CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP022570	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK06, complete sequence	0 crisprs	NA	0	0
NZ_CP022564	Rhizobium leguminosarum bv. viciae strain BIHB 1148 chromosome, complete genome	3 crisprs	csa3,cas3,WYL,DEDDh,PD-DExK,RT	5	5
NZ_CP022568	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK04, complete sequence	0 crisprs	NA	0	0
NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	0 crisprs	DEDDh,csa3	0	1
NZ_CP022565	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence	0 crisprs	csa3	0	0
NZ_CP022566	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence	0 crisprs	csa3,DEDDh	0	0
NZ_CP022569	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

124063 : 137523

Vibrio_phage(25.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017961411.1\|124063_126121_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.7e-36	33.6
WP_094088730.1\|126588_126936_-	GFA family protein	NA	NA	NA	NA
WP_011652887.1\|126945_127983_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	7.1e-15	68.6
WP_094088731.1\|128093_129281_-	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	1.4e-35	27.5
WP_094088732.1\|129347_130076_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.8e-49	42.4
WP_094088733.1\|130145_132014_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	4.6e-73	34.9
WP_094088734.1\|132013_134023_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	7.1e-88	41.5
WP_094088735.1\|134694_135585_+	hypothetical protein	NA	NA	NA	NA
WP_028758328.1\|135588_136044_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	2.0e-14	38.7
WP_077979249.1\|136317_137523_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	7.4e-40	32.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP022564

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022564_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022564_1

2090671-2090969

Orphan

Consensus_repeat	Method
ACGNTCGGNACNGGCGGNTC	CRT

5 spacers

csa3

The CRISPR arrays of NZ_CP022564_1

>merge|NZ_CP022564|1|2090671-2090969|CRT
ACGATCGGTACTGGTGGCAGCTCTGCCGGGGGCGACTGCCCTGCTGGTTCGACCAACTGCAAATCCGGCACGTCCTCGACGGTCGGCACCGGCGGCTCATCGGCCGGTGGCGGCACTTCGAGCAGCACGGTCGGCACCGGCGGCTCTGCTGCGGGCTCCGGCTCGGGGTCTGCTTCGACGCTTGGCACCGGCGGTTCGTCGGCCGGCGGCGGCACCTCCAGCAGCACGGTCGGCACCGGCGGCTCCGCCGCAGGGTCGGGCGACGCGAACTCGGCCTCCAGCGTCGGGACTGGCGCTTC

>NZ_CP022564|1|1|2090671-2090969|CRT
ACGATCGGTACTGGTGGCAG	CTCTGCCGGGGGCGACTGCCCTGCTGGTTCGACCAACTGCAAATCCGGCACGTCCTCG
ACGGTCGGCACCGGCGGCTC	ATCGGCCGGTGGCGGCACTTCGAGCAGC
ACGGTCGGCACCGGCGGCTC	TGCTGCGGGCTCCGGCTCGGGGTCTGCTTCG
ACGCTTGGCACCGGCGGTTC	GTCGGCCGGCGGCGGCACCTCCAGCAGC
ACGGTCGGCACCGGCGGCTC	CGCCGCAGGGTCGGGCGACGCGAACTCGGCCTCC
AGCGTCGGGACTGGCGCTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022564.1\|WP_072639402.1\|2098135_2099434_+\|insulinase-family-protein	unknown	unknown	gnl\|CDD\|223685
NZ_CP022564.1\|WP_094086552.1\|2085961_2087128_-\|site-specific-DNA-methyltransferase	unknown	unknown	gnl\|CDD\|223931
NZ_CP022564.1\|WP_033181368.1\|2087617_2087947_-\|NIPSNAP-family-protein	unknown	unknown	gnl\|CDD\|311781
NZ_CP022564.1\|WP_017959295.1\|2100073_2102986_+\|sensor-domain-containing-phosphodiesterase	unknown	unknown	gnl\|CDD\|238923
NZ_CP022564.1\|WP_094086555.1\|2088886_2089228_-\|oxidoreductase	unknown	unknown	unknown
NZ_CP022564.1\|WP_094086556.1\|2089347_2089800_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022564.1\|WP_094086549.1\|2083768_2084860_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|224115
NZ_CP022564.1\|WP_094086557.1\|2090031_2090247_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022564.1\|WP_094086554.1\|2088019_2088706_+\|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|378968
NZ_CP022564.1\|WP_017959296.1\|2099462_2100077_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP022564.1\|WP_094086550.1\|2084862_2085477_+\|HAD-family-phosphatase	unknown	unknown	gnl\|CDD\|319790
NZ_CP022564.1\|WP_094086551.1\|2085482_2085848_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP022564.1\|WP_094086563.1\|2095083_2095668_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022564.1\|WP_094086559.1\|2091156_2091507_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022564.1\|WP_094086553.1\|2087270_2087621_-\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|225209
NZ_CP022564.1\|WP_094086562.1\|2094251_2094941_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319828
NZ_CP022564.1\|WP_094086561.1\|2092195_2094028_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|185001
NZ_CP022564.1\|WP_094086560.1\|2091516_2091960_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022564.1\|WP_094086564.1\|2095771_2096419_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022564.1\|WP_094086565.1\|2096707_2098132_+\|threonine-synthase	unknown	unknown	gnl\|CDD\|236418

Protein	Function_ID	Function_description	E-value
NZ_CP022564.1\|WP_072639402.1\|2098135_2099434_+\|insulinase-family-protein	gnl\|CDD\|223685	COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only].	4.11767e-132
NZ_CP022564.1\|WP_094086552.1\|2085961_2087128_-\|site-specific-DNA-methyltransferase	gnl\|CDD\|223931	COG0863, COG0863, DNA modification methylase [DNA replication, recombination, and repair].	2.24885e-89
NZ_CP022564.1\|WP_033181368.1\|2087617_2087947_-\|NIPSNAP-family-protein	gnl\|CDD\|311781	pfam07978, NIPSNAP, NIPSNAP. Members of this family include many hypothetical proteins. It also includes members of the NIPSNAP family which have putative roles in vesicular transport. This domain is often found in duplicate.	1.02663e-27
NZ_CP022564.1\|WP_017959295.1\|2100073_2102986_+\|sensor-domain-containing-phosphodiesterase	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	6.11675e-98
NZ_CP022564.1\|WP_094086549.1\|2083768_2084860_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|224115	COG1194, MutY, A/G-specific DNA glycosylase [DNA replication, recombination, and repair].	2.76411e-151
NZ_CP022564.1\|WP_094086554.1\|2088019_2088706_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|378968	pfam12840, HTH_20, Helix-turn-helix domain. This domain represents a DNA-binding Helix-turn-helix domain found in transcriptional regulatory proteins.	4.65689e-13
NZ_CP022564.1\|WP_094086550.1\|2084862_2085477_+\|HAD-family-phosphatase	gnl\|CDD\|319790	cd02603, HAD_sEH-N_like, N-terminal lipase phosphatase domain of human soluble epoxide hydrolase, Escherichia coli YihX/HAD4 alpha-D-glucose 1-phosphate phosphatase, and related domains, may be inactive. This family includes the N-terminal phosphatase domain of human soluble epoxide hydrolase (sEH). sEH is a bifunctional enzyme with two distinct enzyme activities, the C-terminal domain has epoxide hydrolysis activity and the N-terminal domain (Ntermphos), which belongs to this family, has lipid phosphatase activity. The latter prefers mono-phosphate esters, and lysophosphatidic acids (LPAs) are the best natural substrates found to date. In addition this family includes Gallus gallus sEH and Xenopus sEH which appears to lack phosphatase activity, and Escherichia coli YihX/HAD4 which selectively hydrolyzes alpha-Glucose-1-P, phosphatase, has significant phosphatase activity against pyridoxal phosphate, and has low beta phosphoglucomutase activity. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	8.61976e-37
NZ_CP022564.1\|WP_094086551.1\|2085482_2085848_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	2.57422e-08
NZ_CP022564.1\|WP_094086565.1\|2096707_2098132_+\|threonine-synthase	gnl\|CDD\|236418	PRK09225, PRK09225, threonine synthase; Validated.	0
NZ_CP022564.1\|WP_094086553.1\|2087270_2087621_-\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|225209	COG2329, COG2329, Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only].	1.08343e-17
NZ_CP022564.1\|WP_094086562.1\|2094251_2094941_+\|HAD-family-hydrolase	gnl\|CDD\|319828	cd07526, HAD_BPGM_like, subfamily of beta-phosphoglucomutase-like family, similar to Escherichia coli 6-phosphogluconate phosphatase YieH. This subfamily includes Escherichia coli YieH/HAD3 an 6-phosphogluconate phosphatase, which can hydrolyzed purines and pyrimidines as secondary substrates. It belongs to the beta-phosphoglucomutase-like family whose other members include Lactococcus lactis beta-PGM, a mutase which catalyzes the interconversion of beta-D-glucose 1-phosphate (G1P) and D-glucose 6-phosphate (G6P), Saccharomyces cerevisiae phosphatases GPP1 and GPP2 that dephosphorylate DL-glycerol-3-phosphate, and DOG1 and DOG2 that dephosphorylate 2-deoxyglucose-6-phosphate. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.11483e-58
NZ_CP022564.1\|WP_094086561.1\|2092195_2094028_+\|HAMP-domain-containing-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	4.39493e-64
NZ_CP022564.1\|WP_017959296.1\|2099462_2100077_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	2.12814e-39

>NZ_CP022564.1|WP_094086557.1|2090031_2090247_-|hypothetical-protein
MRLSAFVRPAAAVVLLFAFTSTDVIAKGKHRSCAQLQAMKDNALTGGKHAGDGTDKRAKIERKMRKKGCQK
>NZ_CP022564.1|WP_094086556.1|2089347_2089800_-|hypothetical-protein
MDEEDDCMTIEDIIETLEKTDMPDSRIDAFITCAFLLKQLRPAEPNDFDGPHDYLPSSIKSEHGFLMARPFTHDVNHAIDLCKEVRPDAVWHLARGRQTADDSLYGAQLREIKESESVLGEAESNHAALALTLAALRAHVRQEDEKRAGA
>NZ_CP022564.1|WP_094086555.1|2088886_2089228_-|oxidoreductase
MLLRLLAVTALSASLATAAIAQSGGGSGGSGSGSASSSSGSGSDSGAGGTGSGDSGSGGSGANSTSGGGAGGINGASNSGGDPDDCQRQQAGQPGNSAPSGTTTNKPDSATAC
>NZ_CP022564.1|WP_094086554.1|2088019_2088706_+|helix-turn-helix-transcriptional-regulator
MKEGPDIAQIGALIGDPARANMLAALTGGRALTATELAGVGGITVQTASTHLAKLEAGGLLTQRKQGRHRYFTLADEAVARLIESMMGFAAGRGHLRHQPGPKEPALRKARICYDHLAGDYGVRMLDSLIASGSIDAVGDGLALTEKGESDLKCIGIDVSDLRSSRRPLCRSCLDWSERRAHLAGSLGKALLSSFLDKGWARRTAESRSILFSPEGDRQFLKLFPVDA
>NZ_CP022564.1|WP_033181368.1|2087617_2087947_-|NIPSNAP-family-protein
MITCFIRYQIDPFKKEAFAEYARNWGQAIPKNGADLIGYFGPHEGSATTAYGVYNIESLAAYEAYRARLASDPLGRENYEFARREGFILKEDRIFLKNVSAPHAKLVLS
>NZ_CP022564.1|WP_094086553.1|2087270_2087621_-|antibiotic-biosynthesis-monooxygenase
MIAVIFEVVPYMGERHKYLDLAGELRGELEKIDGFISIERFESLTTRGKLLSLSFFRDEEAVKQWRNLEAHRAAQQAGRGGIFADYRLRIASVVRDYGMFERDEAPADSRRVHDAA
>NZ_CP022564.1|WP_094086552.1|2085961_2087128_-|site-specific-DNA-methyltransferase
MASVFPLADLKASVKSDSRPGSRSDSWPASWVDTIIKGDCVSALEALPSHSVDIIFADPPYNLQLGGTLHRPDQSLVDAVDDEWDQFASFEAYDAFTRAWLLACRRVLKPTGSIWVIGSYHNIFRVGATLQDLNFWILNDIIWRKTNPMPNFKGRRFQNAHETMIWASPSAKAKGYTFNYDALKAANDDVQMRSDWLFPICNGSERLKGEDGKKAHPTQKPEALLARVIMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYIDAASARIAAVEPLGKAELTVMTGKKAEVRVAFNVLVESGLIKPGQVLTDARRRYSAIVRADGTVASGGEAGSIHRLGAKVQGLDACNGWTFWHFEDGQSLRPIDDLRSVIRSDLAKAE
>NZ_CP022564.1|WP_094086551.1|2085482_2085848_+|nuclear-transport-factor-2-family-protein
MAFDPAQEIERFHAAINALDFPAIEAYFAEDATYVSNGVGDLTGRIEIMAAFRRYFDDYPDQTAENSLVETLTSLSGRSVWSVRATHSKTGKPLIREGEETITFNAEGRVTRVEVTDYRDF
>NZ_CP022564.1|WP_094086550.1|2084862_2085477_+|HAD-family-phosphatase
MTTDIRHIVFDIGKVLIHYDPHLPFSRLIPDETERHWFFANICTHDWNIEQDRGRTWAEAEALLIKQHPAREEHIRAFRKYWHEMVPHAYDDSVAIMEGLIAQGRDVTMLTNFASDTFREAQQRFPFLTKPRGVTVSGDVGLIKPDIAIYETHTKNFGLDPAATIFIDDAPVNVEGAKAFGWNAVLFSGADKLRSDLAGYGVKV
>NZ_CP022564.1|WP_094086549.1|2083768_2084860_+|A/G-specific-adenine-glycosylase
MTITTLDTPLAKPLLDWYDRHHRELPWRVSPGMAARGVKADPYRVWLSEVMLQQTTVQAVKPYFEKFLQRWPQVTDLAAAETDAVLAAWAGLGYYARARNLKKCAEAVAEEHGGIFPDTEEGLKSLPGIGDYTAAAVAAIAFNRQAAVMDGNVERVISRLYAIATPLPAAKPAMREKVALLTPADRPGDFAQAMMDLGATICTPKRPACSLCPFRGACAALKLSDPELFPVKAAKKEKPVRYGAAFIAVTGDGEILLRRRIDSGLLGGMTEVPTSAWTARIDGETSAAAAPFEAAWQAAGTVIHVFTHFELRLSIWRAAIAAKVAMNDGWWEPVTNLEAQALPTIMKKAIAAAIPLAFKTSKG
>NZ_CP022564.1|WP_094086559.1|2091156_2091507_+|hypothetical-protein
MTNFSTIALGASLALVAGQAMSEEIKLDDGTTCTVVESRSSQGDMSTTVTAGNGQVSSSTTTGSGSTGSSSSSSSAGSSAGSGSVDSFSTASITRPDGTVITKRSDGTCSVMKPKK
>NZ_CP022564.1|WP_094086560.1|2091516_2091960_+|hypothetical-protein
MKPINLIAAASIALLASSSAVLAEECNAAGTVGSAGSASAGGTSASSLGTAGTCRTDDGTTSSIGSGGSAATVDGKAQSKTHVNDSGDKLKAQTKAQAVDKGTFSKSRTKTSTDGSTLDSTTRTMSHVPGEKPVKNTTNQKIILPEQ
>NZ_CP022564.1|WP_094086561.1|2092195_2094028_+|HAMP-domain-containing-protein
MASIQHKIIIASIAIFALAGGATGVGIWSASILSENNAEVARTAHILRNHMQADMMHDALRSDALASLLASNPAAGIDVDTVKADLAEHEASFREMLDANKALAADDKTKTILASVEPPLIAYIASASQIVELAGKDPTAAMKALPDFMAQFSTLEAAMEQAGDQITAASEEISNRSSDINASVDIVLEALLASAALFAFGLYFITRKTVTKPILSLSDDMQRLAGGDTAIACAGIGRTDEIGTMASAVEVFRQAAIANKQLEKDAEAARLQGETERVTARKQADEDAAERLRAATSGLAAGLKRLASGDLAFQIDEPFAPDFENLRHDFNMSIRQLDQTLSAITAAIAAIDEGTREIASGAGDLSKRTEQQAASLEETAAALDQITANVSNSSKRTDEARTEATDANRNAAKSSEVVSHAEEAMRRIEASSQQISSIIGVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSAQAAKEIKGHIQKSSVEVESGVKLVLDTSQVLKAISEQIARINQHMDAIAVSAREQSTGLAEVNTAVNSMDQVTQQNAAMVEQSTAASGHLAEEAAKLRELVSRFRLRATTSTPSAAGRRSGQLAA
>NZ_CP022564.1|WP_094086562.1|2094251_2094941_+|HAD-family-hydrolase
MDGFDLIIFDCDGVLVDSEIIAAEVESALLTEAGYPIDAEEMGERFAGMTWRNILLQIEREASIPFSASLLDKSEHLLDLRLAQDVQPIPGVEFAVSRLPIKRCICSNSSTKRLDMMLTKVGLKPLFAPNIFSAKDLGPDRVKPKPDIFLHGASQMGVSPDKVVVVEDSVHGVHAARAAGMRVIGFTGASHSYPAHADKLTDAGAETAISRMNDLPGVVAALEAWDNVL
>NZ_CP022564.1|WP_094086563.1|2095083_2095668_+|hypothetical-protein
MDIADIRNRAQGVKPGGVTTGEIEYAREILSAAKGNIRAALYVVGLCGEPADARLVEPYLFGEERDVFGELALKVLCRYLGLIDAYKDLYRALIMSDEDIGWQNSRMTAIQLADVFLEKFPDNAIGCKLLEIMMTENDQDRLPARFSLINILGLRQILTDPYAVEFDDFSKDSQIIIAAAQARFQCSAEAPIIH
>NZ_CP022564.1|WP_094086564.1|2095771_2096419_-|hypothetical-protein
MVLGKVSRLIVSASFLALLTGCNSLGIGGDSKPAAPATQPNGTAQIMPLAPANPSSNNPSIGIATTAQGTVAPVVQGACPQIFMRDQDAIFRTYAKGKKDDPQQIVFQASFGDYTRQCTLNDTNLTMTIVAQLRLITGPAGTPGPVTLPIRISVVDGETVLYSEVTKFPTEIPPGAPGTQVIFRKDGITMPVGSGALVRVNIGFDTQPAKTKKSS
>NZ_CP022564.1|WP_094086565.1|2096707_2098132_+|threonine-synthase
MTNVDYISTRGEAPSLGFCDALLTGLARDGGLYVPRKWPSFSKKEIRALRGKTYQEIAFTILSPFTNGEIPDDTFRAMIDEAYGTFRHPAIAPLVQTGPNSFVMELFHGTTLAFKDVAMQLLARLMDYALEKRGERATIVGATSGDTGGAAIDAFASRERTDIFILFPHGKVSPVQQRQMTTSSSPNVHALAVEGNFDDCQNLVKAMFNDAAFRDKVGLSGVNSINWARIMAQIVYYFTAAVALGGPDRKISFTVPTGNFGDIFAGYCAKRMGLPIDRLVIATNENDILARALKTGRYDMKAVKATSSPSMDIQISSNFERLLFEAHDRDASKVRAAMESLKQSNGFEIGAQALKAIRRDFRSGRASEKQVAETIRKTHAETGYLLDPHSAIGVFVAAKKEKPNTPMVTLSTAHPAKFPAAVKSACGIDPALPTWLADLMQREERFQIIKPELKAVENFIGKHARGETTAGAER
>NZ_CP022564.1|WP_072639402.1|2098135_2099434_+|insulinase-family-protein
MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETDNEHGIAHLLEHMAFKGTARRTARQIAEEIEDVGGEVNAATSTETTSYYARVLKDYVPLAVDILADILTESAFEEEELEREKQVILQEINAANDTPDDVVFDRFSEVAYRDQTLGRAILGTPETVVSFTPQQIRGYLSRNYTTDRMFVVATGAVEHDEFLRMVEDRFASLPTAPSAPPVMDAARYIGGSVREPRDLMDAQILLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFGIHAATGGENLPELVPVIIDELHKSADAIHQNEIERARAQIRAQLLMGAESPAARAGQIARQMMLYGRPISNPEMMERLEGITIERLTDLAGRLFYDTVPTLSAIGPLEQLAPMEDITASLSVPASKTLQASR
>NZ_CP022564.1|WP_017959296.1|2099462_2100077_+|GNAT-family-N-acetyltransferase
MPKSVFRFLQRQPEAVQLENDRYLLRLPRYQDFNQWHRLRADSRKFLEPWEPTWRRDELTEGAYRARVVRGKQEYASGQAVPLFIFLKDDMTLVGGVTIGYIRRGAAQSCMIGYWMGERHAGQGHMFAALQLVIPYIFTGLELHRIEAACIPDNARSIRLLEKAGFQQEGYLRGYLKINGQWHDHVMFSRLATDTDKGRKTDSR
>NZ_CP022564.1|WP_017959295.1|2100073_2102986_+|sensor-domain-containing-phosphodiesterase
MTRDRMLPKSPSGRVIAVIAALFLAAFAFVAGVAQAAEPVKISRDDTALDLTATTEIYVNQGEAFQVSTAAGADGIRRRIEVRASSENHQGDWAVFALANVSEEQLERVIVAPHFRLVNSKLFWPDLGSQRISAITPSEGFALDRQPSDEADVFRITLNPGAVITFVAELSTPELPQIYLWEPNAYKDTINAFTLYRGIVLGIAGLLAVFLTILFVVKGTSMLPATAALAWAVLGYICVDFGFLGKLISVASADQRIWRACAEVALASSFVIFLFTYLNLNRWHAHLGYATLAWVLGLALLFGVAIYDPSIAAGIARLSFALTAATGLLLIIYLGFNRYDRAILLVPAWALTLVWLFGAWLTVTGRLDNDIIQPALGGGLVLIVLLIGFTVMQHAFAGGAYQQGLFSDLERQSLALTGSGDMVWDWDVARDRVVTIPDVSIKLGLSPGAMHGAARNWLPRLHPDDRDRFRATLDVLLEHRRGRLNHEFRIRAEDGHFHWLLIRARPVLGSNGEIIRCVGTIVDVTEQKNSVERLLHDALHDNLTGLPNRQVFLDRLQSVLALAPGGDTLRPTVMVIDIDRYKLVNDSLGVAAGDNILIALTRRLRRLLKPQDTLARLAGDQFGLILVSEHNPAKVADFADAISKAIMVPINFANREIILTASVGLASWVDRQESATGLLSDAELAMYRAKRAGGNRVEPFQPAFRDFGTDRLQLETDLRRAIERKELSMVYQPIARLEDVEVAGFEALMRWEHPKRGNIPPSEFIPIAEASDLIGPLGMFALEQATNDLMSWQHQTGELPIFVSINLSSVQLLNNELYDDVRSVLAKTHCQPSRLKLELTESMVMENPEQARLVLQKLKEAGIGLALDDFGTGYSSLAYLTRFPFDMIKLDKALVRDSSDKKATVLRSVISMARELDMKVVAEGIESNEDAIELAKMGCNYGQSYLFGPPMPSESVLRLLRDRFPLTKRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022564_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022564_2

2184310-2184403

Orphan

Consensus_repeat	Method
AAAACCGCTGCACAGTTTTGGGCGACATGCATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022564_2

>merge|NZ_CP022564|2|2184310-2184403|CRISPRCasFinder
AAAACCGCTGCACAGTTTTGGGCGACATGCATAATCCTGGCTTGATGCATGCCGTGACCCAAAAACCGCTGCACACTTTTGGGCGACATGCATA

>NZ_CP022564|2|1|2184310-2184403|CRISPRCasFinder
AAAACCGCTGCACAGTTTTGGGCGACATGCATA	ATCCTGGCTTGATGCATGCCGTGACCCA
AAAACCGCTGCACACTTTTGGGCGACATGCATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022564.1\|WP_017959218.1\|2181294_2181774_-\|BA14K-family-protein	unknown	unknown	gnl\|CDD\|369573
NZ_CP022564.1\|WP_094086610.1\|2193281_2193863_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP022564.1\|WP_094086603.1\|2177154_2177910_-\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|168351
NZ_CP022564.1\|WP_094086604.1\|2177919_2179698_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
NZ_CP022564.1\|WP_094086613.1\|2198048_2200223_+\|glycine--tRNA-ligase-subunit-beta	unknown	unknown	gnl\|CDD\|234925
NZ_CP022564.1\|WP_094086608.1\|2185479_2186916_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_CP022564.1\|WP_017959224.1\|2174830_2176081_+\|class-I-SAM-dependent-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|225174
NZ_CP022564.1\|WP_094086605.1\|2180010_2181006_+\|transporter	unknown	unknown	gnl\|CDD\|213368
NZ_CP022564.1\|WP_094087671.1\|2181994_2183239_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	unknown	unknown	gnl\|CDD\|226985
NZ_CP022564.1\|WP_094086609.1\|2190569_2191136_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022564.1\|WP_094086606.1\|2183657_2184266_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022564.1\|WP_094086602.1\|2172960_2173959_-\|DUF4424-domain-containing-protein	unknown	unknown	gnl\|CDD\|373054
NZ_CP022564.1\|WP_094087670.1\|2174087_2174834_+\|TlyA-family-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|224110
NZ_CP022564.1\|WP_094086607.1\|2184471_2185446_+\|threonylcarbamoyl-AMP-synthase	unknown	unknown	gnl\|CDD\|223088
NZ_CP022564.1\|WP_094087673.1\|2191221_2192181_-\|4-hydroxybenzoate-octaprenyltransferase	unknown	unknown	gnl\|CDD\|183808
NZ_CP022564.1\|WP_017959210.1\|2192341_2193154_-\|MipA/OmpV-family-protein	unknown	unknown	gnl\|CDD\|226236
NZ_CP022564.1\|WP_017959223.1\|2176083_2177094_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293841
NZ_CP022564.1\|WP_094086612.1\|2195323_2197633_-\|RNA-binding-transcriptional-accessory-protein	unknown	unknown	gnl\|CDD\|225094
NZ_CP022564.1\|WP_094086611.1\|2193930_2195190_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|225139
NZ_CP022564.1\|WP_094087672.1\|2186939_2190269_-\|DUF1217-domain-containing-protein	unknown	unknown	gnl\|CDD\|369062

Protein	Function_ID	Function_description	E-value
NZ_CP022564.1\|WP_094086603.1\|2177154_2177910_-\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|168351	PRK06023, PRK06023, crotonase/enoyl-CoA hydratase family protein.	4.20999e-161
NZ_CP022564.1\|WP_094087672.1\|2186939_2190269_-\|DUF1217-domain-containing-protein	gnl\|CDD\|369062	pfam06748, DUF1217, Protein of unknown function (DUF1217). This family represents a conserved region that is found within bacterial proteins, most of which are hypothetical. Some members contain multiple copies.	4.41559e-54
NZ_CP022564.1\|WP_094086604.1\|2177919_2179698_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	3.65664e-149
NZ_CP022564.1\|WP_094086613.1\|2198048_2200223_+\|glycine--tRNA-ligase-subunit-beta	gnl\|CDD\|234925	PRK01233, glyS, glycyl-tRNA synthetase subunit beta; Validated.	0
NZ_CP022564.1\|WP_017959224.1\|2174830_2176081_+\|class-I-SAM-dependent-RNA-methyltransferase	gnl\|CDD\|225174	COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis].	1.56812e-119
NZ_CP022564.1\|WP_094086605.1\|2180010_2181006_+\|transporter	gnl\|CDD\|213368	cd12834, ZntB_u1, Uncharacterized bacterial subgroup of the Salmonella typhimurium Zn2+ transporter ZntB-like subfamily. The MIT superfamily of essential membrane proteins is involved in transporting divalent cations (uptake or efflux) across membranes. The ZntB-like subfamily includes the Zn2+ transporter Salmonella typhimurium ZntB which mediates the efflux of Zn2+ (and Cd2+). Structures of the intracellular domain of Vibrio parahaemolyticus and Salmonella typhimurium ZntB form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA, and Mrs2p. Natural variants such as GVN and GIN which occur in proteins belonging to this subfamily, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	5.3322e-113
NZ_CP022564.1\|WP_094086608.1\|2185479_2186916_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	2.40716e-127
NZ_CP022564.1\|WP_017959210.1\|2192341_2193154_-\|MipA/OmpV-family-protein	gnl\|CDD\|226236	COG3713, OmpV, Outer membrane protein V [Cell envelope biogenesis, outer membrane].	3.75225e-64
NZ_CP022564.1\|WP_017959218.1\|2181294_2181774_-\|BA14K-family-protein	gnl\|CDD\|369573	pfam07886, BA14K, BA14K-like protein. The sequences found in this family are similar to the BA14K proteins expressed by Brucella abortus and by Brucella suis. BA14K was found to be strongly immunoreactive; it induces both humoral and cellular responses in hosts throughout the infective process.	1.73928e-10
NZ_CP022564.1\|WP_094086602.1\|2172960_2173959_-\|DUF4424-domain-containing-protein	gnl\|CDD\|373054	pfam14415, DUF4424, Domain of unknown function (DUF4424). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 310 and 361 amino acids in length.	3.26821e-127
NZ_CP022564.1\|WP_094087670.1\|2174087_2174834_+\|TlyA-family-RNA-methyltransferase	gnl\|CDD\|224110	COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis].	3.76205e-116
NZ_CP022564.1\|WP_094086607.1\|2184471_2185446_+\|threonylcarbamoyl-AMP-synthase	gnl\|CDD\|223088	COG0009, SUA5, Putative translation factor (SUA5) [Translation, ribosomal structure and biogenesis].	2.20445e-76
NZ_CP022564.1\|WP_094087673.1\|2191221_2192181_-\|4-hydroxybenzoate-octaprenyltransferase	gnl\|CDD\|183808	PRK12878, ubiA, 4-hydroxybenzoate octaprenyltransferase.	0
NZ_CP022564.1\|WP_017959223.1\|2176083_2177094_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293841	cd16283, RomA-like_MBL-fold, Enterobacter cloacae RomA and related proteins; MBL-fold metallo hydrolase domain. Derepression of the romA-ramA locus results in a multidrug-resistance phenotype. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	1.52172e-76
NZ_CP022564.1\|WP_094086612.1\|2195323_2197633_-\|RNA-binding-transcriptional-accessory-protein	gnl\|CDD\|225094	COG2183, Tex, Transcriptional accessory protein [Transcription].	0
NZ_CP022564.1\|WP_094086611.1\|2193930_2195190_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|225139	COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane].	3.50267e-125
NZ_CP022564.1\|WP_094086610.1\|2193281_2193863_-\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	2.52805e-58
NZ_CP022564.1\|WP_094087671.1\|2181994_2183239_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	gnl\|CDD\|226985	COG4638, HcaE, Phenylpropionate dioxygenase and related ring-hydroxylating dioxygenases, large terminal subunit [Inorganic ion transport and metabolism / General function prediction only].	2.27477e-114

>NZ_CP022564.1|WP_094086606.1|2183657_2184266_+|hypothetical-protein
MAKLRYFDAKDASRSQEPQLIAAHSEFLRTGRIPRERRHWLAEEKRYFTHDEVAAKTGRKLQVAGEKTHQNINGFHHSIRFPKMIFHRTLQDSPHLGYCHVTAARTKFAHYEEVSWAFYIANFYSDIGDNDNFFERIDVGYSRMYFAVAIKPGENSAEKMTIDRSVRGNGLLFRTHDPQAAIRNILLLGARNEQLREIIRQL
>NZ_CP022564.1|WP_094087671.1|2181994_2183239_-|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha
MDIRSNVLRQLKSRREGFSLEQPFYIDEDYFQLDMEMIYYRDWLFIGHDCELPKPGAYFTVQIGSYPVVIVRGRDNVIRAFHNSCRHRGSRVCTKEHGSSVRLVCPYHQWTYDLEGKLAFARHMGDDFDKTGFNLKPVHCEIVAGYVFICLANTAPDFQPVRDKIEPYVAPHRISESKVAFQNTIIEKGNWKLVWENNRECYHCAANHPELCRTYPEAPSVTGTDGGADDPEIAGHWARCEAAGLPSKFQISPDGQFRTARMPLIEDAESYTMSGKSAVKRPLSEDISISHIGTMLLFHYPTTWNHLLGDHAISFRVLPLSANETAVTTKWLVHKDAVEGVDYDLEELTHVWTETNDQDRRIVEENAFGIHSPAYEPGPYSALHEGGVMQFLEWYSNFMVNRLQGDQAKISAVA
>NZ_CP022564.1|WP_017959218.1|2181294_2181774_-|BA14K-family-protein
MFGLSNKIATAILAAAVVLTGFAPSQAIQMPTPPQVEKSSAVENVQYRRYYRPGYRPGYRPGYRPGAYYRPGYYGGYRGYSYYRPGYRRYNGYWYPLAAFGAGAVIGGAIAAQPRYVAPAPRMGSSHVAWCANRYRSYRAYDNTFQPYNGPRQQCYSPY
>NZ_CP022564.1|WP_094086605.1|2180010_2181006_+|transporter
MDTLPVNIPGFVWAYRFSPDEKAAVRLNNSATVAELTADNCFYWLHLNLVDARVPALLDTLEGLTEDAKSALTTRDTHAAITVDEQMLYGTLVDCQREFAEDTNNLGWLHFAMSDRFIITTRLQPLRSVERARALIDKNPGKFSRPVDLFELLVTEFQRTLIAIVIELTEELNQIEDIVYDSAQRDERRRLAPVRRTVVRLHRHLRTVLALMRRAAAADEDEMPFGFDDVARRLTGRLETVDHDIYALQDRARLLHEEIDSKQSSETNRHLYLLSIMTAFLLPPTLVTGFFGMNTANLPFAVGDYGTEYAVVLILASVALAWWLLRRVDIL
>NZ_CP022564.1|WP_094086604.1|2177919_2179698_-|acyl-CoA-dehydrogenase
MYKAPVEEIAFTLKHVAGMGEAISKGLLGDLGEDLVDAILAEAGRFATEEVAPLAEIGDRQGARLEGGEVRLPDGWRDLYRHWIAGGWNGLTAPEAFGGQALPHMLNVAALEMWNSGSMAFALAPTLTMGAIEAVSVHGSAALKDKYLERMVSGEWTGTMNLTEPHAGSDLGVLKARAERRHDGSYRLFGQKIFITWGEHDAADNIIHLVLARLPDAPAGTRGISLFLVPKFLVNDDGSLGPRNDLFCHSLEHKLGIHGSPTCTMIYGDGKFGGEKGAVGWLVGEENKGLACMFTMMNNARLAVGMQGVAIAEAATQKALAYARERTQGRAPGSSGAGMSPIVEHPDVARMLLTMKALTQGARAISYACAHAIDMSHRAGDISRHWQERAALLTPIAKSFSTDAGVDVASLGIQVHGGMGFIEETGAARYLRDARIAPIYEGTNGIQAIDLVTRKLPLSGGDQVKGFITELKQIADGVRRSNLNGFGETAARLDAAIADLEQATAWLIKTLADDKVAEALSGATPYQRLFGLVLTGCYLAKGGLAEGADGAGEKRIALCRFAAENLLAETAALRDRVVNGAASLAAARILLA
>NZ_CP022564.1|WP_094086603.1|2177154_2177910_-|crotonase/enoyl-CoA-hydratase-family-protein
MTDHIIVEQPAAHPGVQLIRFNRPEKKNAITRAMYRTMADALNAANTNPDIRASALLGTEGCFSAGNDMNDFLAAAIGGGGLGQEILDFLYALVNAEKPVVSGVDGLAIGIGTTIHLHCDLTIASSRSQFRTPFVDLALVPEAASSLVAPRLMGHQRAFAMLAAGEAFSAVEAKEAGLVWKVVEPGEVDAMTLGLAATLAAKPPEALRIARDLIRGDRGEIIARIDEEARYFSARLKSAEARAAFEAFMRR
>NZ_CP022564.1|WP_017959223.1|2176083_2177094_+|MBL-fold-metallo-hydrolase
MSVEKTKRRNPYYNGPVSDHFDGTHFFNPEGIEPLGFRDLMRWQFGGGRARWPRSVPSPYAMAKPDPHVDGEDLRVTMVGHATMLVQVAGLNILTDPVWSERASPFAFAGPRRVVPPGIAFDDLPPIDLVLVSHNHYDHLDIATLRRLGAKHRPRVVTPLGNDTIIRRAVPDIETTSMDWGERISHAGISIDAEPAHHWSARGTADRRMALWASFVLSTPAGKIYHVGDTGFHHGINYKAAQQKHGGFRLAILPFGAYEPRWFMKGQHQNPQEAVIGMTLANAAYVAGHHFATFQLTNEAVDAPARALQDAMREHDIPPERFRPLRAGEVFDVPAV
>NZ_CP022564.1|WP_017959224.1|2174830_2176081_+|class-I-SAM-dependent-RNA-methyltransferase
MSTETVKIEKLGAQGDGIASSAGGPVYVPFSLPGETVAIARVKSQGTIMSITTPSPDRQEPPCRHFGPDGVNGTCGGCTLQHMADAPYRAFKRQLVIDALKSKGLTPDVGEIVPAGPGERRRVVFAARKTEKDMLIGFNQAESHHIVAIEECPISSAGIIARLPAIRAMAASLATSAEPFRVAVLETLSGLDISVDDVKKLSDPQRRKAIETALSLRGIARVSLNGEILVEPSKPMVEFGGVQVSPPPGGFTQATKPAEEAMAELVLAHVGKSKRIADLFAGAGTFSLRLARIGRVHAVEAEAKALAALDHAARNTQGLKPVTVEKRDLFRRPLMTQEFKPYDAVVFDPPRAGAEFQCQELARSAVKKIVAVSCNPLTLARDLAILVESGYRIAQVTPIDQFLWTSHVEVVATLEK
>NZ_CP022564.1|WP_094087670.1|2174087_2174834_+|TlyA-family-RNA-methyltransferase
MSDQNTQRLDQLLVSLGLFASRSRARDAVQRGTVRIGGQVVTKAGALFGADASIEIDDPAQDYVSRAALKLAAALDHFRLDSAGHHCLDVGASTGGFTEVLLQRGAAHVTAIDVGHGQMHPRISGDPRVTNREGLNARNLTAEDIGHPATFIVSDVSFITLKLALAPALEIAEPGAVAVLLVKPQFEAGREAIGKGGMLKDPSSAPAVAAELERWFIEDMGWKSLGLIPSPISGGDGNQEFLLAGLKP
>NZ_CP022564.1|WP_094086602.1|2172960_2173959_-|DUF4424-domain-containing-protein
MLKLFTLLVAAGIASPALANDTLAEIKTGGLIFAQSDDVSMAEEDLFISASEVRVDYVFENSSDKDVESLVAFPMPDISGQVDNNSAISDYDSDNFLHFSTVQDGRPITAKLQQRVISLGIDVTDEFAKQGIPVLPYSQKTTEALAKLPETIRKDWIVRGLVYPMGAGDAAGVDLVPLWTLRSTYWWRTTFPAKKKVSVQHRYKPAVGGTVAISFLEGGEPKGERFEEYSRKYCLDGDFVRVAQQRAREAEAGGANYTESWISYVLSTGANWAGPIKRFQLTIDKGKPGSLISFCGSNVQKIGPTTFRMTSEDFDPTKDFDILILNPPETAQ
>NZ_CP022564.1|WP_094086607.1|2184471_2185446_+|threonylcarbamoyl-AMP-synthase
MARTIDIEADRQAALEAASAALADGFAIAIPTETVYGLAADATNPLAIARIYETKGRPRFNPLICHMADLAMAEEHAEFDPVSRALAAAFWPGPLTLVMPLKPQSSIHSLATAGLDSVGIRVPKGFAGALIGAFGRPLAAPSANTSGGISATSAAHVEADLGAKIPLILDAGPSAVGVESTIVKAEGGQLRLLRPGGLAAREIERVAGQLLLRAKAASAAIEAPGMLASHYAPGASVRLNATAVEPGEALIAFGSAMVSGADSARIVLDLSPRGDLAEAAANLFDYMKRADASGAQSIAFSPIPEDGLGEAINDRLQRAAAPRD
>NZ_CP022564.1|WP_094086608.1|2185479_2186916_+|FAD-binding-oxidoreductase
MSNSSISTELLDRFAAIVGEKYALRSETDLAPHLIENRGLYHGSSPLLLKPGSVEQVSDIMKLATETGTAIVPQTGNTGLVGGQTPRQGKSDIILSLERMNRIRDVDPVANVLVADGGAILAEVQKAAEAHGRLFPLSLGAEGSCRIGGNLSTNAGGTAVLAYGNIRQLCLGLEVVLPTGEIWDGLRRLKKDNTGYDLRDLFIGAEGTLGIITGAVLKLFPEPLGHQVAFAGLNSVADALALFNLASSLCGASLTGFELMPRFGVEITTRHIDGVRDPLEATYPWYVLIDISTSDSAETADRMMSGVLEQGFEAGLVLDAAIAASVAQQKALWHMRESMSDAQKPEGGSIKHDVSVPVSKIPHFMAEAEEAVMTAMPGARICAFGHMGDGNIHYNISQPLGADKDAFIARWHEMNHIVHGLVLAHGGSISAEHGIGQLKRDELAAIRPAIEIELMRRIKRAFDPADIMNPGKVVSLDP
>NZ_CP022564.1|WP_094087672.1|2186939_2190269_-|DUF1217-domain-containing-protein
MITASLAYTILSRDMTSSLNKVASQTTVKKDAQYYADHINKVTNVDDFLGDYKLYSYAMKAYGLEDMTYAKAFMKKVLESDLTDPDSYANKLSDTRYREFAAAFNFNAPEKDVQTDAQEDELIGLYKQSFADAEKAASAESTYYGNNIDSVQSVDDLLNNTRLRTYVLKTFKIDPTYASKDFLRQVLTSDLSDPTSFVNTQGGDKYKALAAQFSFNADGTVTGTAQTAAQKASVIESYTLNSQSVIIDNSVGSDVYYVGKTAAEYNKAYYTAKIGTITNVDDLVADNRLTSYIKTAYSMGADFTAAALRMVLTDPGYAQLMGFTNVYNAFNFKADGSTSNTARAQSIAQANNLQSAASNTGKYYTLTSQSSSITNVDDLLADDVLARYIKDAYRLGTNFSNADLKSILTDPAYAAAQGHAGINADFNFQADGSINGSVIQTEAQRKSTTDKSAANAAHFNGMIGNVTNVDGIMSDAVAVSYIRNSMQIADSVSDATLRTFLVDPAAASAQGYSDVHDLFNFKTDGSVATLYASQSASQSASTTSKANDAAVYYQATIAGISDVDQLLADQKLNNFVRNAFGIPSTVSDLDLRNILTDQSGTGTYADVAAAFNFKADGTLEDGMQAQTAAQISNTKISATARTNDYSARMRAIANVDDLIADDGITNFLKSTYNLPFDISNADLKSILTDATAAAAAGHADLNADFNFAADGSLPVVSSVQTADQAQTTNDNYAARYDDERDEAIEEVASNYQKLMADSSSLVNFSDVNSVNDFLRSNSSADFSKSNDNLPDLFHVALQAFGLTDQDVSRSMMRKILTSDAYDPNGYVASLKDERITNLARAFNFGPDGKAASPFQALPDATMAKYATDYRSHMTMLMKDGPVKDKAAKDATAEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLNATADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEEHTQELYVQQTMEAQQGESNDGVRLALYFSRKASSITSIYGILGDRALYQVITTAYSLPSQISGMDVAKQADLINRFVKLEDLQDPKKVDKLLRRFTAMYDVQSATQQSPALMILTNGGTQ
>NZ_CP022564.1|WP_094086609.1|2190569_2191136_+|hypothetical-protein
MNNPVMKPAWAGTTLRLDPSRFPQQVSYAIHDCSDDVNITIDERGAVLRKVLPSSGLPLSIALPKRVFKGVAARAIDHGDGDVTVTLELHHADPELCIPLLVAHDLSDIAADWRSWSEAFRIPMLMVEADGVARPLEEHIGALRTSDLKPRRRHSYFANRRPRFLVRRTTGRLGVAMKIEGKEIIART
>NZ_CP022564.1|WP_094087673.1|2191221_2192181_-|4-hydroxybenzoate-octaprenyltransferase
MHDTGDFNDRVSDAPSDNWVYRILPPWLWPYAQLARWDRPIGWQLLMWPCFWSATLAANAAIGEGIYSGSLLVSHLFLYFIGAVAMRGAGCTYNDLVDHEIDMEVARTRSRPLPSGRVTRAHAKIFIGLQALVGLIVLLQFNWLNVFLGVLSLGIVAFYPFAKRFTDWPQFYLGLAFSWGALMGWAGIMGGLSFAAILLYAASVAWTIGYDTIYAHQDKEDDELIGVRSTARLFGDRTRQWLIGLYGLTLLLMFIAFALAGANLIAFLALLGAAGMFAWQIVRLDINDPDQCLALFKSNNRVGLIIFFGLFVSLLFAIP
>NZ_CP022564.1|WP_017959210.1|2192341_2193154_-|MipA/OmpV-family-protein
MSHRSVVSISLAIALLSAGSAAAQESGQHFWSGDWYLSVGVAGFSAPKFEGSSHNEFKFSPLISVGRQGAGPRFSSRNDNPSFALIDKGAFRAGIVGRFVPSRDDGDGSELKGLKKVKWGAEAGGFVEVYPTDFLRARAEVRQGIRSHDGIVADLAVDAFTDIAPDLQLSGGPRATFATSGYYDAYYGVNAKQAAASGLDPYKPSSGIQSYGAGAALTWKATENLSASSFLEYKRLAGPAADSSLVRDRGSKNQVLIGVSATYKFNFSLQ
>NZ_CP022564.1|WP_094086610.1|2193281_2193863_-|histidine-phosphatase-family-protein
MSSAFPEIYLVRHGETDWSLSGRHTGRSDIPLTANGEAAARKLADRLAGLSFSAVWSSPSERARKTCTLAGFGSGAVIKDDLAEWDYGAYEGITTKAILADRPGWQLFRDGCPKGEFAADVGDRADAVIGGLRQTAGTILIFSSSHFLRVLAARWLGLPPEDGSRFVLDTASISVLGYEHDLTEPVIRRWNQR
>NZ_CP022564.1|WP_094086611.1|2193930_2195190_-|class-I-SAM-dependent-methyltransferase
MASAFLSIVQQIVRKGSLKLTLANGETHIIGDGTGEPVVARLADQEAEDAIRRDPTMKLGEMYMQGRFILEQGNIYDFLSLVKQNTTNEIFDFKMAALLLGRIAWQQLKNRVPVNRNKHNVAHHYDLSAKLFDLFLDEDWQYSCAYFEPPGIGLDEAQLAKKRHIAAKLLLAPNQRILEIGSGWGGMGMYLTEATEGAEFTGITLSEEQLKVSRTRAEKRGLADRVRFELQDYRTMTGRKFDRIVSVGMFEHVGIGHYGNFFRKVSDLLDDNGVMVLHSIGRPKPSFGTNAFIEKYIFPGGYIPSVGEVVPPLEKAGLLVKDIEILPLHYAYTLRHWRERFVARKAEAVALYDEQFFRMWEFYLAGSEMGFRWDELFILQIQIAKNQFAVPDNRSYIARNEAKLKEFEARRAPLEKVTF
>NZ_CP022564.1|WP_094086612.1|2195323_2197633_-|RNA-binding-transcriptional-accessory-protein
MAADLRFLAARISAEINARPEQAKAAIELLDEGATVPFIARYRKEVTGGLDDTQLRNLAERLVYLRELEARRDAIVESITGQGKMTDELMTKVAGAETKAELEDLYLPYKPKRRTRAEIARERGLGPLAETILADRAREPAMLAEGFITADVPDVKTALEGARDIIAEGIAENADLLGKLRAHMRQAALLKAKIVDGKQATGEKFSDYFDHSERWATAPGHRALAMLRGWNEEVLTLTIEADAETASPNKPVERMIVAAYEIGTSRPGDRWLMEVASWTWRVKLSMSLSLDLMRELRERAEEEAIHVFARNLKDLLLAAPAGSRATMGLDPGIRTGVKVAVVDGTGKVVATSTVYPFQPRNDVRGAQVELASLVRKHNVELISIGNGTGSRETEKLVADMLAELPAPKPTKVIVSEAGASVYSASATAAAEFPDLDVSLRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVDQQKLSRSLDAVVEDAVNAVGVDLNTASAPLLSRVSGLGPSIADAIVRHRDSEGRFETRKDLLKVARLGGRTFEQCAGFLRIPNGKEPLDSSSVHPEAYGVAKKIVAACGRDLRALMGDSAVLKSVDPRQFIDEKFGLPTVRDIIAELEKPGRDPRPSFKTATFAEGVNEISDLTPGMVLEGTVTNVAAFGAFVDIGVHQDGLVHVSQLADRFVKDPHEVVKAGDVVKVRVVEVDAKRKRIALSMKRDDGSSASPPRGDSRGSQGSRPQNERRPAAQKAESQGAFGAALAEAMKRK
>NZ_CP022564.1|WP_094086613.1|2198048_2200223_+|glycine--tRNA-ligase-subunit-beta
MPNLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLSYEGAREYWTPRRLALDIHGLTARSADVREERKGPRTDANEKAIEGFLRGAGLSSVSEAQVMSDPKKGDFYVAVISKPGRATEEIVSDVMPGIIRDFPWPKSMRWGKASSKPGALRWVRPLQSIVCTFGPEHEETTVIPFEIDGITASNITYGHRFHAPEAITVRRFDDYAANLEKAKVILDAERRKDIILHDARDIAFANGLELVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIPSEIIRLTIKTNQKCFVTRASGSETLSNKFILVSNIQASDGGKEIVHGNGKVVRARLSDALHFWKRDQGDLPDLETLTASAAKFGLDIKKPLDQRMAKLDALDVTFHAKLGTQGARVARIRALAKELAGITGADSALVDRAAVLAKADLRTEAVGEFPELQGLMGRKYAVLQGENASVAAAIEDHYKPQGPSDRVPEDKVAITIALADKLDTLIGFWAIDEKPTGSKDPFALRRAALGVVRILLERRIRLPLLASLIGVAFDAKVLGTEKIEVTGEAISDLLSFFHDRLRVYLRDQGARHDLIDAVLTPDADDLLMVARRVEALTAFITSEDGKNLLSGTKRATQLLAAEEKKGTVIADGVSPALLKLDAEKELFAAISSASKDASGAVAGEDFRSAMEALSKLRGPVDRFFEEVLVNDEDAAIRANRLALLRLIREATGTVADFSKISG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022564_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022564_3

2231657-2231738

Orphan

Consensus_repeat	Method
ATGCATGCCTTTATCCCGGAACCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022564_3

>merge|NZ_CP022564|3|2231657-2231738|CRISPRCasFinder
ATGCATGCCTTTATCCCGGAACCGCTTCACACTTCCGGGCGGCATGCATTTGTTGTGATGCATGCCGTTATCCCGGAACCGC

>NZ_CP022564|3|2|2231657-2231738|CRISPRCasFinder
ATGCATGCCTTTATCCCGGAACCGC	TTCACACTTCCGGGCGGCATGCATTTGTTGTG
ATGCATGCCGTTATCCCGGAACCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022564.1\|WP_017959169.1\|2238817_2239429_+\|PRC-barrel-domain-containing-protein	unknown	unknown	gnl\|CDD\|368352
NZ_CP022564.1\|WP_094086630.1\|2222972_2223662_+\|ribonuclease-HII	unknown	unknown	gnl\|CDD\|234574
NZ_CP022564.1\|WP_094086632.1\|2226786_2228016_-\|cell-wall-hydrolase	unknown	unknown	gnl\|CDD\|226296
NZ_CP022564.1\|WP_017959180.1\|2226176_2226515_-\|F0F1-ATP-synthase-assembly-protein	unknown	unknown	gnl\|CDD\|227641
NZ_CP022564.1\|WP_094086633.1\|2228412_2230311_-\|potassium-transporter-Kup	unknown	unknown	gnl\|CDD\|225700
NZ_CP022564.1\|WP_017959170.1\|2237698_2238586_+\|SMP-30/gluconolactonase/LRE-family-protein	unknown	unknown	gnl\|CDD\|225921
NZ_CP022564.1\|WP_094086635.1\|2234462_2235260_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP022564.1\|WP_094086629.1\|2221596_2222754_+\|PA0069-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
NZ_CP022564.1\|WP_003545854.1\|2225066_2225294_-\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|181027
NZ_CP022564.1\|WP_094086638.1\|2241020_2242742_-\|response-regulator	unknown	unknown	gnl\|CDD\|381099
NZ_CP022564.1\|WP_094086636.1\|2236129_2237047_+\|2-dehydro-3-deoxygalactonokinase	unknown	unknown	gnl\|CDD\|226257
NZ_CP022564.1\|WP_094086637.1\|2237060_2237702_+\|2-dehydro-3-deoxy-6-phosphogalactonate-aldolase	unknown	unknown	gnl\|CDD\|181670
NZ_CP022564.1\|WP_043294413.1\|2235368_2236130_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP022564.1\|WP_017959181.1\|2225361_2226114_-\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|235617
NZ_CP022564.1\|WP_077976597.1\|2224365_2224989_-\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|169692
NZ_CP022564.1\|WP_017959168.1\|2239501_2240866_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|227334
NZ_CP022564.1\|WP_172426301.1\|2230329_2231328_-\|magnesium-transporter-CorA-family-protein	unknown	unknown	gnl\|CDD\|213371
NZ_CP022564.1\|WP_043294414.1\|2233475_2234210_-\|LuxR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225360
NZ_CP022564.1\|WP_094086634.1\|2231761_2232934_-\|Mrp/NBP35-family-ATP-binding-protein	unknown	unknown	gnl\|CDD\|378455
NZ_CP022564.1\|WP_094086631.1\|2223870_2224362_-\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|169691

Protein	Function_ID	Function_description	E-value
NZ_CP022564.1\|WP_017959169.1\|2238817_2239429_+\|PRC-barrel-domain-containing-protein	gnl\|CDD\|368352	pfam05239, PRC, PRC-barrel domain. The PRC-barrel is an all beta barrel domain found in photosystem reaction centre subunit H of the purple bacteria and RNA metabolism proteins of the RimM group. PRC-barrels are approximately 80 residues long, and found widely represented in bacteria, archaea and plants. This domain is also present at the carboxyl terminus of the pan-bacterial protein RimM, which is involved in ribosomal maturation and processing of 16S rRNA. A family of small proteins conserved in all known euryarchaea are composed entirely of a single stand-alone copy of the domain.	1.19087e-10
NZ_CP022564.1\|WP_094086630.1\|2222972_2223662_+\|ribonuclease-HII	gnl\|CDD\|234574	PRK00015, rnhB, ribonuclease HII; Validated.	9.56592e-104
NZ_CP022564.1\|WP_094086632.1\|2226786_2228016_-\|cell-wall-hydrolase	gnl\|CDD\|226296	COG3773, SleB, Cell wall hydrolyses involved in spore germination [Cell envelope biogenesis, outer membrane].	9.02967e-85
NZ_CP022564.1\|WP_017959180.1\|2226176_2226515_-\|F0F1-ATP-synthase-assembly-protein	gnl\|CDD\|227641	COG5336, COG5336, Uncharacterized protein conserved in bacteria [Function unknown].	7.69783e-38
NZ_CP022564.1\|WP_094086633.1\|2228412_2230311_-\|potassium-transporter-Kup	gnl\|CDD\|225700	COG3158, Kup, K+ transporter [Inorganic ion transport and metabolism].	0
NZ_CP022564.1\|WP_017959170.1\|2237698_2238586_+\|SMP-30/gluconolactonase/LRE-family-protein	gnl\|CDD\|225921	COG3386, COG3386, Gluconolactonase [Carbohydrate transport and metabolism].	5.57366e-86
NZ_CP022564.1\|WP_094086635.1\|2234462_2235260_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	1.97525e-67
NZ_CP022564.1\|WP_094086629.1\|2221596_2222754_+\|PA0069-family-radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	1.15715e-22
NZ_CP022564.1\|WP_003545854.1\|2225066_2225294_-\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|181027	PRK07558, PRK07558, F0F1 ATP synthase subunit C; Validated.	7.89276e-27
NZ_CP022564.1\|WP_094086638.1\|2241020_2242742_-\|response-regulator	gnl\|CDD\|381099	cd17546, REC_hyHK_CKI1_RcsC-like, phosphoacceptor receiver (REC) domain of hybrid sensor histidine kinases/response regulators similar to Arabidopsis thaliana CKI1 and Escherichia coli RcsC. This family is composed of hybrid sensor histidine kinases/response regulators that are sensor histidine kinases (HKs) fused with a REC domain, similar to the sensor histidine kinase CKI1 from Arabidopsis thaliana, which is involved in multi-step phosphorelay (MSP) signaling that mediates responses to a variety of important stimuli in plants. MSP involves a signal being transferred from HKs via histidine phosphotransfer proteins (AHP1-AHP5) to nuclear response regulators. The CKI1 REC domain specifically interacts with the downstream signaling protein AHP2, AHP3 and AHP5. The plant MSP system has evolved from the prokaryotic two-component system (TCS), which allows organisms to sense and respond to changes in environmental conditions. This family also includes bacterial hybrid sensor HKs such as Escherichia coli RcsC, which is a component of the Rcs signalling pathway that controls a variety of physiological functions like capsule synthesis, cell division, and motility. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	5.84278e-36
NZ_CP022564.1\|WP_094086636.1\|2236129_2237047_+\|2-dehydro-3-deoxygalactonokinase	gnl\|CDD\|226257	COG3734, DgoK, 2-keto-3-deoxy-galactonokinase [Carbohydrate transport and metabolism].	1.39795e-118
NZ_CP022564.1\|WP_094086637.1\|2237060_2237702_+\|2-dehydro-3-deoxy-6-phosphogalactonate-aldolase	gnl\|CDD\|181670	PRK09140, PRK09140, 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed.	2.57669e-113
NZ_CP022564.1\|WP_043294413.1\|2235368_2236130_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.78069e-62
NZ_CP022564.1\|WP_017959181.1\|2225361_2226114_-\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|235617	PRK05815, PRK05815, F0F1 ATP synthase subunit A; Validated.	4.03761e-64
NZ_CP022564.1\|WP_077976597.1\|2224365_2224989_-\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|169692	PRK09174, PRK09174, F0F1 ATP synthase subunit B.	3.35772e-89
NZ_CP022564.1\|WP_017959168.1\|2239501_2240866_-\|EAL-domain-containing-protein	gnl\|CDD\|227334	COG5001, COG5001, Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms].	7.26758e-112
NZ_CP022564.1\|WP_172426301.1\|2230329_2231328_-\|magnesium-transporter-CorA-family-protein	gnl\|CDD\|213371	cd12837, EcCorA-like_u1, uncharacterized subgroup of the Escherichia coli Mg2+ transporter CorA_like subfamily. A uncharacterized subgroup of the Escherichia coli CorA-Salmonella typhimurium ZntB_like family (EcCorA_ZntB-like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. The EcCorA_ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA_ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	3.60063e-155
NZ_CP022564.1\|WP_043294414.1\|2233475_2234210_-\|LuxR-family-transcriptional-regulator	gnl\|CDD\|225360	COG2771, CsgD, DNA-binding HTH domain-containing proteins [Transcription].	5.88197e-20
NZ_CP022564.1\|WP_094086634.1\|2231761_2232934_-\|Mrp/NBP35-family-ATP-binding-protein	gnl\|CDD\|378455	pfam10609, ParA, NUBPL iron-transfer P-loop NTPase. This family contains ATPases involved in plasmid partitioning. It also contains the cytosolic Fe-S cluster assembling factor NBP35 which is required for biogenesis and export of both ribosomal subunits.	2.75748e-146
NZ_CP022564.1\|WP_094086631.1\|2223870_2224362_-\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|169691	PRK09173, PRK09173, F0F1 ATP synthase subunit B; Validated.	3.11812e-71

>NZ_CP022564.1|WP_172426301.1|2230329_2231328_-|magnesium-transporter-CorA-family-protein
MQPERRPVITAYCSNCRSVEIRDLSHAASFPEDVVWIDMIEPTRDEELYVEKILGIEVPTRDDLKDIEPSARLYVENDAVFMTASLLWKADTDVPTLTDVAFILAGNRLVTIRYAHPKSFALFIAALHRLPENWRSGAALLAKLLETIVDRTAEILEISVSRIDILSTHVFGDRAKKVRKPSNYLEEKLRDIAGHHRMISKVRDSLGSLSRLLTFFHTIPAIQQDREAKELCRTVSRDIQSLSEHASFVAANITFLLDASLGLINIEQNSIIKIFSIASVVFLPPTLVASVYGMNFQVMPELTWAAGYPYSLALMVISAVIPFFFFRWKGWL
>NZ_CP022564.1|WP_094086633.1|2228412_2230311_-|potassium-transporter-Kup
MSEESHPNESHMTPRKLFYLSLGSVGVVYGDIGTSPLYAFREALKPVAHDGVTRFEVISLISLMIWALTIIVTIKYVLFLLRADNDGEGGTLSLLALLMKTANGHTAMLMLLGLMGAALFLGDAMITPALSVLSAVEGLKLVTPSLADYIVPISVVILALLFVVQSRGTGAVARFFGPITAVWFLVMAAAGISHISDDYGILAAFNPYYAVSFLLHEGFYGVVVLGAVFLTVTGAEALYADLGHFGRRPIQWAWFLLVFPALTLNYLGQGALVLGNPATMSDPFYLMFPKWALLPVVILATAATIIASQAVITGAFSMVRQGINLGFLPRMEILFTSETNTGQIFVPSVNAVLFIGVIFLVLSFKTSDALATAYGISVTGAMVVTSIMAFEFVRARWNWSLPVAMIALVPLVVLELIFLGANLLKIHDGGYIPILIATAFTVVMWTWRRGTAILMEKTRHTDIPLASFVSSIERKSDHSPAQVPGTAIFLTSDPESAPAALLHNLKHNHVLHDRNVILTIRTINKPRVPSHDRYRVEQISERFSRVELLFGFMESQNVSQALATLRKTGLKFDIMSTSFYLGRRKLVPDAKSGMPYWQDRLYIALANAAANPSDYFRLPANRVVELGSHVII
>NZ_CP022564.1|WP_094086632.1|2226786_2228016_-|cell-wall-hydrolase
MECSRVPCPESVLRRKSPSRSKLRLIPENWVSPAIFGLAGWLIFPSVASHADLAAMLAGLDHEGENWRMVLTNSPAGSIHQAELAFAEPMVTASISAGAGMVLPDGRKVAFNTKDKGTAKDRGHEDTPDEDRVNRGSKKGRVVAVEKMQPPKDFSAGSILERTKMLFTPSFDLKDRSAFVKPKIQGKEIEIATSFYKTQPVVTDIGVPAMLASLVTSNKADVLATAYAPAAPDYARQSPFDSILTEQDSGRFVPEIGPRDHAWAASVLAPSVFSAREQQCLASGIYFEARGESVKGQAAVAQVILNRVRNPSYPKTICGVVYQNEDWRNRCQFSFACDSIKDRVNSEYHWRVARDVAMAVTSGKIWLPQVGSATHYHAVYVRPKWAKTMEKVGRIGLHVFYRTHGGGWS
>NZ_CP022564.1|WP_017959180.1|2226176_2226515_-|F0F1-ATP-synthase-assembly-protein
MADDREESLEKRRAQLEAKLATKRVETGQDEAREARAEVSRKGYAQAMKLSSEFISAIVVGALLGYVLDRFVGTAPWGLIVLLLLGFCAGVLNVLRSAGVVAHPLDDKDDKK
>NZ_CP022564.1|WP_017959181.1|2225361_2226114_-|F0F1-ATP-synthase-subunit-A
MSNDPTHQFLIQKIVPIEIGGIDFSFTNASLFMAVSAAAAAGFLYFSTSNRAIVPGRSQSVAEMSYEFIANMLKEGAGKQGMKFFPLVFSLFMFVLTANLLGMFPYFFTVTSQIIVTFALAILVIGTVLVYGFYKHGFHFLNVFVPSGVPGILLPLVVTIEIISFLSRPISLSVRLFANMLAGHITLKVFAGFVASLGTMGALGIGGAVLPLIMTVALTGLEFLVAFLQAYVFAVLTCMYLNDAIHPGGH
>NZ_CP022564.1|WP_003545854.1|2225066_2225294_-|F0F1-ATP-synthase-subunit-C
MEAEAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIFSLLVALLLLFAV
>NZ_CP022564.1|WP_077976597.1|2224365_2224989_-|F0F1-ATP-synthase-subunit-B
MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGPFPPFDSTTYASQLLWLVITFGVFYLLMQKVIAPRIGAILDQRHTRISQDLEEAGRLKAEADAAVQTYEGELAAARAKSNAIGSAARDAAKAKAEEERRAVEASLSEKIKAAELRIGEIKAKAFADVGTIAEETAAAVVDQLIGGTVAKADVAAAVAAAKKEA
>NZ_CP022564.1|WP_094086631.1|2223870_2224362_-|F0F1-ATP-synthase-subunit-B
MEFAFDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEYQRKRKEAEAEAAHIVAAAEREAEMLTAEAKKKTEEFVANRTALSEQKIKQAEVEAMKAVRSAAVDLAIAAAEAVLAKRADTKIQSELFGNAVGQVKTRLN
>NZ_CP022564.1|WP_094086630.1|2222972_2223662_+|ribonuclease-HII
MKPRTPPDSPLLFDMAPLVPDFRLELKARKAGHWPVAGADEAGRGPLAGPVVAAAVILDPKRIPEGLNDSKQLSAQRREELFVQILATATVSIASSSSTRIDETDIRKASLDAMRRAICSLAIPASYVLTDGLDVPPGLDCPGQAVVKGDARSVSIAAASIVAKVTRDRMMARAHSVFPDYGFAAHVGYGTAQHRAGIERHGPCSLHRMSFRPLRKTEDGPETDELLSE
>NZ_CP022564.1|WP_094086629.1|2221596_2222754_+|PA0069-family-radical-SAM-protein
MREQSLAGQAAFAPANTADIADAMIVSSGLRVEVDRRRGRGAGLNPTGRFEPLQRETVDDGWQTWEELPPFKTEVQVEKPRTAITRNESPDLSFDRSINPYRGCEHGCIYCFARPTHAYMGLSAGLDFETKLFAKPDAAKLLERELAKPGYKVRVIAIGTNTDPYQPIEKEWRIMRGILEVLNKANHPVSIVTKSAMILRDLDILQEMAAKNLARVGISLTTLDRKLARTMEPRAATPPRRLETIRILAGAGIQTAVMAAPLIPALNDHELERILESAKAAGAAEASYVILRLPLEVSPLFRDWLLQHYPDRYRHVMSLVRSMRGGKDYDAEFGKRMKGAGPYAWQIARRFEMAARRFELTRRSVPLRDDLFVPPDGSGVQLSLL
>NZ_CP022564.1|WP_094086634.1|2231761_2232934_-|Mrp/NBP35-family-ATP-binding-protein
MADVTKEQVLETLKTVRGPDLEHDIVELGMVSDVFISDGKVYFSITVPADRARELEPMRLAAERVIKEMPGVKGALVTLTADKKAAAAAPAARPNPPHGHAGHDHQHDHASHAHAPQQPPRAGKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGILDADIYGPSMPRLLKISGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQSALLQMLREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPVLGIVENMSYFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNIRETSDAGTPLVASEPNGVVAGIYRGIAAKVWEQVAGQSQRPAPTIVFE
>NZ_CP022564.1|WP_043294414.1|2233475_2234210_-|LuxR-family-transcriptional-regulator
MAPLSQTSTEEDDYVQEIAGLKTQFDIFRFMKRVTEAYRSRAFMVLNLPPITSFDLQGSTVITSWPAELLALYDQEGLMVNSPVLRRLRTSARPFFYDMSRHNLSRDDGKSILVASLFERFKMMRCAYFPTHDPSGLRGAVSFAGDREPFSPAEMRELSYIAIHVFDRLAEIRNLDTRMTDTLTDREIDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLIK
>NZ_CP022564.1|WP_094086635.1|2234462_2235260_-|IclR-family-transcriptional-regulator
MSSNGENTTPARETGTLGKLMVLLDLVTHADAPLRFTDILALAGQPRGTLHRQLTHLVEEGLLELDGDGRYAPGLRLLDFAARSWARNEFRLIAEPHLRDLQRATGETVHLGVLRGQSIIYLDKVEGRQPVRMYSQIGNASPCYCTGVGKAALSLLPAESLVDLLAGLSFTSFTASTHVSAETLLAEIREIADQGYAFDREEHEAGIRCVAAPVWSEDRTFMGGISITGPAYRLSMELLHQWSVPVQLAAASIMEGMRVRLGPRR
>NZ_CP022564.1|WP_043294413.1|2235368_2236130_+|SDR-family-oxidoreductase
MAAQFPEFKDRAVLVTGGGSGIGAAIVEGFARQGAKVSFIDIAEAAGRELAERLSRETAHPVSFYHADLRDIAAIRRTVDTVIASSGPIRVLVNNAAWDDRHEFDAVTEAYWDNNQAVNLKHVFFTSQAVVPSMRSAGGGAIINMSSIAFKLNMGGFPAYAAAKAAVVGLTKSMAGRLGPENIRVNCILPGMVVTERQMQHWLTEESIARSVEDQCLKVALKPDAIVGPCLFLASDCAAAMTAQSLIVDGGVL
>NZ_CP022564.1|WP_094086636.1|2236129_2237047_+|2-dehydro-3-deoxygalactonokinase
MTNPAYVAVDWGTSSFRLWLIGRDGTVLAERRSGEGMTSAAKTGFSAVLAGHLAAIEAPENLPVIVCGMAGARQGWVEAGYIDVPAPLASILTGAVSVPGESRDIRILPGLAQREMARPDVMRGEETQLLGALGRASSGAQAVCMPGTHSKWVHVTDSKVTGFSTFMTGELFDVISKHTILSHAVAGAEEQPADAAAFEVAVSAAFARPALASNLLFAARSGQLLHAISAAAAQARLSGTLIGLEIAGALQDAANGTTITLVASGRLQALYEQAFRTLSLAFTAIDADAAVRRGLSAAAVAIWPN
>NZ_CP022564.1|WP_094086637.1|2237060_2237702_+|2-dehydro-3-deoxy-6-phosphogalactonate-aldolase
MNRIPFPDMKRPLIAILRGIRPDETESVVGALIDNGLTAIEIPLNSPEPFKSIEIAAKMAPAEVLIGAGTVLTVEAVDSLHAAGGKLLVTPNVEPEVIIRAREYGMVTMPGVFTPTEALAAAGAGATGLKFFPASVLGPSGITAIRAILPPELTIAAVGGVSDKNFGDYTKAGIFAFGLGTSIYKPGMTASEVAERAKATIYAYDAAIGSVNI
>NZ_CP022564.1|WP_017959170.1|2237698_2238586_+|SMP-30/gluconolactonase/LRE-family-protein
MTDIYEFEGKTLCNTNSVLGEGPTYDPDSNTVWWFNILGKELHELNLSTSEKKVHPLPVMASVLARIDAGRQLIATEEGLFVRDIASGNLTFYAALENDRPENRSNDGRTHPSGALWIGTMSKRAENQAGAIYHVASGKVTKIFNGISIPNSICFSPDGTVGYYTDSRINRLMRVMVDPLTGLPSGEPIVLVDSMDDPGSIDGSVVDADGYLWNARWGAGAVDRYSPDGLRISRYMVPAVQPSCPAFIGVNADRLAVTTAWEGLDEDARSAQPSAGALLELGIDVKGVFDPVYVI
>NZ_CP022564.1|WP_017959169.1|2238817_2239429_+|PRC-barrel-domain-containing-protein
MTRKLLTTVAAGALFATAFAPAAFSQTAPQPADPAAPTQAAPADPAAPKPMTPDVTKPAGDAAQAPAAAPTADTAQAAYLTEQAPDQVSANTYIGQSVYNGNNESIGSVNDLIMKKDGGMVAAIVGVGGFLGIGEKNVAVPMEKITVAQNTQDGSVKLTTSETAESLKAAPEFKTLAMLAAEKAPAPAATGTDTTATGSTTPK
>NZ_CP022564.1|WP_017959168.1|2239501_2240866_-|EAL-domain-containing-protein
MMKSADIAFLTVGQNELQAMAYTDPLTGLGNRNRMRDKVLQISSERASDPAPFTIGIVNLDSFKPINDLFGSTAGDEILCQVAHRLRACIPDGALVTRHDGDEFAFVLPLIFERASAEKFGQMIREVLSAPYDLGDRNVRLSASLGFSIYPFAGEDCEELLKSAETALYRSKRRGRGQITVYSREIAQEMKRATQLEQALRNAIISDAIDVHFQPIVSLSNNQVVGFEALARWNDPDLGFVSPGVFVPLAEERGFIDALSEALLRKAAEAALSWPRELFLSFNLSSAQLMDPGTSSSVLSILGRVGFDPHRLELEITETAVMSSADTAHRIIADLRAAGVRISLDDFGTGQSSLGRLRDFIFDKIKIDRAFVSRINSDRASEHIIKAILTMCEGLELEVVAEGIEDYAEAVKLRTLGCGMGQGYHFGRPADGIATLRFLHENYYDPTMMERASA
>NZ_CP022564.1|WP_094086638.1|2241020_2242742_-|response-regulator
MSAGFEKADTSSEMDGAPAEADLQTALFDVVCDSLSAAFIIYDKNDHLIFASRQTLDFFPLPAEMLKPGTRLRDFLGAMYDTGIRQQFDVRQGGSLSREDWLSQKIASHWRERFDAVERHGADSWVRFVKRRLPGGYGVTIISDISENKKREEQWRSDLERVQLTEDILDNLPFPLFVKDRNLTYVAVNLAFCEKYQTSADEVLGRKSGDLFSEEIAKRFEESDRHVLETGEMSVSRQRQISRDGIERDIVSRKHRIGKPGRYFLVSTMQDLPRDGADLDEFGQASAITASSNQSYRRAYVPVPTGIARREPAAMEAIVPENFSGRKVLVVTADLAAETAALRTLTKYGFESCSVRGEDEEERFLEIATSSGISLDLLIIDNQMGMRCLELAEQYGIPALVMDGFQIANELTFQIARHFNRNSRSAAGSDADWEISISDDPVGLQILVAEDNDINQIVFSQILEGLGYRHMLAATGDEAVRLWAEHRPQIVLMDISLPGFNGFEAARLIRQMEETGGGTRTPIIGVLTQAFERDRAECVKSGMDDVIMKPVSPDMLETIFQKYLMNEAMRAQN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_AP022607	Mycobacterium branderi strain JCM 12687 plasmid pJCM12687	228336-228363	2	0.929
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	578195-578222	3	0.893
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	928234-928261	3	0.893
NZ_CP022564_1	1.2\|2090769\|28\|NZ_CP022564\|CRT	2090769-2090796	28	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	687279-687306	5	0.821
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP014580	Burkholderia sp. OLGA172 plasmid pOLGA1, complete sequence	266140-266167	5	0.821
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	331462-331489	5	0.821
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	1628534-1628561	5	0.821
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	KR053194	Gordonia phage GAL1, complete genome	12310-12337	5	0.821
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1344539-1344566	5	0.821
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	352880-352907	5	0.821
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP032687	Rhizobium sp. CCGE531 plasmid pRCCGE531b, complete sequence	408264-408291	5	0.821
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP032688	Rhizobium sp. CCGE531 plasmid pRCCGE531a, complete sequence	277920-277947	5	0.821
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	131555-131582	5	0.821
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	555220-555247	5	0.821
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	419517-419544	5	0.821
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	493390-493417	5	0.821
NZ_CP022564_1	1.2\|2090769\|28\|NZ_CP022564\|CRT	2090769-2090796	28	NZ_CP023450	Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence	76509-76536	6	0.786
NZ_CP022564_1	1.2\|2090769\|28\|NZ_CP022564\|CRT	2090769-2090796	28	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	826491-826518	6	0.786
NZ_CP022564_1	1.2\|2090769\|28\|NZ_CP022564\|CRT	2090769-2090796	28	NZ_CP010956	Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence	74743-74770	6	0.786
NZ_CP022564_1	1.2\|2090769\|28\|NZ_CP022564\|CRT	2090769-2090796	28	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	986637-986664	6	0.786
NZ_CP022564_1	1.2\|2090769\|28\|NZ_CP022564\|CRT	2090769-2090796	28	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	257612-257639	6	0.786
NZ_CP022564_1	1.2\|2090769\|28\|NZ_CP022564\|CRT	2090769-2090796	28	MH155867	Gordonia phage Easley, complete genome	33589-33616	6	0.786
NZ_CP022564_1	1.2\|2090769\|28\|NZ_CP022564\|CRT	2090769-2090796	28	NC_008759	Polaromonas naphthalenivorans CJ2 plasmid pPNAP03, complete sequence	146216-146243	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	928360-928387	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	670995-671022	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	464832-464859	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	506702-506729	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1197100-1197127	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2343250-2343277	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	47048-47075	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	1458828-1458855	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	637815-637842	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	616437-616464	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	627937-627964	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	480685-480712	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	537273-537300	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	CP051288	Salmonella phage ST-29, complete genome	33429-33456	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	775790-775817	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1389704-1389731	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	25152-25179	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	741033-741060	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	MK373773	Escherichia phage vB_EcoP_KAW1A4500, complete genome	28033-28060	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	KY295899	Escherichia phage vB_EcoP_R, complete genome	42072-42099	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NC_047807	Escherichia phage vB_EcoP_C, complete genome	19204-19231	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	MK814759	Gordonia phage Reyja, complete genome	14349-14376	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	KY295891	Escherichia phage vB_EcoP_B, complete genome	38097-38124	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	KY435490	Escherichia virus K1E, complete genome	14545-14572	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	KY295893	Escherichia phage vB_EcoP_D, complete genome	40483-40510	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	AM084415	Enterobacteria phage K1E, complete genome	28973-29000	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	AY370674	Enterobacteria phage K1-5, complete genome	27402-27429	6	0.786
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NC_047889	Escherichia virus mutPK1A2, complete genome	27944-27971	6	0.786
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	132219-132250	6	0.812
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	457543-457574	6	0.812
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	281522-281553	6	0.812
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	975709-975740	6	0.812
NZ_CP022564_1	1.2\|2090769\|28\|NZ_CP022564\|CRT	2090769-2090796	28	NZ_CP012383	Streptomyces ambofaciens ATCC 23877 plasmid pSAM1, complete sequence	62081-62108	7	0.75
NZ_CP022564_1	1.2\|2090769\|28\|NZ_CP022564\|CRT	2090769-2090796	28	CP000385	Mycobacterium sp. MCS Plasmid1, complete sequence	133331-133358	7	0.75
NZ_CP022564_1	1.2\|2090769\|28\|NZ_CP022564\|CRT	2090769-2090796	28	NC_008704	Mycobacterium sp. KMS plasmid pMKMS02, complete sequence	159390-159417	7	0.75
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	548263-548290	7	0.75
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	125147-125174	7	0.75
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	294839-294866	7	0.75
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	424988-425015	7	0.75
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NC_008759	Polaromonas naphthalenivorans CJ2 plasmid pPNAP03, complete sequence	146216-146243	7	0.75
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP030128	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence	308591-308618	7	0.75
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1393833-1393860	7	0.75
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	KY798216	Mycobacterium phage Journey13, complete genome	24096-24123	7	0.75
NZ_CP022564_1	1.4\|2090868\|28\|NZ_CP022564\|CRT	2090868-2090895	28	EF057797	Vibrio phage VP882, complete genome	18797-18824	7	0.75
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013553	Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence	132399-132430	7	0.781
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013586	Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence	137764-137795	7	0.781
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013538	Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence	126290-126321	7	0.781
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013564	Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence	132399-132430	7	0.781
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	667883-667914	7	0.781
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	619457-619488	7	0.781
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	339707-339738	7	0.781
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	353737-353768	7	0.781
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	126621-126652	7	0.781
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	570440-570471	7	0.781
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	499980-500011	7	0.781
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP022566	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence	536035-536066	7	0.781
NZ_CP022564_1	1.3\|2090817\|31\|NZ_CP022564\|CRT	2090817-2090847	31	NZ_CP016084	Streptomyces sp. SAT1 plasmid unnamed4, complete sequence	77472-77502	8	0.742
NZ_CP022564_1	1.3\|2090817\|31\|NZ_CP022564\|CRT	2090817-2090847	31	KM659091	Ochrobactrum sp. LM19 plasmid pLM19O1, complete sequence	57554-57584	8	0.742
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	291101-291132	8	0.75
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	151236-151267	8	0.75
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	451023-451054	8	0.75
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	460207-460238	8	0.75
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	423818-423849	8	0.75
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	53011-53042	8	0.75
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	9646-9677	8	0.75
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	53017-53048	8	0.75
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	76555-76586	8	0.75
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	352510-352541	8	0.75
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1063682-1063713	8	0.75
NZ_CP022564_1	1.3\|2090817\|31\|NZ_CP022564\|CRT	2090817-2090847	31	MN961670	Pseudomonas putida strain 420352 plasmid p420352-IMP, complete sequence	510733-510763	9	0.71
NZ_CP022564_1	1.3\|2090817\|31\|NZ_CP022564\|CRT	2090817-2090847	31	MK496050	Pseudomonas sp. strain FFUP_PS_41 plasmid pJBCL41, complete sequence	115819-115849	9	0.71
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	291160-291191	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	303924-303955	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	291101-291132	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	310557-310588	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	475014-475045	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	305521-305552	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	303924-303955	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	310557-310588	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	475014-475045	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	447906-447937	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	456505-456536	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	461813-461844	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	182049-182080	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	182049-182080	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	180490-180521	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	184737-184768	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	178855-178886	9	0.719
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	182049-182080	9	0.719
NZ_CP022564_1	1.5\|2090916\|34\|NZ_CP022564\|CRT	2090916-2090949	34	NZ_CP015322	Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence	417458-417491	10	0.706
NZ_CP022564_1	1.5\|2090916\|34\|NZ_CP022564\|CRT	2090916-2090949	34	NZ_CP015322	Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence	270600-270633	10	0.706
NZ_CP022564_1	1.5\|2090916\|34\|NZ_CP022564\|CRT	2090916-2090949	34	NZ_CP015322	Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence	372940-372973	10	0.706
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	145522-145553	10	0.688
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	260576-260607	10	0.688
NZ_CP022564_3	3.1\|2231682\|32\|NZ_CP022564\|CRISPRCasFinder	2231682-2231713	32	NZ_CP022566	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence	147170-147201	10	0.688
NZ_CP022564_1	1.5\|2090916\|34\|NZ_CP022564\|CRT	2090916-2090949	34	MH617568	Microviridae sp. isolate ctce955, complete genome	1506-1539	11	0.676

1. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_AP022607 (Mycobacterium branderi strain JCM 12687 plasmid pJCM12687) position: , mismatch: 2, identity: 0.929

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gtcggccggcggcggcacccccagcggc	Protospacer
*******************.*****.**

2. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

gtcggccggcggcggcacctccagcagc	CRISPR spacer
ctcggccggcggcggcaccaccagcaac	Protospacer
 ****************** ******.*

3. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 3, identity: 0.893

gtcggccggcggcggcacctccagcagc	CRISPR spacer
ctctgccggcggcggcacgtccagcagc	Protospacer
 ** ************** *********

4. spacer 1.2|2090769|28|NZ_CP022564|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 5, identity: 0.821

atcggccggtggcggcacttcgagcagc	CRISPR spacer
cttgggcggtggcggcacttcgcgcagg	Protospacer
 *.** **************** ****

5. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP014580 (Burkholderia sp. OLGA172 plasmid pOLGA1, complete sequence) position: , mismatch: 5, identity: 0.821

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gtaggccggcgccggcacctccagcgcg	Protospacer
** ******** *************.

6. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 5, identity: 0.821

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gtcggccagcagcggcacctccaccgcc	Protospacer
*******.**.************ *. *

7. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 5, identity: 0.821

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gagcgccggcggcggaacgtccagcagc	Protospacer
*   *********** ** *********

8. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to KR053194 (Gordonia phage GAL1, complete genome) position: , mismatch: 5, identity: 0.821

gtcggc-cggcggcggcacctccagcagc	CRISPR spacer
-ccaacgcggcggcggcaccaccagcagc	Protospacer
 .*..* ************* ********

9. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 5, identity: 0.821

gtcgg--ccggcggcggcacctccagcagc	CRISPR spacer
--cgatcccggcggcgtcacctccagctgc	Protospacer
  **.  ********* ********** **

10. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 5, identity: 0.821

gtcgg--ccggcggcggcacctccagcagc	CRISPR spacer
--cgatcccggcggcgtcacctccagctgc	Protospacer
  **.  ********* ********** **

11. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP032687 (Rhizobium sp. CCGE531 plasmid pRCCGE531b, complete sequence) position: , mismatch: 5, identity: 0.821

gtcgg--ccggcggcggcacctccagcagc	CRISPR spacer
--cgatcccggcggcgtcacctccagctgc	Protospacer
  **.  ********* ********** **

12. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP032688 (Rhizobium sp. CCGE531 plasmid pRCCGE531a, complete sequence) position: , mismatch: 5, identity: 0.821

gtcgg--ccggcggcggcacctccagcagc	CRISPR spacer
--cgatcccggcggcgtcacctccagctgc	Protospacer
  **.  ********* ********** **

13. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 5, identity: 0.821

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gtcggccagcagcggcacctccaccgcc	Protospacer
*******.**.************ *. *

14. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.821

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gtcggccagcagcggcacctccaccgcc	Protospacer
*******.**.************ *. *

15. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.821

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gtcggccagcagcggcacctccaccgcc	Protospacer
*******.**.************ *. *

16. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 5, identity: 0.821

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gtcggccagcagcggcacctccaccgcc	Protospacer
*******.**.************ *. *

17. spacer 1.2|2090769|28|NZ_CP022564|CRT matches to NZ_CP023450 (Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.786

atcggccggtggcggcacttcgagcagc	CRISPR spacer
ctcggccggtggcggcgcttcgatcgag	Protospacer
 ***************.****** *..

18. spacer 1.2|2090769|28|NZ_CP022564|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 6, identity: 0.786

atcggccggtggcggcacttcgagcagc	CRISPR spacer
cccggccggtggcagcacgtcgagcacg	Protospacer
 .***********.**** *******

19. spacer 1.2|2090769|28|NZ_CP022564|CRT matches to NZ_CP010956 (Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence) position: , mismatch: 6, identity: 0.786

atcggccggtggcggcacttcgagcagc	CRISPR spacer
ctcggccggtggcggcgcttcgatcgag	Protospacer
 ***************.****** *..

20. spacer 1.2|2090769|28|NZ_CP022564|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 6, identity: 0.786

atcggccggtggcggcacttcgagcagc	CRISPR spacer
cccggccggtggcagcacgtcgagcacg	Protospacer
 .***********.**** *******

21. spacer 1.2|2090769|28|NZ_CP022564|CRT matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 6, identity: 0.786

atcggccggtggcggcacttcgagcagc	CRISPR spacer
ctcggccggtggcggcacctcggtgcgc	Protospacer
 *****************.***.   **

22. spacer 1.2|2090769|28|NZ_CP022564|CRT matches to MH155867 (Gordonia phage Easley, complete genome) position: , mismatch: 6, identity: 0.786

atcggccggtggcggcacttcgagcagc	CRISPR spacer
gtcggccggtggcggcgcttcgccgagg	Protospacer
.***************.*****   **

23. spacer 1.2|2090769|28|NZ_CP022564|CRT matches to NC_008759 (Polaromonas naphthalenivorans CJ2 plasmid pPNAP03, complete sequence) position: , mismatch: 6, identity: 0.786

atcggccggtggcggcacttcgagcagc	CRISPR spacer
acaggccggcggcggcacttcaagcatg	Protospacer
*. ******.***********.****

24. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cagcgccggcggcggtacgtccagcagc	Protospacer
    ***********.** *********

25. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cagcgccggcggcgggacctcaagcagc	Protospacer
    *********** ***** ******

26. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgtgcccggcggcggcacctccagcgac	Protospacer
  .* ********************..*

27. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
ttcggccggcggcggcgtctccagcccg	Protospacer
 ***************..*******

28. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gcgtaccggcggcggcaactccagcaga	Protospacer
*.  .************ *********

29. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
ttcggccggcggcggcacctgcggcgtg	Protospacer
 ******************* *.**.

30. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
ccgagccggcgcgggcacctccagcagc	Protospacer
 . .*******  ***************

31. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cagcgccggcggcggaacgtccagcagc	Protospacer
    *********** ** *********

32. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
ttcggccggcggcggcgcctgcagcgcg	Protospacer
 ***************.*** ****.

33. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gcgtaccggcggcggcaactccagcaga	Protospacer
*.  .************ *********

34. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgtgcccggcggcggcacctccagcgac	Protospacer
  .* ********************..*

35. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgtgcccggcggcggcacctccagcgac	Protospacer
  .* ********************..*

36. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgtgcccggcggcggcacctccagcgac	Protospacer
  .* ********************..*

37. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to CP051288 (Salmonella phage ST-29, complete genome) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gtcggcccgcggcggcaccgccaggttg	Protospacer
******* *********** ****

38. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gtcggccagcagcggcacctccaccgcg	Protospacer
*******.**.************ *.

39. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
ttaccctggcggcggcgcctccagcagc	Protospacer
 *   *.*********.***********

40. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cccggccagcggcggcacctcccgcccc	Protospacer
 .*****.************** **  *

41. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gaaatccgccggcggcaccgccagcagc	Protospacer
*  . *** ********** ********

42. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to MK373773 (Escherichia phage vB_EcoP_KAW1A4500, complete genome) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgccacctgcggcagcacctccagcagc	Protospacer
  * .** *****.**************

43. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to KY295899 (Escherichia phage vB_EcoP_R, complete genome) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgccacctgcggcagcacctccagcagc	Protospacer
  * .** *****.**************

44. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NC_047807 (Escherichia phage vB_EcoP_C, complete genome) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgccacctgcggcagcacctccagcagc	Protospacer
  * .** *****.**************

45. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to MK814759 (Gordonia phage Reyja, complete genome) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gacggccggcggtggcacctccacggcc	Protospacer
* **********.**********  . *

46. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to KY295891 (Escherichia phage vB_EcoP_B, complete genome) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgccacctgcggcagcacctccagcagc	Protospacer
  * .** *****.**************

47. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to KY435490 (Escherichia virus K1E, complete genome) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgccacctgcggcagcacctccagcagc	Protospacer
  * .** *****.**************

48. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to KY295893 (Escherichia phage vB_EcoP_D, complete genome) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgccacctgcggcagcacctccagcagc	Protospacer
  * .** *****.**************

49. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to AM084415 (Enterobacteria phage K1E, complete genome) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgccacctgcggcagcacctccagcagc	Protospacer
  * .** *****.**************

50. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to AY370674 (Enterobacteria phage K1-5, complete genome) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgccacctgcggcagcacctccagcagc	Protospacer
  * .** *****.**************

51. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NC_047889 (Escherichia virus mutPK1A2, complete genome) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgccacctgcggcagcacctccagcagc	Protospacer
  * .** *****.**************

52. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 6, identity: 0.812

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattggtatgg	Protospacer
* **************.******** **   *

53. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 6, identity: 0.812

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattagtcggc	Protospacer
* **************.******** **.*

54. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 6, identity: 0.812

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattattgctg	Protospacer
* **************.********  *  **

55. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 6, identity: 0.812

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattattgctg	Protospacer
* **************.********  *  **

56. spacer 1.2|2090769|28|NZ_CP022564|CRT matches to NZ_CP012383 (Streptomyces ambofaciens ATCC 23877 plasmid pSAM1, complete sequence) position: , mismatch: 7, identity: 0.75

atcggccggtggcggcacttcgagcagc	CRISPR spacer
ggcggccggtggtggcacttcgagaccg	Protospacer
. **********.***********

57. spacer 1.2|2090769|28|NZ_CP022564|CRT matches to CP000385 (Mycobacterium sp. MCS Plasmid1, complete sequence) position: , mismatch: 7, identity: 0.75

atcggccggtggcggcacttcgagcagc	CRISPR spacer
gcgcgccggcggcggctcttcgagcaga	Protospacer
..  *****.****** **********

58. spacer 1.2|2090769|28|NZ_CP022564|CRT matches to NC_008704 (Mycobacterium sp. KMS plasmid pMKMS02, complete sequence) position: , mismatch: 7, identity: 0.75

atcggccggtggcggcacttcgagcagc	CRISPR spacer
gcgcgccggcggcggctcttcgagcaga	Protospacer
..  *****.****** **********

59. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.75

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cgtgcccggcggcggcacctccagcgat	Protospacer
  .* ********************...

60. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 7, identity: 0.75

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gagttccggcggcggcgcctccagcacg	Protospacer
*    ***********.*********

61. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 7, identity: 0.75

gtcggccggcggcggcacctccagcagc	CRISPR spacer
cctcaccggcggcggcacgtccggcagc	Protospacer
 .. .************* ***.*****

62. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.75

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gtcggccgtcggcggcacctcggcgttc	Protospacer
******** ************ .    *

63. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NC_008759 (Polaromonas naphthalenivorans CJ2 plasmid pPNAP03, complete sequence) position: , mismatch: 7, identity: 0.75

gtcggccggcggcggcacctccagcagc	CRISPR spacer
acaggccggcggcggcacttcaagcatg	Protospacer
.. ***************.** ****

64. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP030128 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.75

gtcggccggcggcggcacctccagcagc	CRISPR spacer
agcggccggcgcctgcacctccagcctg	Protospacer
. ********* * ***********

65. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

gtcggccggcggcggcacctccagcagc	CRISPR spacer
gtcggccagcggcggcacctcggtctcg	Protospacer
*******.************* . *

66. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to KY798216 (Mycobacterium phage Journey13, complete genome) position: , mismatch: 7, identity: 0.75

gtcggccggcggcggcacctccagcagc	CRISPR spacer
ccttaccggcggcggcacccccggcagc	Protospacer
 .. .**************.**.*****

67. spacer 1.4|2090868|28|NZ_CP022564|CRT matches to EF057797 (Vibrio phage VP882, complete genome) position: , mismatch: 7, identity: 0.75

gtcggccggcggcggcacctccagcagc	CRISPR spacer
ccgcaccggcagcggcacctgcagcagc	Protospacer
 .  .*****.********* *******

68. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013553 (Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence) position: , mismatch: 7, identity: 0.781

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattggtccga	Protospacer
* **************.******** **.  .

69. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013586 (Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence) position: , mismatch: 7, identity: 0.781

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattggtccga	Protospacer
* **************.******** **.  .

70. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013538 (Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence) position: , mismatch: 7, identity: 0.781

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattagtccga	Protospacer
* **************.******** **.  .

71. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013564 (Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence) position: , mismatch: 7, identity: 0.781

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattggtccga	Protospacer
* **************.******** **.  .

72. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 7, identity: 0.781

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattagaggat	Protospacer
* **************.******** *  *

73. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.781

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattagaggat	Protospacer
* **************.******** *  *

74. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 7, identity: 0.781

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tacacacttccgggcgacatgcattgagcggg	Protospacer
* **************.******** . .* *

75. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 7, identity: 0.781

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tacacacttccgggcgacatgcattaagcgcg	Protospacer
* **************.******** . .*.*

76. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattaggcgcc	Protospacer
* **************.******** * .*.

77. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 7, identity: 0.781

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattagaggat	Protospacer
* **************.******** *  *

78. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 7, identity: 0.781

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacatttccgggcgacatgcattaggtcag	Protospacer
* ****.*********.******** * *  *

79. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP022566 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence) position: , mismatch: 7, identity: 0.781

ttcacacttccgggcggcatgcatttgttgtg-	CRISPR spacer
tgcacacttttgggcggcatgcattag-agcgc	Protospacer
* *******..************** *  *.*

80. spacer 1.3|2090817|31|NZ_CP022564|CRT matches to NZ_CP016084 (Streptomyces sp. SAT1 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.742

tgctgcgggctccggctcggggtctgcttcg	CRISPR spacer
cgtcccgggcttcggctcggcgtctgctggg	Protospacer
.*.. ******.******** *******  *

81. spacer 1.3|2090817|31|NZ_CP022564|CRT matches to KM659091 (Ochrobactrum sp. LM19 plasmid pLM19O1, complete sequence) position: , mismatch: 8, identity: 0.742

tgctgcgggctccggctcggggtctgcttcg	CRISPR spacer
cggctccggctccggctccgggtctggttcc	Protospacer
.* . * *********** ******* ***

82. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 8, identity: 0.75

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcggcatgcattaacaagc	Protospacer
* *********************** .. .

83. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 8, identity: 0.75

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattaggcact	Protospacer
* **************.******** * ...

84. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 8, identity: 0.75

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcgttagaggat	Protospacer
* **************.*****.** *  *

85. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcattagagaat	Protospacer
* **************.******** *  .

86. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 8, identity: 0.75

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacatgcgttagaggat	Protospacer
* **************.*****.** *  *

87. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 8, identity: 0.75

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacactttcgggcgacatgcattaggcggt	Protospacer
* *******.******.******** * .*

88. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 8, identity: 0.75

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacacttccgggcgacgtgcattagcgcgg	Protospacer
* **************.*.****** *.   *

89. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 8, identity: 0.75

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacactttcgggcgacatgcattaggcggt	Protospacer
* *******.******.******** * .*

90. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.75

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacactttcgggcgacatgcattaggcggt	Protospacer
* *******.******.******** * .*

91. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.75

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacactttcgggcgacatgcattagccgaa	Protospacer
* *******.******.******** *..* .

92. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.75

ttcacacttccgggcggcatgcatt-tgttgtg	CRISPR spacer
tgcacactttctggcggcatgcattaagccgc-	Protospacer
* *******.* *************  *..*.

93. spacer 1.3|2090817|31|NZ_CP022564|CRT matches to MN961670 (Pseudomonas putida strain 420352 plasmid p420352-IMP, complete sequence) position: , mismatch: 9, identity: 0.71

tgctgcgggctccggctcggggtctgcttcg	CRISPR spacer
tgctgctggcttcggctcggggtgccgggca	Protospacer
****** ****.*********** .    *.

94. spacer 1.3|2090817|31|NZ_CP022564|CRT matches to MK496050 (Pseudomonas sp. strain FFUP_PS_41 plasmid pJBCL41, complete sequence) position: , mismatch: 9, identity: 0.71

tgctgcgggctccggctcggggtctgcttcg	CRISPR spacer
tgctgctggcttcggctcggggtgccgggca	Protospacer
****** ****.*********** .    *.

95. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacagttccgggcggcatgcattaacaagc	Protospacer
* **** ****************** .. .

96. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacagttccgggcggcatgcattaacaagc	Protospacer
* **** ****************** .. .

97. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacagttccgggcggcatgcattaacaagc	Protospacer
* **** ****************** .. .

98. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacagttccgggcggcatgcattaacaagc	Protospacer
* **** ****************** .. .

99. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
ttcacacttccaggcgacatgcatcggagcat	Protospacer
***********.****.*******. *

100. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacagttccgggcggcatgcattaacaagc	Protospacer
* **** ****************** .. .

101. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacagttccgggcggcatgcattaacaagc	Protospacer
* **** ****************** .. .

102. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacagttccgggcggcatgcattaacaagc	Protospacer
* **** ****************** .. .

103. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
ttcacacttccaggcgacatgcatcggagcat	Protospacer
***********.****.*******. *

104. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
ttcacacttccaggcgacatgcatcggagcat	Protospacer
***********.****.*******. *

105. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
ttcacacttccaggcgacatgcatcggagcat	Protospacer
***********.****.*******. *

106. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
ttcacacttccaggcgacatgcatcggagcat	Protospacer
***********.****.*******. *

107. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
ttcagacttccggacggcatgcacctaaaggc	Protospacer
**** ********.*********..*.  *

108. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
ttcagacttccggacggcatgcacctaaaggc	Protospacer
**** ********.*********..*.  *

109. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
ttcagacttccggacggcatgcacctaaaggc	Protospacer
**** ********.*********..*.  *

110. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
ttcagacttccggacggcatgcacctaaaggc	Protospacer
**** ********.*********..*.  *

111. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
ttcagacttccggacggcatgcacctaaaggc	Protospacer
**** ********.*********..*.  *

112. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
ttcagacttccggacggcatgcacctaaaggc	Protospacer
**** ********.*********..*.  *

113. spacer 1.5|2090916|34|NZ_CP022564|CRT matches to NZ_CP015322 (Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence) position: , mismatch: 10, identity: 0.706

cgccgcagggtcgggcgacgcgaactcggcctcc	CRISPR spacer
aagcttcaggtcgcgcgccgcgaactcggcctcg	Protospacer
 . * . .***** *** ***************

114. spacer 1.5|2090916|34|NZ_CP022564|CRT matches to NZ_CP015322 (Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence) position: , mismatch: 10, identity: 0.706

cgccgcagggtcgggcgacgcgaactcggcctcc	CRISPR spacer
aagcttcaggtcgcgcgccgcgaactcggcctcg	Protospacer
 . * . .***** *** ***************

115. spacer 1.5|2090916|34|NZ_CP022564|CRT matches to NZ_CP015322 (Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence) position: , mismatch: 10, identity: 0.706

cgccgcagggtcgggcgacgcgaactcggcctcc	CRISPR spacer
aagcttcaggtcgcgcgccgcgaactcggcctcg	Protospacer
 . * . .***** *** ***************

116. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 10, identity: 0.688

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tctttgtttccgggcggcatgcatcagttgat	Protospacer
*.. ...*****************. ****

117. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 10, identity: 0.688

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tctttgtttccgggcggcatgcatcagttgat	Protospacer
*.. ...*****************. ****

118. spacer 3.1|2231682|32|NZ_CP022564|CRISPRCasFinder matches to NZ_CP022566 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence) position: , mismatch: 10, identity: 0.688

ttcacacttccgggcggcatgcatttgttgtg	CRISPR spacer
tgcacgcttccgggcgacatgcattaagcact	Protospacer
* ***.**********.******** . ...

119. spacer 1.5|2090916|34|NZ_CP022564|CRT matches to MH617568 (Microviridae sp. isolate ctce955, complete genome) position: , mismatch: 11, identity: 0.676

cgccgcagggtcgggcgacgcgaactcggcctcc	CRISPR spacer
cgcggcagggtcgggccacgcgaaaagatcgcgt	Protospacer
*** ************ *******   . * . .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

829656 : 839900

uncultured_Mediterranean_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003539661.1\|829656_830166_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	2.5e-45	59.4
WP_017960446.1\|830195_830768_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	1.8e-41	52.0
WP_094085979.1\|830810_831305_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	3.6e-25	37.2
WP_094085980.1\|831442_831721_+	hypothetical protein	NA	NA	NA	NA
WP_003539654.1\|831854_832010_+	hypothetical protein	NA	NA	NA	NA
WP_094085981.1\|832360_835198_-	DNA gyrase subunit A	A0A1B1IVS2	uncultured_Mediterranean_phage	1.0e-76	42.4
WP_012757442.1\|835434_836082_+	MarC family protein	NA	NA	NA	NA
WP_094085982.1\|836181_836694_-	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	1.2e-44	73.7
WP_094085983.1\|836978_839900_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.2

DBSCAN-SWA_2

1102733 : 1229187

125

uncultured_Mediterranean_phage(25.64%)

portal,protease,transposase,capsid,terminase,integrase,head,tail,tRNA

attL 1136000:1136021|attR 1180384:1180405

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094086090.1\|1102733_1105274_-	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	6.9e-56	48.6
WP_003539006.1\|1105319_1105667_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.4e-12	39.1
WP_094086091.1\|1105977_1106850_+	ATP-binding protein	NA	NA	NA	NA
WP_026158654.1\|1106992_1108594_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	5.1e-12	29.2
WP_011651660.1\|1108732_1109386_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	7.6e-15	33.5
WP_017960203.1\|1109382_1110156_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.2e-23	30.2
WP_017960202.1\|1110160_1111444_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.1e-97	45.6
WP_017960201.1\|1111645_1112473_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.0e-53	46.1
WP_017960200.1\|1112469_1113081_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_017960199.1\|1113132_1113324_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	2.6e-08	76.9
WP_094086092.1\|1113507_1114224_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.4e-38	47.2
WP_094086093.1\|1114220_1115078_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	4.3e-34	38.5
WP_094086094.1\|1115096_1116110_-	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	1.3e-24	42.6
WP_094086095.1\|1116221_1119461_-	SPOR domain-containing protein	NA	NA	NA	NA
WP_017960194.1\|1119505_1121263_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_065279719.1\|1121328_1122546_-	deoxyguanosinetriphosphate triphosphohydrolase	NA	NA	NA	NA
WP_017960192.1\|1122767_1123100_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	1.5e-19	47.6
WP_094086096.1\|1123222_1124014_+	exodeoxyribonuclease III	NA	NA	NA	NA
WP_026158651.1\|1124025_1124823_-	sel1 repeat family protein	NA	NA	NA	NA
WP_094086097.1\|1124842_1125313_-	hypothetical protein	NA	NA	NA	NA
WP_094086098.1\|1125541_1126822_-	transporter	NA	NA	NA	NA
WP_094086099.1\|1127222_1130066_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	2.0e-136	36.7
WP_017960187.1\|1130181_1131051_-	DUF2497 domain-containing protein	NA	NA	NA	NA
WP_172426283.1\|1131385_1132051_-	protein-L-isoaspartate O-methyltransferase	NA	NA	NA	NA
WP_085994567.1\|1132537_1132723_+	hypothetical protein	NA	NA	NA	NA
WP_094086100.1\|1133287_1133608_+	hypothetical protein	NA	NA	NA	NA
WP_017960183.1\|1134728_1135067_+	KTSC domain-containing protein	NA	NA	NA	NA
WP_017960182.1\|1135063_1135405_-	hypothetical protein	NA	NA	NA	NA
WP_017960181.1\|1135507_1135825_-	membrane protein	NA	NA	NA	NA
1136000:1136021	attL	NA	NA	NA	NA
WP_094086102.1\|1136210_1137311_+	hypothetical protein	NA	NA	NA	NA
WP_094087640.1\|1137528_1137918_-	BA14K family protein	NA	NA	NA	NA
WP_150131644.1\|1138144_1138447_-	HNH endonuclease	NA	NA	NA	NA
WP_094086104.1\|1138412_1138721_-	hypothetical protein	NA	NA	NA	NA
WP_172426284.1\|1138850_1139012_+	hypothetical protein	NA	NA	NA	NA
WP_094086105.1\|1139070_1140447_+	hypothetical protein	NA	NA	NA	NA
WP_094086107.1\|1140874_1141180_+	hypothetical protein	NA	NA	NA	NA
WP_094086108.1\|1141176_1141479_+	hypothetical protein	NA	NA	NA	NA
WP_094086109.1\|1141475_1141706_+	hypothetical protein	A0A141GEZ4	Brucella_phage	1.3e-14	51.6
WP_150131645.1\|1141894_1143598_+	hypothetical protein	NA	NA	NA	NA
WP_094086111.1\|1143727_1144291_+	hypothetical protein	NA	NA	NA	NA
WP_094086113.1\|1145430_1145682_+	hypothetical protein	NA	NA	NA	NA
WP_094086114.1\|1145761_1147012_-	SGNH/GDSL hydrolase family protein	A0A068CDE5	Rhizobium_phage	1.3e-164	76.1
WP_094086115.1\|1147004_1147268_-	hypothetical protein	A0A1J0GUZ4	Halomonas_phage	5.7e-06	40.9
WP_094086116.1\|1147305_1147647_-	hypothetical protein	NA	NA	NA	NA
WP_150131646.1\|1147881_1148265_-	hypothetical protein	NA	NA	NA	NA
WP_094086119.1\|1148261_1148858_-	lysozyme	L7TM06	Rhizobium_phage	7.0e-60	59.3
WP_094086120.1\|1148844_1149096_-	hypothetical protein	NA	NA	NA	NA
WP_094086121.1\|1149123_1149636_-	hypothetical protein	NA	NA	NA	NA
WP_094086122.1\|1149632_1149944_-	hypothetical protein	A0A0F6WBI7	Sinorhizobium_phage	7.7e-18	59.5
WP_094086123.1\|1150795_1154029_-	hypothetical protein	G8GWG0	Rhodobacter_phage	4.8e-102	33.0
WP_094086124.1\|1154079_1154556_+\|transposase	transposase	NA	NA	NA	NA
WP_094086125.1\|1154552_1154909_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_094086126.1\|1154980_1156513_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	5.6e-101	40.8
WP_094086127.1\|1156522_1156984_-	hypothetical protein	NA	NA	NA	NA
WP_094087641.1\|1156999_1157407_-	C40 family peptidase	G8GWF9	Rhodobacter_phage	1.3e-12	37.6
WP_094086128.1\|1157421_1157925_-	DUF1833 family protein	NA	NA	NA	NA
WP_094086129.1\|1157921_1158272_-	hypothetical protein	NA	NA	NA	NA
WP_094086130.1\|1158268_1161418_-\|tail	phage tail length tape measure family protein	A0A076G7H2	Sinorhizobium_phage	2.9e-59	32.2
WP_094086131.1\|1161463_1161931_+	YbjQ family protein	M4STD1	Rhodobacter_phage	7.8e-22	51.2
WP_094086132.1\|1161927_1162119_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_094086133.1\|1162139_1162490_-	hypothetical protein	NA	NA	NA	NA
WP_094086134.1\|1162513_1162948_-\|tail	phage tail protein	NA	NA	NA	NA
WP_094086135.1\|1162996_1163401_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_094086136.1\|1163401_1163893_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_094086137.1\|1163892_1164249_-\|head,tail	head-tail adaptor protein	B4UTP9	Rhizobium_phage	2.3e-13	38.7
WP_094086138.1\|1164412_1164823_-	hypothetical protein	B4UTP8	Rhizobium_phage	9.5e-32	54.7
WP_094086139.1\|1164840_1165380_-\|head,tail	phage head-tail connector protein	B4UTP7	Rhizobium_phage	1.6e-55	57.2
WP_094086140.1\|1165342_1165555_-	hypothetical protein	NA	NA	NA	NA
WP_094086141.1\|1165604_1166858_-\|capsid	phage major capsid protein	B4UTP3	Rhizobium_phage	5.7e-144	64.0
WP_094086142.1\|1166954_1167566_-\|head,protease	HK97 family phage prohead protease	B4UTP2	Rhizobium_phage	3.3e-44	57.9
WP_094086143.1\|1167562_1168819_-\|portal	phage portal protein	B4UTP1	Rhizobium_phage	7.6e-173	79.3
WP_172426285.1\|1168818_1170717_-\|terminase	terminase large subunit	A0A0U2C138	Paracoccus_phage	9.5e-159	48.7
WP_094086145.1\|1170682_1171069_-	hypothetical protein	A0A0U2C0X7	Paracoccus_phage	6.7e-11	37.8
WP_094086147.1\|1172236_1172608_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_094087642.1\|1172862_1174023_-	hypothetical protein	NA	NA	NA	NA
WP_094086148.1\|1174022_1174424_-	hypothetical protein	NA	NA	NA	NA
WP_094086149.1\|1174884_1175139_-	hypothetical protein	NA	NA	NA	NA
WP_094086150.1\|1175293_1177819_-	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_172426286.1\|1177787_1178069_-	hypothetical protein	NA	NA	NA	NA
WP_094086151.1\|1178068_1178530_-	hypothetical protein	NA	NA	NA	NA
WP_094086152.1\|1178626_1178839_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_094086153.1\|1179056_1180241_-\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	4.6e-79	42.8
WP_017960166.1\|1182238_1182553_-	hypothetical protein	NA	NA	NA	NA
1180384:1180405	attR	NA	NA	NA	NA
WP_017960165.1\|1182678_1182930_+	hypothetical protein	NA	NA	NA	NA
WP_017960164.1\|1183265_1183469_+	hypothetical protein	NA	NA	NA	NA
WP_157626479.1\|1184147_1184429_-	hypothetical protein	NA	NA	NA	NA
WP_094086154.1\|1184957_1185878_+	hypothetical protein	NA	NA	NA	NA
WP_017960160.1\|1186084_1188202_+	catalase	A0A2K9L572	Tupanvirus	4.5e-141	49.8
WP_017960159.1\|1188349_1188709_+	low affinity iron permease family protein	NA	NA	NA	NA
WP_017960158.1\|1188809_1189217_-	low affinity iron permease family protein	Q19XG2	Mycobacterium_phage	3.3e-08	40.5
WP_017960157.1\|1189558_1190650_+	PHB depolymerase family esterase	NA	NA	NA	NA
WP_017960156.1\|1190692_1190992_-	hypothetical protein	NA	NA	NA	NA
WP_051077381.1\|1191101_1193027_-	adenine deaminase	NA	NA	NA	NA
WP_017960154.1\|1193251_1194292_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017960153.1\|1194404_1195229_+	ABC transporter permease	NA	NA	NA	NA
WP_017960152.1\|1195225_1196017_+	ABC transporter permease	NA	NA	NA	NA
WP_017960151.1\|1196024_1197083_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	7.4e-20	52.7
WP_094086155.1\|1197100_1198498_+	dipeptidase	NA	NA	NA	NA
WP_094086156.1\|1198636_1199902_+	glycerate kinase	NA	NA	NA	NA
WP_172426287.1\|1199989_1200946_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_094086157.1\|1201037_1201994_-	lytic transglycosylase domain-containing protein	A0A0A0P1R1	Enterobacteria_phage	1.5e-06	35.6
WP_094086158.1\|1202215_1202938_+	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_094086159.1\|1203092_1203752_-	peroxiredoxin	NA	NA	NA	NA
WP_094086161.1\|1204045_1205044_-	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_094086162.1\|1205057_1206890_-	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_094086163.1\|1207008_1207992_-	ABC transporter permease	NA	NA	NA	NA
WP_077981205.1\|1207988_1208984_-	ABC transporter permease	NA	NA	NA	NA
WP_072638702.1\|1208980_1210519_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-15	28.9
WP_094086164.1\|1210596_1211736_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_020049643.1\|1211964_1212969_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.6e-25	31.0
WP_072638704.1\|1213054_1213642_+	ANTAR domain-containing response regulator	NA	NA	NA	NA
WP_172426288.1\|1213676_1214957_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_077981208.1\|1215437_1216706_+	NarK/NasA family nitrate transporter	NA	NA	NA	NA
WP_094086165.1\|1216723_1219174_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_017960132.1\|1219178_1219514_+	nitrite reductase small subunit NirD	NA	NA	NA	NA
WP_094086166.1\|1219514_1222172_+	nitrate reductase	NA	NA	NA	NA
WP_094086167.1\|1222209_1222887_-	HAD family hydrolase	NA	NA	NA	NA
WP_029873043.1\|1223002_1223320_-	hypothetical protein	NA	NA	NA	NA
WP_017960128.1\|1223533_1223860_+	hypothetical protein	NA	NA	NA	NA
WP_094086168.1\|1224028_1224331_+	hypothetical protein	NA	NA	NA	NA
WP_017960127.1\|1224327_1225587_+	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	1.1e-41	33.8
WP_094086169.1\|1225587_1226421_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_172426289.1\|1226519_1227179_-	cupin domain-containing protein	NA	NA	NA	NA
WP_017960124.1\|1227405_1228443_+	cysteine synthase A	NA	NA	NA	NA
WP_094086171.1\|1228449_1229187_+\|tRNA	alanyl-tRNA editing protein	NA	NA	NA	NA

DBSCAN-SWA_3

1449002 : 1459878

Cyanophage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172426291.1\|1449002_1451213_-	esterase-like activity of phytase family protein	M4SLV1	Cyanophage	1.1e-81	43.6
WP_094086268.1\|1451296_1452196_-	DMT family transporter	NA	NA	NA	NA
WP_003547346.1\|1452677_1452953_-	HU family DNA-binding protein	A0A172Q061	Acinetobacter_phage	7.1e-07	34.1
WP_094086269.1\|1453159_1455577_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.1e-204	49.5
WP_003547337.1\|1455979_1457257_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	7.9e-133	58.6
WP_017959926.1\|1457553_1458189_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	9.5e-63	59.2
WP_172426292.1\|1458462_1459878_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.6e-12	34.1

DBSCAN-SWA_4

1522266 : 1531574

Acanthamoeba_polyphaga_mimivirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017959872.1\|1522266_1524234_+	hypothetical protein	A0A0G2Y9S0	Acanthamoeba_polyphaga_mimivirus	1.5e-05	26.9
WP_017959871.1\|1524257_1524836_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	1.2e-32	46.2
WP_017959870.1\|1524842_1525898_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.6e-94	51.2
WP_017959869.1\|1525901_1526789_+	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_026158619.1\|1526799_1527669_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	1.5e-95	59.2
WP_026158618.1\|1527789_1528401_-	riboflavin synthase	A0A2I2L4R9	Orpheovirus	2.6e-17	35.4
WP_017959867.1\|1528400_1529786_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.0e-32	38.1
WP_003547190.1\|1529789_1530266_-	transcriptional repressor NrdR	NA	NA	NA	NA
WP_017959866.1\|1530275_1531574_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	1.3e-98	51.3

DBSCAN-SWA_5

3719022 : 3729024

Streptococcus_phage(12.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094087348.1\|3719022_3721254_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.2e-123	37.1
WP_018243700.1\|3721918_3722140_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	7.9e-17	52.1
WP_094087349.1\|3722149_3722554_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	8.5e-17	43.1
WP_094087350.1\|3722532_3724737_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	2.5e-211	51.9
WP_017962232.1\|3724911_3725886_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A160DHK0	Gordonia_phage	2.1e-138	75.1
WP_094087351.1\|3725990_3727214_+	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	5.4e-14	29.4
WP_094087352.1\|3727232_3727961_-	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	3.1e-41	38.0
WP_025396142.1\|3727957_3728314_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_017962228.1\|3728313_3729024_-	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	4.3e-48	47.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022567

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP022564

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection