA	NA	NA	NA
WP_095575855.1\|2146478_2147210_-	glycine betaine ABC transporter permease YehW	NA	NA	NA	NA
WP_000569309.1\|2147214_2148141_-	glycine betaine ABC transporter ATP binding protein YehX	G3M9Y6	Bacillus_virus	4.8e-23	30.8

DBSCAN-SWA_9

2545571 : 2620058

Salmonella_phage(42.86%)

plate,head,terminase,tail,integrase,holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059219642.1\|2545571_2546312_-\|tRNA	tRNA (cytosine(32)/uridine(32)-2'-O)-methyltransferase TrmJ	NA	NA	NA	NA
WP_059219643.1\|2546430_2547234_+	inositol-1-monophosphatase	NA	NA	NA	NA
WP_025238575.1\|2547379_2548234_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_059219644.1\|2548424_2549705_+	stationary phase inducible protein CsiE	NA	NA	NA	NA
WP_000244166.1\|2549696_2550836_-	3-phenylpropionate MFS transporter	NA	NA	NA	NA
WP_059219645.1\|2551250_2551673_+	DoxX family protein	NA	NA	NA	NA
WP_059267490.1\|2551832_2552705_-	aldose 1-epimerase	NA	NA	NA	NA
WP_000700787.1\|2552715_2553810_-	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_001276664.1\|2553842_2554841_-	ABC transporter permease	NA	NA	NA	NA
WP_059278260.1\|2554865_2556377_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-13	27.7
WP_095575928.1\|2556399_2557383_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_095575929.1\|2557479_2560761_-	DUF5107 domain-containing protein	NA	NA	NA	NA
WP_059219648.1\|2560878_2562072_+	ROK family protein	NA	NA	NA	NA
WP_059219649.1\|2562273_2563527_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	2.0e-101	52.7
WP_059219101.1\|2563856_2565047_+	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_000717692.1\|2565094_2565433_-	nitrogen regulatory protein P-II	NA	NA	NA	NA
WP_002461544.1\|2565493_2566828_-	two-component system response regulator GlrR	W8CYM9	Bacillus_phage	6.7e-10	37.3
WP_059219676.1\|2566817_2567531_-	two-component system QseEF-associated lipoprotein QseG	NA	NA	NA	NA
WP_059219650.1\|2567548_2568979_-	two component system sensor histidine kinase QseE/GlrK	W8CYF6	Bacillus_phage	4.4e-15	25.6
WP_025238561.1\|2569601_2570183_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_059275363.1\|2570251_2574139_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	3.8e-130	58.9
WP_054411135.1\|2574396_2575953_+	membrane-bound lytic murein transglycosylase MltF	NA	NA	NA	NA
WP_001250374.1\|2576096_2576633_-\|tRNA	tRNA adenosine(34) deaminase TadA	NA	NA	NA	NA
WP_000190659.1\|2576657_2577293_-	phosphatidylglycerophosphatase C	NA	NA	NA	NA
WP_002461536.1\|2577501_2578350_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_095575930.1\|2579240_2580086_+	hypothetical protein	NA	NA	NA	NA
WP_095575931.1\|2580090_2580405_-	recombinase family protein	M1T2R9	Escherichia_phage	4.3e-40	92.1
WP_019842908.1\|2580434_2580821_+	hypothetical protein	A0A0F7LBW5	Escherichia_phage	2.1e-09	70.0
WP_095575932.1\|2580822_2581266_+\|tail	tail fiber assembly protein	A0A0F7LDZ0	Escherichia_phage	2.0e-59	74.1
WP_095575933.1\|2581237_2581840_-\|tail	tail fiber assembly protein	M1SV83	Escherichia_phage	3.3e-97	88.0
WP_095575934.1\|2581839_2582628_-\|tail	tail fiber protein	M1TAS6	Escherichia_phage	6.2e-80	63.0
WP_000049950.1\|2582627_2583308_-	DUF2612 domain-containing protein	A0A0M5M1K4	Salmonella_phage	2.6e-103	78.8
WP_095575935.1\|2583304_2584504_-\|plate	baseplate J/gp47 family protein	A0A0M4RD32	Salmonella_phage	1.4e-184	83.6
WP_001270634.1\|2584503_2584857_-	hypothetical protein	A0A0M4R339	Salmonella_phage	3.1e-55	90.6
WP_001007932.1\|2584856_2585609_-	hypothetical protein	A0A0M5M1K7	Salmonella_phage	2.0e-88	66.3
WP_000213604.1\|2585671_2585842_-	hypothetical protein	NA	NA	NA	NA
WP_000044735.1\|2585845_2586400_-	hypothetical protein	NA	NA	NA	NA
WP_000832850.1\|2586407_2586755_-	hypothetical protein	A0A0M4RTY3	Salmonella_phage	6.0e-27	81.1
WP_021517994.1\|2586757_2587822_-	hypothetical protein	A0A0M4QX01	Salmonella_phage	6.5e-157	81.7
WP_000155119.1\|2587824_2588127_-	hypothetical protein	A0A0M4R5B7	Salmonella_phage	2.2e-49	92.0
WP_001420197.1\|2588126_2588714_-	hypothetical protein	A0A0M3ULD5	Salmonella_phage	6.9e-84	88.5
WP_095575936.1\|2588713_2590699_-	lytic transglycosylase catalytic	A0A0M4REK7	Salmonella_phage	3.4e-175	53.5
WP_032314228.1\|2590876_2591329_-	hypothetical protein	A0A0M4S6U8	Salmonella_phage	2.7e-56	73.3
WP_000109249.1\|2591332_2591773_-	DUF3277 family protein	A0A2H4J619	uncultured_Caudovirales_phage	7.0e-57	75.3
WP_021572531.1\|2591783_2592929_-	DUF3383 domain-containing protein	A0A2H4J8G4	uncultured_Caudovirales_phage	1.8e-160	73.8
WP_001349562.1\|2592932_2593496_-	hypothetical protein	A0A0M4R331	Salmonella_phage	3.4e-80	76.3
WP_001519792.1\|2593470_2593860_-	hypothetical protein	A0A0M3ULK0	Salmonella_phage	3.3e-66	95.3
WP_021517253.1\|2593846_2594401_-	hypothetical protein	A0A0M4S631	Salmonella_phage	2.6e-80	83.7
WP_001125665.1\|2594397_2594805_-	DUF4054 domain-containing protein	A0A0M5M3S2	Salmonella_phage	8.7e-70	95.6
WP_160393966.1\|2594803_2595037_+	hypothetical protein	NA	NA	NA	NA
WP_095575938.1\|2595033_2595975_-	DUF2184 domain-containing protein	A0A0M3ULD3	Salmonella_phage	1.1e-155	86.9
WP_001066733.1\|2595986_2596493_-	hypothetical protein	A0A0M4QWZ6	Salmonella_phage	9.8e-71	80.5
WP_095575939.1\|2596496_2597717_-	DUF2213 domain-containing protein	A0A0M4R5A6	Salmonella_phage	3.2e-200	88.0
WP_157730589.1\|2597731_2598466_-\|head	phage head morphogenesis protein	A0A0M4REK0	Salmonella_phage	2.2e-95	85.0
WP_000113490.1\|2598356_2599823_-	DUF1073 domain-containing protein	A0A0M4S6U1	Salmonella_phage	6.7e-261	91.8
WP_095575940.1\|2599822_2601445_-	TerL protein	A0A0M5M1R6	Salmonella_phage	0.0e+00	95.2
WP_000162796.1\|2601447_2602020_-\|terminase	terminase small subunit	A0A2H4J480	uncultured_Caudovirales_phage	1.4e-60	69.6
WP_095575941.1\|2602081_2602606_-	hypothetical protein	K7P6W1	Enterobacteria_phage	1.3e-41	66.1
WP_001194119.1\|2602589_2603066_-	glycoside hydrolase family protein	Q8SBE0	Shigella_phage	2.1e-86	96.2
WP_000781776.1\|2603069_2603411_-\|holin	phage holin, lambda family	Q8SBE1	Shigella_phage	2.8e-53	91.9
WP_095575942.1\|2603855_2604197_-	hypothetical protein	NA	NA	NA	NA
WP_089647689.1\|2604228_2604651_-	antitermination protein	Q8W638	Enterobacteria_phage	5.2e-41	63.3
WP_095575943.1\|2604939_2607126_-	replication protein	B6SCY1	Bacteriophage	1.1e-174	72.7
WP_044782164.1\|2607115_2607301_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000606440.1\|2607414_2608107_+	helix-turn-helix transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	3.8e-57	48.5
WP_000801672.1\|2608728_2608878_+	hypothetical protein	NA	NA	NA	NA
WP_000051353.1\|2608874_2609777_+	hypothetical protein	Q3LZP9	Bacteriophage	6.1e-07	54.4
WP_095575944.1\|2609779_2611081_+	DUF2800 domain-containing protein	B6SCX9	Bacteriophage	6.8e-132	55.5
WP_000769011.1\|2611096_2611645_+	DUF2815 family protein	Q775A5	Bordetella_phage	1.6e-66	65.9
WP_042106501.1\|2611696_2612335_+	hypothetical protein	H6WRY3	Salmonella_phage	1.7e-72	69.3
WP_000490741.1\|2612402_2612672_-	hypothetical protein	NA	NA	NA	NA
WP_095575945.1\|2612728_2614792_+	DNA polymerase	Q775A3	Bordetella_phage	1.0e-275	67.8
WP_000008820.1\|2614797_2615013_+	ANR family transcriptional regulator	NA	NA	NA	NA
WP_000637724.1\|2615009_2615309_+	DUF4406 domain-containing protein	A0A0U2SAZ1	Escherichia_phage	2.7e-28	63.2
WP_095575946.1\|2615298_2615580_+	VRR-NUC domain-containing protein	B6SD64	Bacteriophage	1.1e-26	65.9
WP_063112595.1\|2615568_2616495_-	hypothetical protein	A0A1R3Y6Z6	Salmonella_virus	5.5e-51	38.5
WP_095575947.1\|2616597_2617992_+	DEAD/DEAH box helicase	Q3LZN8	Bacteriophage	1.5e-214	74.4
WP_001291431.1\|2617988_2618189_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_001138329.1\|2618185_2619583_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_095575948.1\|2619797_2620058_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.7e-18	54.7

DBSCAN-SWA_10

2763226 : 2770367

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000110915.1\|2763226_2765788_+	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	3.5e-31	20.7
WP_044708390.1\|2765894_2766551_+	protein-serine/threonine phosphatase	K7P7V3	Enterobacteria_phage	3.6e-49	44.9
WP_002461462.1\|2766601_2767369_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.1e-68	57.0
WP_059221372.1\|2767564_2768473_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	6.6e-118	76.2
WP_095575967.1\|2768469_2769732_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	6.3e-135	60.6
WP_000997546.1\|2769728_2770367_+	aldolase	A0A077SK32	Escherichia_phage	7.5e-84	75.5

DBSCAN-SWA_11

4501370 : 4571164

Enterobacteria_phage(43.64%)

terminase,tail,transposase,integrase,lysis,portal,protease

attL 4510644:4510674|attR 4573457:4573487

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095576245.1\|4501370_4502303_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	1.7e-60	51.7
WP_054409938.1\|4502494_4503451_-	GTPase	NA	NA	NA	NA
WP_000467859.1\|4503461_4503665_-	YbdD/YjiX family protein	NA	NA	NA	NA
WP_095576246.1\|4503714_4505865_-	pyruvate/proton symporter BtsT	NA	NA	NA	NA
WP_095574528.1\|4506902_4508264_-	MFS transporter	NA	NA	NA	NA
WP_000091581.1\|4508481_4509396_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_095576247.1\|4509534_4510557_+	L-galactonate oxidoreductase	A0A2K9L7I1	Tupanvirus	6.1e-11	24.9
4510644:4510674	attL	NA	NA	NA	NA
WP_024165299.1\|4510736_4513028_-	phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase	NA	NA	NA	NA
WP_095576248.1\|4513281_4513776_-	DUF2501 domain-containing protein	NA	NA	NA	NA
WP_059221687.1\|4513832_4514570_-	DNA replication protein DnaC	V5UQI5	Shigella_phage	2.9e-63	50.4
WP_059267525.1\|4514572_4515112_-	primosomal protein DnaT	T1SA92	Salmonella_phage	1.7e-28	62.8
WP_000538185.1\|4515217_4515691_-	threonine/serine exporter	NA	NA	NA	NA
WP_095576249.1\|4515681_4516452_-	threonine/serine exporter ThrE family protein	NA	NA	NA	NA
WP_095574531.1\|4517077_4517803_+	response regulator transcription factor	NA	NA	NA	NA
WP_000400850.1\|4517760_4518438_+	DNA-binding transcriptional activator BglJ	NA	NA	NA	NA
WP_059278757.1\|4518477_4519266_-	siderophore-iron reductase FhuF	NA	NA	NA	NA
WP_072243629.1\|4519406_4519643_+	DUF1435 domain-containing protein	NA	NA	NA	NA
WP_095576250.1\|4520301_4521333_-	16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC	NA	NA	NA	NA
WP_044714832.1\|4521435_4521849_+	DNA polymerase III subunit psi	NA	NA	NA	NA
WP_001092450.1\|4521817_4522264_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_000870691.1\|4522278_4522956_+	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_021537116.1\|4523341_4524565_+\|integrase	site-specific integrase	A5LH57	Enterobacteria_phage	2.8e-236	98.5
WP_021537117.1\|4524836_4525856_-	DUF4365 domain-containing protein	NA	NA	NA	NA
WP_071791560.1\|4526587_4526782_-	helix-turn-helix domain-containing protein	A5LH59	Enterobacteria_phage	9.3e-30	90.6
WP_000073886.1\|4526781_4527093_-	hypothetical protein	A0A2H4N7F8	Pectobacterium_phage	1.1e-11	42.6
WP_024241867.1\|4527089_4527476_-	hypothetical protein	A5LH60	Enterobacteria_phage	1.1e-40	71.7
WP_024241866.1\|4527475_4527838_-	phage protein	K7PH61	Enterobacteria_phage	1.3e-64	97.4
WP_000008174.1\|4527828_4528365_-	5'-deoxynucleotidase	A5LH62	Enterobacteria_phage	2.8e-100	99.4
WP_000081287.1\|4528492_4529317_-	DUF2303 family protein	U5P439	Shigella_phage	6.0e-150	100.0
WP_000135682.1\|4529382_4529745_-	hypothetical protein	U5P4J6	Shigella_phage	3.3e-60	100.0
WP_059251277.1\|4530216_4530732_+	hypothetical protein	NA	NA	NA	NA
WP_000848748.1\|4530932_4531607_-	LexA family transcriptional repressor	U5P0T5	Shigella_phage	1.2e-132	100.0
WP_000649477.1\|4531697_4531898_+	helix-turn-helix domain-containing protein	U5P445	Shigella_phage	7.9e-32	100.0
WP_024241865.1\|4531941_4532493_+	hypothetical protein	Q8SBF4	Shigella_phage	7.6e-101	99.5
WP_024241864.1\|4532489_4533326_+	ash family protein	Q8SBF3	Shigella_phage	1.6e-150	99.3
WP_029792846.1\|4533318_4533555_+	hypothetical protein	A0A291AX25	Escherichia_phage	5.1e-38	96.2
WP_024241862.1\|4533551_4534370_+	helix-turn-helix domain-containing protein	A0A291AWW0	Escherichia_phage	1.8e-122	98.5
WP_016236627.1\|4534366_4534861_+	PerC family transcriptional regulator	U5P0U0	Shigella_phage	4.3e-87	97.6
WP_001522094.1\|4534860_4535514_+	phage N-6-adenine-methyltransferase	A5LH72	Enterobacteria_phage	5.6e-127	99.1
WP_024241861.1\|4535510_4535837_+	LexA family transcriptional regulator	U5P451	Shigella_phage	4.5e-53	99.1
WP_000767110.1\|4535833_4536229_+	RusA family crossover junction endodeoxyribonuclease	A0A0P0ZD39	Stx2-converting_phage	5.7e-66	98.4
WP_001072669.1\|4536391_4537207_+	KilA-N domain-containing protein	U5P4K5	Shigella_phage	8.5e-149	99.3
WP_001360050.1\|4537214_4538204_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	1.5e-195	100.0
WP_024241860.1\|4538217_4538970_+	antitermination protein	A0A192Y5X6	Salmonella_phage	1.3e-138	96.0
WP_122985741.1\|4539248_4539338_-	hypothetical protein	NA	NA	NA	NA
WP_001589622.1\|4539392_4539605_-	cold shock-like protein CspF	NA	NA	NA	NA
WP_024241859.1\|4539905_4540121_+	cold shock-like protein CspB	A0A1W6JNX5	Morganella_phage	1.7e-24	75.0
WP_024241858.1\|4540865_4541081_+\|lysis	phage lysis protein EssD	A5LH82	Enterobacteria_phage	5.0e-32	95.8
WP_024044720.1\|4541080_4541578_+	lysozyme RrrD	A5LH83	Enterobacteria_phage	8.4e-91	99.4
WP_024241857.1\|4541574_4542012_+\|lysis	lysis protein	K7P7F7	Enterobacteria_phage	4.2e-70	96.6
WP_024241856.1\|4542215_4542770_+	Rha family transcriptional regulator	A0A088CBJ5	Shigella_phage	7.7e-93	94.4
WP_000421825.1\|4543274_4543814_+	DUF1441 family protein	A5LH26	Enterobacteria_phage	1.8e-94	100.0
WP_024241854.1\|4543822_4545922_+\|terminase	phage terminase large subunit family protein	A5LH27	Enterobacteria_phage	0.0e+00	99.9
WP_001072975.1\|4545918_4546131_+	hypothetical protein	A5LH28	Enterobacteria_phage	1.1e-31	100.0
WP_077827187.1\|4546058_4547639_+\|portal	phage portal protein	A5LH29	Enterobacteria_phage	1.5e-287	99.0
WP_095576251.1\|4547583_4549611_+\|protease	Clp protease ClpP	A5LH30	Enterobacteria_phage	0.0e+00	99.4
WP_001097046.1\|4549697_4550021_+	DUF2190 family protein	A5LH31	Enterobacteria_phage	8.5e-52	100.0
WP_001283153.1\|4550013_4550289_+	DNA breaking-rejoining protein	K7PH43	Enterobacteria_phage	2.3e-45	100.0
WP_095576252.1\|4550300_4550879_+\|tail	phage tail protein	A5LH33	Enterobacteria_phage	2.7e-101	99.5
WP_023148639.1\|4550875_4551277_+\|tail	phage tail protein	K7PJP5	Enterobacteria_phage	1.1e-72	100.0
WP_024241850.1\|4551287_4552031_+\|tail	phage tail protein	A0A291AWU6	Escherichia_phage	3.0e-132	99.6
WP_001300035.1\|4552091_4552478_+\|tail	phage minor tail protein G	A0A291AWW5	Escherichia_phage	1.6e-65	100.0
WP_001161009.1\|4552486_4552816_+\|tail	phage tail assembly protein T	A5LH37	Enterobacteria_phage	7.6e-56	100.0
WP_024241849.1\|4552787_4555862_+\|tail	phage tail tape measure protein	A0A291AWX1	Escherichia_phage	0.0e+00	92.5
WP_000847354.1\|4555858_4556188_+\|tail	phage tail protein	A0A2R9YJM0	Escherichia_phage	8.1e-58	97.2
WP_024241847.1\|4556187_4556886_+\|tail	phage minor tail protein L	A0A0K2FJ01	Enterobacteria_phage	1.4e-131	98.3
WP_029792841.1\|4556890_4557628_+\|tail	phage tail protein	K7PLW1	Enterobacteria_phage	2.7e-146	97.1
WP_095576253.1\|4558258_4561672_+	host specificity protein J	K7PKJ2	Enterobacteria_phage	0.0e+00	96.0
WP_024241843.1\|4561742_4562342_+	Ail/Lom family outer membrane beta-barrel protein	Q687E7	Enterobacteria_phage	2.9e-106	95.0
WP_172843354.1\|4564683_4565190_+\|tail	tail fiber domain-containing protein	A0A1X7QGH6	Escherichia_phage	1.6e-44	54.9
WP_059222141.1\|4565327_4565657_-	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_024241840.1\|4566013_4566604_-	recombinase family protein	A0A219Y9V9	Aeromonas_phage	6.2e-24	36.2
WP_000836769.1\|4566982_4567216_-	cold shock protein YdfK	A0A192Y6D5	Salmonella_phage	6.4e-33	88.3
WP_001372053.1\|4567284_4567398_-	hypothetical protein	A0A1C9IHU6	Salmonella_phage	1.4e-06	77.8
WP_001217539.1\|4567824_4568073_-	DinI-like family protein	A5LH55	Enterobacteria_phage	1.1e-38	100.0
WP_095576255.1\|4568292_4569879_+	peptide chain release factor 3	D0R0F5	Streptococcus_phage	4.1e-30	25.2
WP_095576256.1\|4570270_4570876_+	molecular chaperone OsmY	NA	NA	NA	NA
WP_000490275.1\|4571002_4571164_+	DUF1328 domain-containing protein	A0A0N7CBR2	Salmonella_phage	1.8e-10	64.2
4573457:4573487	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_AP014856

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection