CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP022282	Chryseobacterium sp. T16E-39 chromosome, complete genome	3 crisprs	WYL,csa3,DEDDh,RT,c2c10_CAS-V-U3,cas3	0	1	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022282_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022282_1

1833419-1834117

Orphan

Consensus_repeat	Method
TTTAATCAGCCTATTGGAAGCTGG	CRISPRCasFinder

9 spacers

The CRISPR arrays of NZ_CP022282_1

>merge|NZ_CP022282|1|1833419-1834117|CRISPRCasFinder
TTCAATCAACCTCTGGGAAATTGGAATACTTCTAATGTAACGAATATGGCCTATACTTTTTTTTCAGCAACAGTTTTCAATCAGCCAATTGGAAATTGGAATACTTCCAAGGTAATACAGATGGTGGCCATGTTTAACAGTGCTGAAGCATTTAATCAGCCTATTGGAAGCTGGGATCTCTCTGAAAATAAAAGTACTGAGTTTATGTTCTCAGATGCCCATGCGTTTAATCAGCCTATTGGAAGCTGGAATATTTCCAAATTAGTTGAGACAGACCACATGTTCAGTAATGCTACAAGCTTTAATCAGGAGATTGGAAATTGGGACACCGGCAATATTACAGTTATGTCAGGAATGTTTAATGGCGCAGTAGCATTCAATCAGAGTATAGGAAACTGGAATGTAGGCAATGTAATCGATATGCGGGAAATGTTTCAGGATGCGACAAGTTTTAATCAGAACATTGGAAATTGGAATACAAGTAAGACACTGCTCATGATGGCCATGTTTAATGGCGCGAGTGCATTCAATCAAAATATAGGGAACTGGAATGTAAGTCATGTAATAAATATGAGCCAGATGTTCAAAAATACAGCAAACTTTAACCAGAATATCGGAGGTTGGAATACTGGCAGTGTTACACTCATGCCTGAAATGTTTAATGGTGCAGTGGTATTCAATCAGAATATAGGAAACTGG

>NZ_CP022282|1|1|1833419-1834117|CRISPRCasFinder
TTCAATCAACCTCTGGGAAATTGG	AATACTTCTAATGTAACGAATATGGCCTATACTTTTTTTTCAGCAACAGTT
TTCAATCAGCCAATTGGAAATTGG	AATACTTCCAAGGTAATACAGATGGTGGCCATGTTTAACAGTGCTGAAGCA
TTTAATCAGCCTATTGGAAGCTGG	GATCTCTCTGAAAATAAAAGTACTGAGTTTATGTTCTCAGATGCCCATGCG
TTTAATCAGCCTATTGGAAGCTGG	AATATTTCCAAATTAGTTGAGACAGACCACATGTTCAGTAATGCTACAAGC
TTTAATCAGGAGATTGGAAATTGG	GACACCGGCAATATTACAGTTATGTCAGGAATGTTTAATGGCGCAGTAGCA
TTCAATCAGAGTATAGGAAACTGG	AATGTAGGCAATGTAATCGATATGCGGGAAATGTTTCAGGATGCGACAAGT
TTTAATCAGAACATTGGAAATTGG	AATACAAGTAAGACACTGCTCATGATGGCCATGTTTAATGGCGCGAGTGCA
TTCAATCAAAATATAGGGAACTGG	AATGTAAGTCATGTAATAAATATGAGCCAGATGTTCAAAAATACAGCAAAC
TTTAACCAGAATATCGGAGGTTGG	AATACTGGCAGTGTTACACTCATGCCTGAAATGTTTAATGGTGCAGTGGTA
TTCAATCAGAATATAGGAAACTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022282.1\|WP_089027244.1\|1829110_1829641_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	unknown	unknown	gnl\|CDD\|200361
NZ_CP022282.1\|WP_089027241.1\|1824806_1825970_+\|type-IX-secretion-system-outer-membrane-channel-protein-PorV	unknown	unknown	unknown
NZ_CP022282.1\|WP_089027238.1\|1817755_1819027_-\|UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D--alanine-ligase	unknown	unknown	gnl\|CDD\|273468
NZ_CP022282.1\|WP_089027256.1\|1844907_1845291_+\|DUF1634-domain-containing-protein	unknown	unknown	gnl\|CDD\|377927
NZ_CP022282.1\|WP_089027243.1\|1828295_1828910_-\|4'-phosphopantetheinyl-transferase-superfamily-protein	unknown	unknown	gnl\|CDD\|225002
NZ_CP022282.1\|WP_089029823.1\|1843444_1843993_-\|DUF1543-domain-containing-protein	unknown	unknown	gnl\|CDD\|369429
NZ_CP022282.1\|WP_089027245.1\|1829808_1831125_+\|adenosylhomocysteinase	unknown	unknown	gnl\|CDD\|214963
NZ_CP022282.1\|WP_089027240.1\|1820858_1824746_+\|type-IX-secretion-system-sortase-PorU	unknown	unknown	gnl\|CDD\|199210
NZ_CP022282.1\|WP_089027255.1\|1844080_1844911_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP022282.1\|WP_089027242.1\|1826047_1828315_+\|FUSC-family-protein	unknown	unknown	gnl\|CDD\|130727
NZ_CP022282.1\|WP_089027247.1\|1832254_1832647_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227027
NZ_CP022282.1\|WP_089027251.1\|1837487_1838384_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|183067
NZ_CP022282.1\|WP_172821022.1\|1838564_1839131_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022282.1\|WP_089027253.1\|1841427_1842060_+\|HdeD-family-acid-resistance-protein	unknown	unknown	gnl\|CDD\|225786
NZ_CP022282.1\|WP_089027252.1\|1839140_1841264_+\|cation:proton-antiporter	unknown	unknown	gnl\|CDD\|223551
NZ_CP022282.1\|WP_157676787.1\|1831235_1832039_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022282.1\|WP_089027250.1\|1836731_1837235_-\|5-(carboxyamino)imidazole-ribonucleotide-mutase	unknown	unknown	gnl\|CDD\|376377
NZ_CP022282.1\|WP_089027254.1\|1842102_1843212_-\|5-(carboxyamino)imidazole-ribonucleotide-synthase	unknown	unknown	gnl\|CDD\|235674
NZ_CP022282.1\|WP_089027239.1\|1819092_1820694_-\|gliding-motility-lipoprotein-GldJ	unknown	unknown	gnl\|CDD\|132563
NZ_CP022282.1\|WP_089027249.1\|1834920_1836675_+\|BspA-family-leucine-rich-repeat-surface-protein	unknown	unknown	gnl\|CDD\|308794

Protein	Function_ID	Function_description	E-value
NZ_CP022282.1\|WP_089027244.1\|1829110_1829641_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	gnl\|CDD\|200361	TIGR04110, hypothetical_protein_VSWAT3_12502, heme utilization protein HutZ. Members of this family are heme utilization proteins, typically designated HutZ. They are members of the PPOX family (pfam01243) and, except for the lack of an N-terminal extension, are closely related to one form of heme oxidase (1.14.99.3), HugZ (TIGR04109). Members typically are found in a three-gene operon with radical SAM enzyme HutW and a protein of unknown function, HutX.	5.35897e-57
NZ_CP022282.1\|WP_089027253.1\|1841427_1842060_+\|HdeD-family-acid-resistance-protein	gnl\|CDD\|225786	COG3247, HdeD, Uncharacterized conserved protein [Function unknown].	1.02447e-16
NZ_CP022282.1\|WP_089027238.1\|1817755_1819027_-\|UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D--alanine-ligase	gnl\|CDD\|273468	TIGR01143, murF, UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase. This family consists of the strictly bacterial MurF gene of peptidoglycan biosynthesis. This enzyme is almost always UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanyl ligase, but in a few species, MurE adds lysine rather than diaminopimelate. This enzyme acts on the product from MurE activity, and so is also subfamily rather than equivalog. Staphylococcus aureus is an example of species in this MurF protein would differ. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	8.76145e-116
NZ_CP022282.1\|WP_089027256.1\|1844907_1845291_+\|DUF1634-domain-containing-protein	gnl\|CDD\|377927	pfam07843, DUF1634, Protein of unknown function (DUF1634). This family contains many hypothetical bacterial and archaeal proteins. A few members of this family are annotated as being putative transmembrane proteins, and the region in question in fact contains many hydrophobic residues.	2.75092e-22
NZ_CP022282.1\|WP_089027243.1\|1828295_1828910_-\|4'-phosphopantetheinyl-transferase-superfamily-protein	gnl\|CDD\|225002	COG2091, Sfp, Phosphopantetheinyl transferase [Coenzyme metabolism].	0.000737854
NZ_CP022282.1\|WP_089027240.1\|1820858_1824746_+\|type-IX-secretion-system-sortase-PorU	gnl\|CDD\|199210	cd02258, Peptidase_C25_N, Peptidase C25 family N-terminal domain, found in Arg-gingipain (Rgp), Lys-gingipain (Kgp) and related proteins. Peptidase family C25 is a unique class of cysteine proteases, exemplified by gingipain, which is produced by Porphyromonas gingivalis. P. gingivalis is one of the primary gram-negative pathogens that causes periodontitis, a disease that is also associated with other diseases such as diabetes and cardiovascular disease. Gingipains are a group of extracellular Arg- and Lys-specific proteinases called Arg-gingipain (Rgp) and Lys-gingipain (Kgp); RgpA and RgpB are homologous Arg-specific gingipains encoded by two closely related genes, rgpA and rgpB, while Lys-specific gingipain is encoded by the single kgp gene. Mutant studies have shown that, among the large quantities of proteolytic enzymes produced by P. gingivalis, these three proteases are major virulence factors of this bacterium. All three genes encode an N-terminal pre-pro fragment, followed by the protease domain; however, rgpA and kgp also encode additional C-terminal HA (hemaglutinin/adhesion) subunits which consist of several sequence-related adhesion domains. Although unique, their cysteine protease active site residues (His and Cys) forming the catalytic dyad are well-conserved, cleaving the C-terminal peptide bond with Arg or Lys residues. Gingipains are evolutionarily related to other highly specific proteases including caspases, clostripain, legumains, and separase. Gingipains function by dysregulating host defense and inflammatory responses, and degrading host proteins, e.g. tissue, cells, matrix, plasma and immunological proteins. They are proposed to enhance gingival crevicular fluid (GCF) production through activation of the kallikrein/kinin pathways, thus increasing vascular permeability and causing gingival inflammation, a distinctive feature of periodontitis. RgpA and RgpB are also able to cleave and activate coagulation factors IX and X in order to activate prothrombin to produce thrombin, which in turn increases production of GCF. The gingipains also play a pivotal role in the survival of P. gingivalis in the host by attacking the host defense system through cleavage of several immunological molecules, while at the same time evading the host-immune response by dysregulating the cytokine network.	2.53774e-106
NZ_CP022282.1\|WP_089029823.1\|1843444_1843993_-\|DUF1543-domain-containing-protein	gnl\|CDD\|369429	pfam07566, DUF1543, Domain of Unknown Function (DUF1543). This domain is found as 1-2 copies in a small family of proteins of unknown function.	2.19048e-12
NZ_CP022282.1\|WP_089027245.1\|1829808_1831125_+\|adenosylhomocysteinase	gnl\|CDD\|214963	smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase.	0
NZ_CP022282.1\|WP_089027251.1\|1837487_1838384_+\|EamA-family-transporter	gnl\|CDD\|183067	PRK11272, PRK11272, putative DMT superfamily transporter inner membrane protein; Provisional.	1.4578e-30
NZ_CP022282.1\|WP_089027255.1\|1844080_1844911_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	1.16229e-29
NZ_CP022282.1\|WP_089027242.1\|1826047_1828315_+\|FUSC-family-protein	gnl\|CDD\|130727	TIGR01666, Uncharacterized_protein_HI_1680, TIGR01666 family membrane protein. This model represents a clade of sequences from gamma and beta proteobacteria. These proteins are >700 amino acids long and many have been annotated as putative membrane proteins. The gene from Salmonella has been annotated as a putative efflux transporter. The gene from E. coli has the name yccS. [Cell envelope, Other].	1.46833e-52
NZ_CP022282.1\|WP_089027239.1\|1819092_1820694_-\|gliding-motility-lipoprotein-GldJ	gnl\|CDD\|132563	TIGR03524, gliding_motility_protein_GldJ, gliding motility-associated lipoprotein GldJ. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldJ is a lipoprotein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae. Knockouts of GldJ abolish the gliding phenotype. GldJ is homologous to GldK. There is a GldJ homolog in Cytophaga hutchinsonii and several other species that has a different, shorter architecture and is represented by a separate model. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.	3.97541e-149
NZ_CP022282.1\|WP_089027252.1\|1839140_1841264_+\|cation:proton-antiporter	gnl\|CDD\|223551	COG0475, KefB, Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism].	9.2566e-57
NZ_CP022282.1\|WP_089027247.1\|1832254_1832647_+\|hypothetical-protein	gnl\|CDD\|227027	COG4682, COG4682, Predicted membrane protein [Function unknown].	1.68012e-44
NZ_CP022282.1\|WP_089027250.1\|1836731_1837235_-\|5-(carboxyamino)imidazole-ribonucleotide-mutase	gnl\|CDD\|376377	pfam00731, AIRC, AIR carboxylase. Members of this family catalyze the decarboxylation of 1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR). This family catalyze the sixth step of de novo purine biosynthesis. Some members of this family contain two copies of this domain.	3.99876e-90
NZ_CP022282.1\|WP_089027254.1\|1842102_1843212_-\|5-(carboxyamino)imidazole-ribonucleotide-synthase	gnl\|CDD\|235674	PRK06019, PRK06019, phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed.	2.52036e-125
NZ_CP022282.1\|WP_089027249.1\|1834920_1836675_+\|BspA-family-leucine-rich-repeat-surface-protein	gnl\|CDD\|308794	pfam03382, DUF285, Mycoplasma protein of unknown function, DUF285. This region appears distantly related to leucine rich repeats.	1.55806e-48

>NZ_CP022282.1|WP_089027247.1|1832254_1832647_+|hypothetical-protein
MKKQRVSNAFVAASWIALGAGMIGYIVGLARAEMLLNEKGYYFTILLYGLFAVVSLQKAVRDKLENIPVTDIYYGICWFATLSSIVLLAIGLWNATILPSEKGFYAFAFLLALFGAISVQKNTRDNMLQD
>NZ_CP022282.1|WP_157676787.1|1831235_1832039_+|hypothetical-protein
MKKYLFLGLIGTATIFNSCSSDNDNANDPSEKRVLLSKITTIYYDNPAQPETTVSTLEYNAQGELVKTLSDGRVSIFEYNNGKPVKVNYYNADHTLEYYTSFAYNGEQLVNIKAIYSNPNFNRSSTYTYNANGKLASSTLCQSEDCSHPSISSYTYNGDNISVETYLMGGTISYSNKKEFSYDDQLNPYTNINKYIKIMMEGAYTISKNNYTTEKISYKDNNNGTWIQNQTNTYSIQYNSDHLPVQVIGKQSNGQNYVQYNYEYITQ
>NZ_CP022282.1|WP_089027245.1|1829808_1831125_+|adenosylhomocysteinase
MSTTTQYIPYKVKDISLAEWGRKEITLAEAEMPGLMSIREEYGPSQPLKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIFSTQDHAAAAIAAAGIPVYAWKGLNEEDFDWCIEQTLFFGEDRKPLNMILDDGGDLTNMVFDKYPQFTKDIKGLSEETTTGVHRLYERMKNGTLVMPAINVNDSVTKSKFDNKYGCKESAVDAVRRATDLMLAGKRVVVCGYGDVGKGTAASFRGAGSIVTVTEIDPICALQAAMDGYEVKRLDTVVDNADIIITTTGNFNIVRGEHFLKMKDKAVVCNIGHFDNEIDMAWLNENYGSTKSEVKPQVDIYTLEGGKEVIILAEGRLVNLGCATGHPSFVMSNSFSNQTLAQIELWNNSAAYGNEVYMLPKHLDEKVAALHLKKLSVELETLSPEQAEYIGVDVKGPFKPEYYRY
>NZ_CP022282.1|WP_089027244.1|1829110_1829641_-|pyridoxamine-5'-phosphate-oxidase-family-protein
MNHTNTEDGAQKKAKPVAPKVKELIANTKSVILATVDAEGNPNSSYAPFVQVENTFYILVSFMAKHTKNLADERKVSMMFIEDESTTKQIYARERLTIEATPSQIERDSETWNNVVAGLKETHGKVVDVISKMKDFILIALHPTKGSYVNGFGSAYFVDENLEILEHRNDMNHQSK
>NZ_CP022282.1|WP_089027243.1|1828295_1828910_-|4'-phosphopantetheinyl-transferase-superfamily-protein
MPLYRDFSDDTATILVWKYDESEELRIEDLLEPENAEKVKDYHPKKLLEVLMVRKLLKGLKPNSKILYNEREPFLSPKDAEISITHSFPFASIAISKNKIGIDIEKFNPKIMRVIDKFTYENERGFIPEDIASTYYTIIWSVKESMYKIHHSKYWSLKKNYEVKPFELKNLHKISCRVYDDQFSDEFKARVEFFDDYCFTIVEE
>NZ_CP022282.1|WP_089027242.1|1826047_1828315_+|FUSC-family-protein
MNYSAELKKFVTSQYVYSAIRITLATVLPCLVLAHFGILKEYFLFPLGTSFVALTDQPGPFIRRRNALTFAIFCFVLVALIASLVMNIKVLVILEIIVFAMFFSLIGVYGQRLAAVGSLSLVVMAIFIDGHLTGDNIFKSLLIFASGCTWFLLIFLIVTTIQPYKLASQMIGENYLQLAEFLKIKANYYQKNPDFDKLTTQVIAKQIGIKNLQEETRETVFKTRTIVNESTTTSRLLMLMFLNSMDLHEKLMTSESDYQKLQESFKDSMILVHIHDYLNLLAEEITNIGISLQVGTRAKPIFNLDAELKKLNTQYFEVRNRQITPETLENFMILRQILMRISEITKEINEIYKVFSQDVKLAKSLSTGLDLRKFMPNEEKLNFQVLKNNISFSSSQFRHAIRITTALLIGYLFSFFQFLSIGHTYWILITITAILKPAYSITKQRNGLRLYGTIVGATIAYIILHFIHINAILFGTLLVSMILCFSLLKGRYFWAVLFMTIYVFLSFNFLSPGKVDIIFKDRIVDTVIAGIIAFLVSYIVLPVWEHTQNLDLMKKSAESNLIYFQSVISKFLQEGFDLEEYKVKRKNAIISLANLSDNFQRMISEPKNQQKKLEVVHQFVATSHLVTAYTASLSQYSKNDEKYPEIDAESWSKKIESELQQTSALLKGEEINEVLKMESRLEPEDSSIDDLMLKRKTELEENEASDVNDPNKISHLTELKNIHDVLELIYDVAKEQRKVIEKYKNESEATTPPQS
>NZ_CP022282.1|WP_089027241.1|1824806_1825970_+|type-IX-secretion-system-outer-membrane-channel-protein-PorV
MNLTTKLLLGIGFTAGFLGYSQDLSKVGPVLTGAPFLRIAPDARSGGMGDQGVVTSPDAFSQFWNAAKYPFSRTSSSVGLNYTPYMGKLTNDVFLLYGAFHKFLGQDERSTISASIYYFNMGQVDLTQLVGTEVASMGTSKPNEFSIDVAYALKLSDSYSMAVTGRFIRSDLAGGFNTDTTLKPANSFAVDVSGYYTSPRFSSFGGYDGKLNAGFAIQNLGPKLDYTGNEESRSYLPTMARLGVGYDMYLDDVNKIGLSVEGSKILVPGSEFIGMDPNTRQPMYAVPNVGPIAGIGKSFKNKNSIMYSGALEYSYDNAFAVRTGYFRESEEQGARQFATAGIGLKYRSFGLDISYLINMSKINTALDNTLRFGLTWNIGDETSNVDY
>NZ_CP022282.1|WP_089027240.1|1820858_1824746_+|type-IX-secretion-system-sortase-PorU
MKQIITFLLLSSFVSTLYAQKINIEWNGSKIQDFGDTKINLPNFKNRGFSYGQNNIFIITTQKIGERQLKVSNLVWESVSNRELFELSKNVLPDYDITNVSYYYSEGEQYASVNVGLFKNVKGRIQRLSSFEISEGSGSNQIMNAAKVGTSNNPLSSGAFYKIKVDKSGIFKITTQFLKDNGINPSSVNPKNFRIYGNGGIMLSEFNQDVKYSALQENAIQVVGEDDGIWNDQDYALFYAQGPNGYNLYNKSNGGGFKRADERVDKSENVKNIYDDFSYYYINFDKGAGKRVLPIDADLPATALITRFDNYQVINNDQKNIMKVGRVWTEEAPFTTDKTVTFNLNSPIQGADAIKYRTKVIGYKSQGNSISFDINNQNAQIYSSGSTDPDYLPLTYSGDITNLNGNQISFNYKPNITTNPNGSFYFDYAEVQYKEDLKYNGSQMNFRDFSLTSGTNTSYGFSVNNTAGLEQIWDVTDITNANRRVNKATGSASFNFGYVTADLNFNNEFVAFKADAAYSPQFVERIANQNLSGLQNVDYLIITVPEMMSQAQRLANYHQTKNNFNVQIVDANKIYNEFGSGSRDLTAIRDFITKLNTPLGSLKYVFILGDTSYDYKNRVPNNSNVVSSYQSEQSSEFVTSFVTDDYIVMTKPQTSASVPSNLPDLPVGRLPAANVTEAGIMMDKTLAYYNSLSGQSTPFGEWRMKLDFVVDDDNDGGSPFHDVMNNTLSTVFEQPGSTNLKEYNVRKLYLDAFQAQSTAGGQRYPQVNQAISNDIGNSMYLFYFGHGGISGWAQERVLTLDEINNANNFSNVYSRFPFVSTITCEFTLWDEPETLSAGERFLKMKQGGPAAMITSSRAIGVDYGRDFTDLYTQDIFKLVNDDFETLGVAHLNAKKQKGPQTDHLKVNLLGDPAMKLSRPKRLLVIDNIETPVPGLIRGLDFVKVKGHINNTNGTVNTTFNGRVVINIFDKRLNKKTLNNDGGLTPILNYTEEGSAIVKASGTAVNGVFTVEFYVPKDINYAVGEGRILGYADNKAMDVFNNQSVQVGDINPNGINDSQPPKVKLYMNNTNFADGGITDQNPMLLACVTDDTGINSTGSGIGHDITVYLDGQIINTIVLNDFYASGEGNGCLSPSLADYQKGNVTYPFRNLSIGQHQLSFKVWDINNNSTSATLNFEVKDEADQHLVINRPLNWPNPFTNKTYVQFEHNCDDILNVNVQIYTITGKLVRTLSQAVVAEPFLQGFRTPRQAIEWDGRDDFGATVGKGTYIFKIFAKSQNQEKCKGSATAVEKMVLLK
>NZ_CP022282.1|WP_089027239.1|1819092_1820694_-|gliding-motility-lipoprotein-GldJ
MKKLKLFSLIALSSTLALTSCGGSGTNKGGGTKKFISKTGWKPNEKQGWFFAGKQQKQKGWPGMVYVEGGTFTMGLVKDDVMHDWNNSPRRMQVSSFFIGETEITNYEYREYLTWLKYVFPPSDPSFKEIYNGALPDTLLWDNKLSRNDYNETYFRSPEFDYYPVVGVSWTQANRYCEWLTDRANEKALMSAGIIAKDLYINESNNQGGTAFNMDKFKANDPEMQGYINEQRMQQKSGLKTTNQRLLSANRAPNSAMVQKFRLPTEVEWEYAALGMAKNREYNQYLGKKPEIERLRGTKGRDRGMFLENFKMGRGDYSGIAGWKNDGSARTSDVRQYPSNDLGVYGMYGNVSEWTADVYRPIIDEDFSDFNYYRGNMPQAVVKNGDGTYKMVDEGSIKYDTLADGRLVYKSLPGQFEKQTIADYRNYRDGDRQSSLEYYKAGDSTAAYDMYNSPKQRFIVDGSGRVIMQKDTKDRTSAMSNDIRVIKGGSWQDTAYWLDPGQRRYKDQNRAFGWIGFRVAQDARAADKSRTRR
>NZ_CP022282.1|WP_089027238.1|1817755_1819027_-|UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D--alanine-ligase
MNIEQFYPLFSKANKVTIDSRKIESNDIFFAFSGDNFDAATLAEKAISDGALAVIVERKDFENTARNIFYVPSTLDFLQALAVYHRNQLDIPFIGLTGSNGKTTTKELIHAVLSEKYNVQYTYGNLNNHIGVPLTILSVKPGHEMAVIEMGANHQKEIELLCTIAKPDYGYITNFGKAHLEGFGGFEGVIKGKSELYDYLKEYNKTIVVNENDSIQVDKTENYEPKITFGKKDSDYYFESYSEDHCVGLSYQGTKALSKLTGNYNFTNLCAAVSLGLHFGIDQEKIKHAIESYTPTNMRSQIVKKEGKTLVLDTYNANPSSMAVSLSNFITFEGSKSIIIGDMLELGEESMVEHQNILKQALELGFDEIITVGGNFKKVNLTTLSFENTQELIEYLKLNGIQSDNILLKASRGISLEKALDFI
>NZ_CP022282.1|WP_089027249.1|1834920_1836675_+|BspA-family-leucine-rich-repeat-surface-protein
MYKKLIPFIFFLFFFHFGNAQNEFITVWKPSLPRYSTAYSGIPVASTDQQIWVPAVGTNFQIYWEEIGFPTNHATLTNLNSTHQVLVDLGTPMNPNPADATYRLKISNGNGSFHRMRFSNWDMFTNGDGLVGDVHKIVKLEQWGNIHWSSMGQAFQLCRDFDVTATDSPDLSAVTDMSNMFASNFTLIGNSTFDNWDTSHVENLLGTFSGCFVFNQPVGSWDTSNVNMMGITFTAAKQFNQPLAHWNTSKVVYMTAMFSGAKEFNQPIGNWDLSSAIDCEFMFSNAEKFNQPIGNWNTSKVVEMDRMFNQAKAFNQDISNWDTSSATIMEGMFAGASNFNQNIGNWNLSKVLYVNDMFNGATQFNQNIGNWDVSKVIWTYNMFKDAKNFNQNLGSWNVGLVTNMNNMFNGATDFNQNLGSWNLHSLVSAQNMLLNSGLNCQNYDSTLYEWNINGSTPNNINLGNTSPLVYSHPSSVSARNNLINNKMWTITGDTYNGECQSFLSSSEVLAHNEISIYPNPATDFINIKNLKGNNNYKIFDISGRIVLQNLLHEEKIDVSSLTKGNYILVITTKDKSQSFKFIKK
>NZ_CP022282.1|WP_089027250.1|1836731_1837235_-|5-(carboxyamino)imidazole-ribonucleotide-mutase
MVGIIMGSQSDLPIMEQAANFLKTLEIPYELTVVSAHRTPERMFDYAKTAKERGLKVIIAGAGGAAHLPGMVASCTTLPVIGVPILSSNSIDGWDSVLSILQMPGGIPVATVALNGALNAGILAAKILGSGNEQIAEKLQTYQDSLKDKVLGTVDDIKAQHPNQYDR
>NZ_CP022282.1|WP_089027251.1|1837487_1838384_+|EamA-family-transporter
MKDYKLTFAILTVAIVWGTTFLSIRVAVQTIPAWFVAGIRQSLAALIMLVILLYRKELQWIGWKNLKYQIVFSSLMLIIANGMTTVAEETVTSSLASLISACSPILVFLGSVAVGIQKFSIRAVIGILMSFGGVLFIFWDGIKDLANPDYAMGIIFLLVAIAGWASGTIFTKKLNIQSGNITLNLLYQFAFAGIVQIIFAFLFSEDYNFENWSFRSISAMLYLAVFGSVAAFFAYHYALTKISPVQVSILAYINTIISIFLSWLILGESISVKFILAAVLIILGVFTINYNPAMFKKQ
>NZ_CP022282.1|WP_172821022.1|1838564_1839131_+|hypothetical-protein
MLKNTLLILFISPFLLLSCDNRQKEKKLLEREQQLLEKEKLFAHKESEYQALIKMRDSIFSKKDSIQIMKWPTEISGSWNGKVICIESNCSDYVVGDQRNDTWEFDSDSIQLVTKIISNSNLIRLYSGRFENNEIKLNFKTDSTAKKKVDMNILLNDISDTKIRGTRTVMTDNNCTAKFSVELTRSSK
>NZ_CP022282.1|WP_089027252.1|1839140_1841264_+|cation:proton-antiporter
MILLSIHNLSFPIEDPVLKFLLVLIIILAAPLLLNKIKVPHLLGLIIAGAVIGPNGFNLLARDSSIVVTGTTGLLYIMFLAGLEIDMGDFKKNKWKSLIFGIYTFTVPFILGFIGAYYLLHFSLLTSILFASLFSSHTLIAYPLVSKLGIAKNLAVNITVGGTMITDVLALLVLAIIVGMSQGDVGPEFWVKLSVSFIIFSLIVLLIFPIIGRWFFKKVEDKISQYIFVLVMIYLAALLAELAGMEAIIGAFFAGLALNRLIPHTSSLMNRVEFVGNAIFIPFFLISVGMLIDFKVFFKSMETLEVAAIMLVASIGGKYLSAVMTQKTFRLSKEEGKLIFGLSSASAAATLASVMVGYNIIVSETETGEPVRLLNEHVLNGSILLILISCTISSFVSMSSAQKIAETDNEDTVSGNSHEEENLLLAINHQETVERMVNLGILIKAQSNIENFFALNVINEDKNESSVKNAEKLLHQATDTAAAADVQLQPLKRYDNDVVNGVSNVIKEQNITDLIIGLEDEKGFSPSFVYNLYNGYLQNDDVNVLVYHAAQPISTIKKYAVMIPENSDKEAGFFHALLRVWNMARNSGATMTFYAPENIIDILQRIIKKANIEAEFIIMSTWRDGEKTAAQLKNDEALIVFMAKRGMVSYIPQMRLMPELLNRNLKENNYLLIFPFSEYDKNDSEKRSVGNHRDFIEIGNVIQKIFK
>NZ_CP022282.1|WP_089027253.1|1841427_1842060_+|HdeD-family-acid-resistance-protein
MPNLLKSFRNSVKHWYIPLILGILFIGCGIYVFSSPLETYLTLSLLFSVSFIVSGIFDIFFSINNAKVLNGWGLYLVTGLLSLIMGIYLVSYPQISMTILPFIVGFTVMFRSFQLLGISFDLKDAHVLRWGNLAIFSILGIILSFMLLANPIFSGMSLVVLTGLSFIFVGVASVILAFNLKKIKDYPSKLGSELKDKIESLHHELNDKMK
>NZ_CP022282.1|WP_089027254.1|1842102_1843212_-|5-(carboxyamino)imidazole-ribonucleotide-synthase
MKIGILGGGQLGRMLIQSALKYDDEFYTLDPASDAPCNNISNFTQGNFNDYETVLNFGKNKDVVTIEIEHVNADALAELENQGVRVVPNAAIIKTIQQKILQKEFYEAHDIPSPEFQVVWNSDDKITMPLPFVQKMNTGGYDGKGVQVIRNEEDFQNLWKEASVIESLVDIDKELSVIVARNENGETKTFPVTEMVADPKLNLLDFNICPVFLHEDIQRQIDLITEKFLNAINSPGLFAIELFLDRAGKVWVNETAPRLHNSGHQSQEGNANSQFEQMYRVVKNLPLADTDAFGYSGMLNLVGAEGYSGKVIYEGIEDVLKLPKTYIHLYGKTETKPGRKMGHINVLADSKEELMDKLIKVKSMIRVIA
>NZ_CP022282.1|WP_089029823.1|1843444_1843993_-|DUF1543-domain-containing-protein
MKLFYVILGATPPGRNIEQHDVFFGIAENLKDLVPDMKDFWKEADGKIHIDCHQEVRFANGYEVKIVEKTGQPIEDQLYFINLGGYKRGYFEEFHEQHLMVGQSMGEIIKRVKETEFYKTMGFEGAVSHVDDKHGVDIDDIFNVNDILPQKMKEKYSIILEKSDAEDQNNPMGLGYLKIDKV
>NZ_CP022282.1|WP_089027255.1|1844080_1844911_+|sulfite-exporter-TauE/SafE-family-protein
MSEIIILFLGAISAGLLGSLTGLGGGVIIIPLLTLGFGVPMHYAIGASLISVVGTSSGAAVAFVKEGFTNMRIGMFLEIATTAGAIAGALVSGILNPNTIGIIFASILLLTVILNIKGKPDHQEPLIKGSLEDKLKLYGTFPDKGVIKSYSARNTIPGFFMMMFAGAMSGLLGIGSGALKVLAMDNMMKLPFKVSTTTSNFMIGVTAVASSLIYFQRGEIIPVIVAPVLVGVVVGSFIGSKTLMVSKTKKLKVFFAIVITILSIYMMYNGINQSFR
>NZ_CP022282.1|WP_089027256.1|1844907_1845291_+|DUF1634-domain-containing-protein
MRKNFTDVDLNRSVGNLLRMGVILSVAISIVGFIKLFLEGFKMPKNYSLLETGSSSEKVWGQFWDSLCKGEGMAIIQLGILVLIFTPLMRIVFALIGYLKEKDYIYVIISSIVLAIMAISFFTGYAH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022282_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022282_2

2761869-2761950

Orphan

Consensus_repeat	Method
TAAATTCTACTTAAAAACAAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022282_2

>merge|NZ_CP022282|2|2761869-2761950|CRISPRCasFinder
TAAATTCTACTTAAAAACAAAAATACAAATAGTAAAAATAATTTCTAACTTCTGCATCTTAAATTCTGCTTAAAAACAAAAA

>NZ_CP022282|2|2|2761869-2761950|CRISPRCasFinder
TAAATTCTACTTAAAAACAAAAA	TACAAATAGTAAAAATAATTTCTAACTTCTGCATCT
TAAATTCTGCTTAAAAACAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022282.1\|WP_089029864.1\|2767338_2768322_+\|phosphatidylinositol-specific-phospholipase-C	unknown	unknown	gnl\|CDD\|176528
NZ_CP022282.1\|WP_089028011.1\|2760620_2761781_-\|GlmU-family-protein	unknown	unknown	gnl\|CDD\|274907
NZ_CP022282.1\|WP_089028004.1\|2754153_2754672_+\|thioredoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|239321
NZ_CP022282.1\|WP_034678907.1\|2763851_2764178_+\|nucleotide-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|212138
NZ_CP022282.1\|WP_089028002.1\|2753374_2753572_+\|KTSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|379296
NZ_CP022282.1\|WP_089028005.1\|2755147_2756608_-\|IMP-dehydrogenase	unknown	unknown	gnl\|CDD\|376340
NZ_CP022282.1\|WP_089028010.1\|2760012_2760522_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274376
NZ_CP022282.1\|WP_089028012.1\|2762439_2763852_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022282.1\|WP_089028015.1\|2766545_2767133_-\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_CP022282.1\|WP_089028006.1\|2756773_2757481_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022282.1\|WP_089028009.1\|2759372_2760038_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022282.1\|WP_089028016.1\|2768408_2770238_-\|alkaline-phosphatase	unknown	unknown	gnl\|CDD\|176519
NZ_CP022282.1\|WP_089028018.1\|2771940_2774829_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|274948
NZ_CP022282.1\|WP_089028007.1\|2757508_2758012_-\|DUF4252-domain-containing-protein	unknown	unknown	gnl\|CDD\|379445
NZ_CP022282.1\|WP_089028013.1\|2764364_2765582_+\|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|238797
NZ_CP022282.1\|WP_089028008.1\|2758024_2759308_-\|DUF4252-domain-containing-protein	unknown	unknown	gnl\|CDD\|371327
NZ_CP022282.1\|WP_089028014.1\|2765710_2766463_-\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|235816
NZ_CP022282.1\|WP_089028017.1\|2770405_2771914_-\|RagB/SusD-family-nutrient-uptake-outer-membrane-protein	unknown	unknown	gnl\|CDD\|185760
NZ_CP022282.1\|WP_034715439.1\|2762001_2762253_-\|type-B-50S-ribosomal-protein-L31	unknown	unknown	gnl\|CDD\|234969
NZ_CP022282.1\|WP_172821068.1\|2753686_2754148_+\|redoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|239316

Protein	Function_ID	Function_description	E-value
NZ_CP022282.1\|WP_089029864.1\|2767338_2768322_+\|phosphatidylinositol-specific-phospholipase-C	gnl\|CDD\|176528	cd08586, PI-PLCc_BcPLC_like, Catalytic domain of Bacillus cereus phosphatidylinositol-specific phospholipases C and similar proteins. This subfamily corresponds to the catalytic domain present in Bacillus cereus phosphatidylinositol-specific phospholipase C (PI-PLC, EC 4.6.1.13) and its sequence homologs found in bacteria and eukaryota. Bacterial PI-PLCs participate in Ca2+-independent PI metabolism, hydrolyzing the membrane lipid phosphatidylinositol (PI) to produce phosphorylated myo-inositol and diacylglycerol (DAG). Although their precise physiological function remains unclear, bacterial PI-PLCs may function as virulence factors in some pathogenic bacteria. Bacterial PI-PLCs contain a single TIM-barrel type catalytic domain. Their catalytic mechanism is based on general base and acid catalysis utilizing two well conserved histidines, and consists of two steps, a phosphotransfer and a phosphodiesterase reaction. This family also includes some uncharacterized eukaryotic homologs, which contains a single TIM-barrel type catalytic domain, X domain. They are similar to bacterial PI-PLCs, and distinct from typical eukaryotic PI-PLCs, which have a multidomain organization that consists of a PLC catalytic core domain, and various regulatory domains, and strictly require Ca2+ for their catalytic activities. The prototype of this family is Bacillus cereus PI-PLC, which has a moderate thermal stability and is active as a monomer.	1.83764e-104
NZ_CP022282.1\|WP_089028011.1\|2760620_2761781_-\|GlmU-family-protein	gnl\|CDD\|274907	TIGR03991, alt_bact_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase. The MJ_1101 protein from Methanococcus jannaschii has been characterized as the GlmU enzyme catalyzing the final two steps of UDP-GlcNAc biosynthesis. Homologs of this enzyme are identified in a number of bacterial organisms and modeled here. A number of these are observed in proximity to the GlmS and GlmM genes, and phylogenetic profiling by PPP identifies the LEPBI_I0518 gene in Leptospira biflexa as a likely Glm-system candidate. Multiple sequence alignments of these bacterial homologs with their archaeal counterparts reveals significant structural differences, necessitating the construction of separate models. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Central intermediary metabolism, Amino sugars].	4.94636e-135
NZ_CP022282.1\|WP_089028004.1\|2754153_2754672_+\|thioredoxin-domain-containing-protein	gnl\|CDD\|239321	cd03023, DsbA_Com1_like, DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti. It contains a CXXC motif, assumed to be imbedded in a DsbA-like structure. Its homology to DsbA suggests that the protein is a protein disulfide oxidoreductase. The role of such a protein in pathogenesis is unknown.	1.9202e-29
NZ_CP022282.1\|WP_034678907.1\|2763851_2764178_+\|nucleotide-pyrophosphohydrolase	gnl\|CDD\|212138	cd11531, NTP-PPase_BsYpjD, Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain putative pyrophosphatase YpjD from Bacillus subtilis and its bacterial homologs. This family includes a putative pyrophosphatase Ypjd from Bacillus subtilis (BsYpjD) and its homologs. Although its biological role has not been described in detail, BsYpjD shows significant sequence similarity to the dimeric 2-deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTP pyrophosphatase or dUTPase) and NTP-PPase MazG proteins. However, unlike typical tandem-domain MazG proteins, BsYpjD contains a single MazG-like domain.	3.87483e-38
NZ_CP022282.1\|WP_089028002.1\|2753374_2753572_+\|KTSC-domain-containing-protein	gnl\|CDD\|379296	pfam13619, KTSC, KTSC domain. This short domain is named after Lysine tRNA synthetase C-terminal domain. It is found at the C-terminus of some Lysyl tRNA synthetases as well as a single domain in bacterial proteins. The domain is about 60 amino acids in length and contains a reasonably conserved YXY motif in the centre of the sequence. The function of this domain is unknown but it could be an RNA binding domain.	1.6991e-15
NZ_CP022282.1\|WP_089028005.1\|2755147_2756608_-\|IMP-dehydrogenase	gnl\|CDD\|376340	pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain. This family is involved in biosynthesis of guanosine nucleotide. Members of this family contain a TIM barrel structure. In the inosine monophosphate dehydrogenases 2 CBS domains pfam00571 are inserted in the TIM barrel. This family is a member of the common phosphate binding site TIM barrel family.	0
NZ_CP022282.1\|WP_089028010.1\|2760012_2760522_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274376	TIGR02985, Sig70_bacteroi1, RNA polymerase sigma-70 factor, Bacteroides expansion family 1. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are found primarily in the genus Bacteroides. This family appears to have resulted from a lineage-specific expansion as B. thetaiotaomicron VPI-5482, Bacteroides forsythus ATCC 43037, Bacteroides fragilis YCH46 and Bacteroides fragilis NCTC 9343 contain 25, 12, 24 and 23 members, respectively. There are currentlyonly two known members of this family outside of the Bacteroides, in Rhodopseudomonas and Bradyrhizobium.	1.31645e-26
NZ_CP022282.1\|WP_089028017.1\|2770405_2771914_-\|RagB/SusD-family-nutrient-uptake-outer-membrane-protein	gnl\|CDD\|185760	cd08977, SusD, starch binding outer membrane protein SusD. SusD-like proteins from Bacteroidetes, members of the human distal gut microbiota, are part of the starch utilization system (Sus). Sus is one of the large clusters of glycosyl hydrolases, called polysaccharide utilization loci (PULs), which play an important role in polysaccharide recognition and uptake, and it is needed for growth on amylose, amylopectin, pullulan, and maltooligosaccharides. SusD, together with SusC, a predicted beta-barrel porin, forms the minimum outer-membrane starch-binding complex. The adult human distal gut microbiota is essential for digestion of a large variety of dietary polysaccharides, for which humans lack the necessary glycosyl hydrolases.	2.0798e-29
NZ_CP022282.1\|WP_089028015.1\|2766545_2767133_-\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	2.96029e-13
NZ_CP022282.1\|WP_172821068.1\|2753686_2754148_+\|redoxin-domain-containing-protein	gnl\|CDD\|239316	cd03018, PRX_AhpE_like, Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE. AhpE is described as a 1-cys PRX because of the absence of a resolving cysteine. The structure and sequence of AhpE, however, show greater similarity to 2-cys PRXs than 1-cys PRXs. PRXs are thiol-specific antioxidant (TSA) proteins that confer a protective role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. The first step of catalysis is the nucleophilic attack by the peroxidatic cysteine on the peroxide leading to the formation of a cysteine sulfenic acid intermediate. The absence of a resolving cysteine suggests that functional AhpE is regenerated by an external reductant. The solution behavior and crystal structure of AhpE show that it forms dimers and octamers.	3.11102e-55
NZ_CP022282.1\|WP_089028018.1\|2771940_2774829_-\|TonB-dependent-receptor	gnl\|CDD\|274948	TIGR04056, OMP_RagA_SusC, TonB-linked outer membrane protein, SusC/RagA family. This model describes a distinctive clade among the TonB-linked outer membrane proteins (OMP). Members of this family are restricted to the Bacteriodetes lineage (except for Gemmatimonas aurantiaca T-27 from the novel phylum Gemmatimonadetes) and occur in high copy numbers, with over 100 members from Bacteroides thetaiotaomicron VPI-5482 alone. Published descriptions of members of this family are available for RagA from Porphyromonas gingivalis, SusC from Bacteroides thetaiotaomicron, and OmpW from Bacteroides caccae. Members form pairs with members of the SusD/RagB family (pfam07980). Transporter complexes including these outer membrane proteins are likely to import large degradation products of proteins (e.g. RagA) or carbohydrates (e.g. SusC) as nutrients, rather than siderophores. [Transport and binding proteins, Unknown substrate].	0
NZ_CP022282.1\|WP_089028007.1\|2757508_2758012_-\|DUF4252-domain-containing-protein	gnl\|CDD\|379445	pfam14060, DUF4252, Domain of unknown function (DUF4252). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 154 and 182 amino acids in length.	1.60732e-22
NZ_CP022282.1\|WP_089028013.1\|2764364_2765582_+\|3-phosphoshikimate-1-carboxyvinyltransferase	gnl\|CDD\|238797	cd01556, EPSP_synthase, EPSP synthase domain. 3-phosphoshikimate 1-carboxyvinyltransferase (5-enolpyruvylshikimate-3-phosphate synthase) (EC 2.5.1.19) catalyses the reaction between shikimate-3-phosphate (S3P) and phosphoenolpyruvate (PEP) to form 5-enolpyruvylshkimate-3-phosphate (EPSP), an intermediate in the shikimate pathway leading to aromatic amino acid biosynthesis. The reaction is phosphoenolpyruvate + 3-phosphoshikimate = phosphate + 5-O-(1-carboxyvinyl)-3-phosphoshikimate. It is found in bacteria and plants but not animals. The enzyme is the target of the widely used herbicide glyphosate, which has been shown to occupy the active site. In bacteria and plants, it is a single domain protein, while in fungi, the domain is found as part of a multidomain protein with functions that are all part of the shikimate pathway.	1.86514e-97
NZ_CP022282.1\|WP_089028008.1\|2758024_2759308_-\|DUF4252-domain-containing-protein	gnl\|CDD\|371327	pfam10988, DUF2807, Putative auto-transporter adhesin, head GIN domain. This bacterial family of proteins shows structural similarity to other pectin lyase families. Although structures from this family align with acetyl-transferases, there is no conservation of catalytic residues found. It is likely that the function is one of cell-adhesion. In Structure 3jx8, it is interesting to note that the sequence of contains several well defined sequence repeats, centred around GSG motifs defining the tight beta turn between the two sheets of the super-helix; there are 8 such repeats in the C-terminal half of the protein, which could be grouped into 4 repeats of two. It seems likely that this family belongs to the superfamily of trimeric auto-transporter adhesins (TAAs), which are important virulence factors in Gram-negative pathogens. In the case of Parabacteroides distasonis, which is a component of the normal distal human gut microbiota, TAA-like complexes probably modulate adherence to the host (information derived from TOPSAN).	2.09388e-27
NZ_CP022282.1\|WP_089028014.1\|2765710_2766463_-\|glucose-1-dehydrogenase	gnl\|CDD\|235816	PRK06500, PRK06500, SDR family oxidoreductase.	4.72397e-90
NZ_CP022282.1\|WP_034715439.1\|2762001_2762253_-\|type-B-50S-ribosomal-protein-L31	gnl\|CDD\|234969	PRK01678, rpmE2, type B 50S ribosomal protein L31.	2.71751e-44
NZ_CP022282.1\|WP_089028016.1\|2768408_2770238_-\|alkaline-phosphatase	gnl\|CDD\|176519	cd08577, PI-PLCc_GDPD_SF_unchar3, Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases. This subfamily corresponds to a group of uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipase C (PI-PLC), and glycerophosphodiester phosphodiesterases (GP-GDE), and also sphingomyelinases D (SMases D) and similar proteins. They hydrolyze the 3'-5' phosphodiester bonds in different substrates, utilizing a similar mechanism of general base and acid catalysis involving two conserved histidine residues.	4.73485e-96

>NZ_CP022282.1|WP_089028011.1|2760620_2761781_-|GlmU-family-protein
MQLVFSDAQYWEDFLPLTFTRPIAEMRCGILTFSERWQKLLENSEVSYFTENYLQQKFKSPEEKESLFLVTNFLPTENVLQQIKDLKPGEALVYEDELIAAKINMKGFSLNQIEKMTDIKEELVFFKKPKDLFTYNHKAIDFDFELLTSGKTSQELSSTNGFLGDKKDLFIEEGAQIEFSTLNTKTGKIYIGKNTEVMEGCHLRGPIALCDDSKFNLGAKIYGATTIGPNCKIGGEVNNIIVFGYSSKGHDGFVGNSVIGEWCNFGADTNSSNMKNNYGNVKLWNYRTKAFEDTGLQFAGLIMGDHSKTAINTQLNTGTVIGVASNIFKEGFPPNLIENFSWGGFKGDERFKLDKAYEVAERAMARRKVALTDDDKGILKHIFDTY
>NZ_CP022282.1|WP_089028010.1|2760012_2760522_-|sigma-70-family-RNA-polymerase-sigma-factor
MTQETFKNTVFILKNEMYRFAKRFVMSSDEAEDVVQDLMVKFWQKREELEQFGNLKSYALKSVRNECLNRLKHHDVKIGFADMQLHRSELYSMEVNNLKEHIIGFINQLPEKQKMVIHLKDVEEYEVSEISEMLEMEENAVRVNLMRARQKVKEQISQLMNYEQRSISR
>NZ_CP022282.1|WP_089028009.1|2759372_2760038_-|hypothetical-protein
MNNDQFQDKYEEIFRDIKEEKMDWDFEDFLQKAEGIDDDKIIPLEKKKPSFPKWFWMAASVVVILSIGFIVNYNQEHSIIDDQSKLVEHQVKQQKKDFIEENHEPEQQVAINNTDSIAGAKKDSVSQDNTIAEKDVMDEILPKRGRLKKEVRPKFTYNSSYKKYNAAKKDSTGYNNNYVIVNGKRIDNVDEAINVTKYSFQIFANNVSEKLVQPKVMDDNY
>NZ_CP022282.1|WP_089028008.1|2758024_2759308_-|DUF4252-domain-containing-protein
MKKILIIFALAFSHFFTVYGQEDKFDKLFEKYQQVEGVTSIKIAKPMFGMLSSLNIDDSQLDQIKPLLSKINGLKILITENPENANSAGGKKLQNSLSQINKDISSYLSHLNYNEVMSVNSKDSKIKFLSAGAKEGILDDVLLSIDSGDGGNVLVMLDGKLSMDDLNKIIKSSETKTSSITNTTRSSMTSENSTSYLNGEARNVGEFSGIQVSTGINLIYKQESPTSVKVIADADKLQYVITKVENGILKVYVDNKGERNIRFKNLSVNVSSPRMRSIKASSGASFIAVNPVKENSMDIDASSGAAVKGKFNVSSTTDVSSTSGASVKVSVNTSAIVVKASSGSDTIIEGQATSGVIDISSGASCKAENLKLNELEVESTSGASLSVNVTDRLKVKASSGGSVKYKGNPQIDSNISKMSGGSLKAIN
>NZ_CP022282.1|WP_089028007.1|2757508_2758012_-|DUF4252-domain-containing-protein
MKNLKTIFLFSCILILLQSCIVSHRRPNMAFFSDTNYDFKGARFESINVPMFLAKPFIKKALREDGENEEVADLVKKISKIKVLTVENGDPGMLADYAAYLNNNNYEDWATIKHDGDNVNVRVKQSGEAIKNMLITVNSDKELVFVDVKGNFTADDISKFINSASDK
>NZ_CP022282.1|WP_089028006.1|2756773_2757481_-|hypothetical-protein
MEKLIREVRMLKIYAASLTIAFILLFLLAFKSNNDHQRFQEIDVERINVIEKDGTLKMVISNKKRQHPGLLNNKPLKAREREAGLIFFNSLGDECGGLIYDSDEKGSGMVYSVDQRKTDQIMQLQYSEGTGADKRRAYGLKLWDRPDDFTLEKVLKFDDSLQKLNDPVATKKAFAKLKEEGKLGSERFFAGKTANGDVGLFIRDDKGRVRLKIYVDKNNQTHIEDVDENGKSTIK
>NZ_CP022282.1|WP_089028005.1|2755147_2756608_-|IMP-dehydrogenase
MSIHNKIVETAITFDDVLLVPSYSEVLPNQVSLKSRLTDKITLNVPIVSAAMDTVTEGDLAIALARVGGLGFIHKNMTIAEQAAQVNRVKRSENGMISDPVTLSKDHTLAQAKEMMSKYKISGLPVVDQDNILIGIITNRDVKYQENLDMKVEEIMTKENLITSDKNTNLEKAKEILLKNRVEKLPIVDKENKLVGLITIKDIDNQLEYPNSNKDPKGRLIVGAGVGVGEDTMDRIAALVQAGVDIVAIDSAHGHSKGVLDKISEIRKTYPDLDIVGGNIVTAEAAKDLIKAGANVLKVGVGPGSICTTRVVAGVGVPQLSAIYNVYEFAKSKNVAVIADGGIKLSGDIVKAIASGAGAVMLGSLLAGTDEAPGEEIIFQGRKFKSYQGMGSLSAMKRGGKERYFQSEAKKFVPEGIEGRVPHKGKLEDVIFQLTGGLRAGMGYCGAKDIEALQKDTKMVMITGSGLKESHPHDVIITQEAPNYSL
>NZ_CP022282.1|WP_089028004.1|2754153_2754672_+|thioredoxin-domain-containing-protein
MSTLRIPIGPNDHVQGNPETARIVLVEYGDYQCPYCGHAFPLVRQFVKENQDDVAFVFRNFPLTDAHEYAMAAATVAEAAGKQGKFWEMHDLIYDNQNILNEALLNECVKVLKLDVNKIENEINTEELQNKIEADFEGGVRSGVNGTPSFFVNGQKWEDYDGTYDSFIDLIS
>NZ_CP022282.1|WP_172821068.1|2753686_2754148_+|redoxin-domain-containing-protein
MLEQGTPAPDFELHATPDQKLKRSDFLGKNLILVFYPADWSPVCGDQVSLYNEMLSIFHKYNADILGISVDSAWCHDAFMENRKLHFPLLADFNPKGEVSKAYGVYNEENGTSKRALFVIDPEGTIQWSYLSPDGINPGADGIIDALENLKQK
>NZ_CP022282.1|WP_089028002.1|2753374_2753572_+|KTSC-domain-containing-protein
MPSSVVHSYEYFPKTEILRIVYQSGAVYDYLKVPPIIVDQFKAFTSKGTFLNKVIKKKFKYIKIK
>NZ_CP022282.1|WP_034715439.1|2762001_2762253_-|type-B-50S-ribosomal-protein-L31
MKNGIHPENYRLVVFKDMSNDEVFLCKSTAETKDTIQYEGQEYPLIKMEISSTSHPFYTGKVKLVDTAGRVDKFMNKYKKFAK
>NZ_CP022282.1|WP_089028012.1|2762439_2763852_+|hypothetical-protein
MKFKLLLAFSFWMLLMAVSCNKDDISFDAPSQQLRFSRDTVFCDTVYHQVRSETYVVKVYNNEDKDISIPRINLEKGAASLYKINVDGKAGYDFKDVPLRKKDSLYIFVEIAPQATGPEAIAEDRVVFTSPAGQQHVTLFSVVQDAEFFIQTPTNPNVITNHTTWDNTKAKIIYGDLTINPNITLDIQPGTKVYFHKNSGMKVAAGATLNINGTLNNEVVLRGDRNDPYYDTIPKNWNSIRMDVGSTLNMNYGRLFGGTRGLEMKQTNATISNSFIHTFQEYGIYAINTTVNAKNLVMNNCGESAIGIFKGGTHNYIHSTIANYSAPYVMSQLNRNGIFATNEWKNDAGQTEQGALQLNVKNSIVYSDRDNSVNFEQTPGQVFNFQFQNCLLKYSNTSEAGFNFESNPNVIQSLKNEEPMFVNRFTAHLNLRVKPTSPAKNKGNLGVAASVPFDIANVSRTTSPTLGAYQ
>NZ_CP022282.1|WP_034678907.1|2763851_2764178_+|nucleotide-pyrophosphohydrolase
MEITNLQQQVDEWIKTIGVRYFNELTNMAMLTEEVGEVARIIARRYGEQSEKESDKSKDLGEELADVLFVTLCLANQTGVNLQEAFDKKMKIKTDRDKDRHQNNEKLK
>NZ_CP022282.1|WP_089028013.1|2764364_2765582_+|3-phosphoshikimate-1-carboxyvinyltransferase
MKLEKSKLEGDQTIQISGSKSISNRLLILESLFSNIKIGNLSNSQDTEMLTKALSENSEVVDIHHAGTAMRFLTSYFSIFEGRDTILTGSGRMKERPIKNLVNALRDLGADIEYMENEGFPPLKIKGKKITKSNVNVPANISSQFITSLLLIAGKLENGLEINLVGDITSRSYIEMTLDIITKFGINATFNGNTIKVEPFTNPSSVIHYEVESDWSSASYFYSICALGRKTLHLKSFYKQSTQGDSAIAKIYKEFFGITTIFSEDEHKITLQPDPNFSFPEKIELDMNNCPDIAQTLCVTAAALKIPFDISGLGTLRVKETDRLQALYNELKKIGTETEITDLTIKSVSFGEPEENISISTYQDHRMAMSFAPFCLIKELNIEEENVVEKSYPMFWKDLASILIS
>NZ_CP022282.1|WP_089028014.1|2765710_2766463_-|glucose-1-dehydrogenase
MSQKMKNKVAVVTGGSSGIGLAIAKRFAEEGAQVVITGRNQRTIDQAVAEIGPNSLGIQGDVSKLNDLTRIYQTVADHFGKVDTLIVNAGVYVIAPLVDFTEEQFDKVSDINFKGAFFSVQKALPVLNDGASVVLVSSTVNRKGVPNHAAYSATKAAVRSLARSFSSELLDRKIRVNTLSPGPVDTPVFASVTDSAEGALAMMEAMGNFTPAKRVAMPEELAAAALYLASDDSSFMLGAELLLDGGLKDL
>NZ_CP022282.1|WP_089028015.1|2766545_2767133_-|Crp/Fnr-family-transcriptional-regulator
MEDLSPFFENIKRKTHLSTENMERLTAAFQVVRIKRKQMIIQPGFVAKYRIYVLKGAFHSYVIDDKGNEHTIQFAVEDWWLSDYNSYIHQTPATQFVEALENSIILQIDHQAEQELKDANWELATLFRLMAEKSAAYLARRIVSNLTQSAEERYNDFVATYPKVVQRLPQYALASYLNMTREFLSKIRNDKVRKK
>NZ_CP022282.1|WP_089029864.1|2767338_2768322_+|phosphatidylinositol-specific-phospholipase-C
MRYLTILFFGIATTSTMLSSCSENVIGMDSEDKNLSLHDNKISKASLASVGIGNWMSGLEDNTSISKISIPGTHDSGAMREVPSNSGTAKTQNLTIREQLNAGIRFLDIRCRHIDNSFAIHHGAIYQNLNFDDVLSACYTFLDNHPTETIVMSVKEEYNASNTTRTFEQTFDSYIQKNPSRWDLGVNIPNLGSIRGKIKLLRRFSAGTSKGIDATSWADNTTFEINNPAASLKVQDYYQVGNNDDKWSKISALYNEAKADTSGKLYINFTSGYKPLIFGIPSIPTVSNNINPKLKTLFQSSPQGSYGIMPIDFVNAELAELIIKTNF
>NZ_CP022282.1|WP_089028016.1|2768408_2770238_-|alkaline-phosphatase
MKQIKIGVLLAMAIFSQNQAQNYSHYNVSNAHSHNDYEQEVPFWQAYYANFGSIEADVFLVNDKLWVAHTEKELSPDRTLESLYLDNISKQIKLNKGNIYPDSKKKLQLLIDVKQDYKTTLTALINILKKYPEITGNPGIRIVITGGRPQPGDFKNYPDYFFFDGDLDKRYTPDELKRVGLFSADLQALVKWNGKGIPRDEETDRIKKAVAIAHEQQKPVRFYGAPDFPNAWVNFIDLGVDYINTDHIPDLKKFLNTIPKNFYKNTKEYSTYTPTYKTDGIIKNVKNVILLIPDGTSLPQYYAAFTANKGKLNVFNMKATGLSKTNSSNAYITDSAPGSTAFATGVKTKNTFVGVDEMGKEIAQIPDIIASHGMTSGLISTGDVTDATPADFYAHSDNRNSSEPILKDFVGSKTKILIGGPTNGLTPENIQKIKEAKIDIYQDLKSVKKINNRTLVIDPLASQRITNGRGNWLADAFDLTLNDLKENKKGFFMMVEASQTDGGGHSNNIEQLVTELLDFDHVVGKAMKFADENKETLVIVLGDHETGGLTLLDGSLKDGWVFGNFSTNDHTSIPSSVFAYGPHSKNFTGLFENTEIFNKILEAYGIQKH
>NZ_CP022282.1|WP_089028017.1|2770405_2771914_-|RagB/SusD-family-nutrient-uptake-outer-membrane-protein
MNFFKKIFWVSGIAVVLSSCANELDVQPEGTPTEASFWKTENDLITGANAMYKPLSDSEFYGRGFFWFINASDDMVTGRAKSEADNAKNFSSNYIAAGDLETQWNKRYNVIGVANRVIRNIDNIQTSAAIKNKYLGEALFMSSRMYFELAYNYGNEKAGIPIIDRTKEPDTNPIPRAANVMDNYNYIVADLKKAAELLPAQEQLLAKDYGRPHKAAAWALLAKVYLFMKDWQNAAFWANEVMTKGNRSLLNNYADVFKAENNYSSEYIWSIPSTPKFNAVGSILPGVMLENKGWGLYNGWGYFQPTKELYDEYETGDLRRNTTILKLGDQFTFNGSPRTYASTNSLTGYQFNKYMDAFKYALNSGHVSANGDYPCTDLAVPIMRYAEVILIKAEAKIMMGQNADIEINMIRTRAGLASKNGCTLADLKHERRCELAGEWADRHRDLVRWGDAQSTYAQPLHGISGQVVWASRNFNPSVHNVWAVPQVEIVNSHGIIKQNAGW
>NZ_CP022282.1|WP_089028018.1|2771940_2774829_-|TonB-dependent-receptor
MTVLKTPVSVAYLTGRGLLIGALCISPVLLSQKKDSLKEKSIDEVVVVGYGTQKKSKVSGAVSEVSLDKLSSRSLSGIGEVLQGKTPGVTVVNEGGDPNGSPKVNIRGLGGINGETPLYVVDGVVFNGTPAINPNDIQDISVLKDASAAIYGARSSGGVILITTKRGKKGALTVDFDVKYGINKAWRLKESLNAAEFQDVMYQAFENAGKLGSLPLAFNAEKYADGRVTRTDWMKEIFRTGTIQEYNLNLSGGSEKSRFFVGMNHRNLEGILLNTQAKRYNFRVNSEHKIKDWLTIGENMYYNYSDGNTADTKSGYTGALVAAMYYPPNVPVYAPNGAFSGLPIDVAGGYGDMINPVAYLQRISIRNPTHEILINPYAEITLAKDLKFRSNFSQTFKIGTVKNFTYRVLEVGKIFDTNNLEYQSNNSSTALAEQLLTYKIALNKHNFDFLGGFTFQKTIDEGFAAKSYDFRSEVEVFQHLQNAADTNKDVSSYKYQQSLVSYLARVNYDYAGKYVVSVLGRRDGSSLVAKQNRFANYYAVSGAWVMSRENFMSDISWLSNLKWRGSYGILGNLGGISPQAVNPLMIRENNIIFGQDPSQNIAYYATTRPNPNLKWGKSEQTNFGLDASFLHNSLSLQFDYFVKNSKDQIFNVSLPSTATYNNQYINAGLFQDKGYELGINYNSKKTGDFSYSIGATFSQLKNTVKQLADVNEIFINSNGVRGVLKPTRIRVGESLYSYYGYKTGGIFNSQEEINNYKDINGNLIQPNAKPGDIKFLKKDGNTGTLNNDDFVNLGNPYPKFSYGLSYNMTWKNFDLNVFFQGVYGNKIFNGLKFISLNPGGTGQNYNMDREILNAWTPQNTNTDIPRLVQGDPSGNYSKVSDFYVENGSYLRLKNLTIGYSLPKELYGKLDVTKLRIYVTTNNLFTITKYTGFDPEVGMDTYGVDTGRYPQARSFIFGVEIGL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022282_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022282_3

3737932-3738059

Orphan

Consensus_repeat	Method
CCAGTTGAAAACAACGGTTGTCCTTGGCCAGATACTGACGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022282_3

>merge|NZ_CP022282|3|3737932-3738059|CRISPRCasFinder
CCAGTTGAAAACAACGGTTGTCCTTGGCCAGATACTGACGGTGATGGTGTTATCGACAAAGATGATGCTTGTCCTACAGTAGCAGGTCCAGCTGAAAACAACGGTTGTCCTTGGCCAGATACTGACGG

>NZ_CP022282|3|3|3737932-3738059|CRISPRCasFinder
CCAGTTGAAAACAACGGTTGTCCTTGGCCAGATACTGACGG	TGATGGTGTTATCGACAAAGATGATGCTTGTCCTACAGTAGCAGGT
CCAGCTGAAAACAACGGTTGTCCTTGGCCAGATACTGACGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022282.1\|WP_089028808.1\|3732121_3734767_+\|T9SS-type-A-sorting-domain-containing-protein	unknown	unknown	gnl\|CDD\|380191
NZ_CP022282.1\|WP_089028821.1\|3746432_3747464_+\|MoxR-family-ATPase	unknown	unknown	gnl\|CDD\|223786
NZ_CP022282.1\|WP_089028809.1\|3734842_3736462_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP022282.1\|WP_089028816.1\|3741688_3742438_-\|RDD-family-protein	unknown	unknown	gnl\|CDD\|377640
NZ_CP022282.1\|WP_089028814.1\|3740345_3741317_+\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|273203
NZ_CP022282.1\|WP_089028807.1\|3731267_3732026_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225818
NZ_CP022282.1\|WP_089028810.1\|3736582_3737041_+\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|376590
NZ_CP022282.1\|WP_089028819.1\|3744386_3745184_+\|DUF4129-domain-containing-protein	unknown	unknown	unknown
NZ_CP022282.1\|WP_089028818.1\|3743431_3744394_+\|DUF4013-domain-containing-protein	unknown	unknown	unknown
NZ_CP022282.1\|WP_089028806.1\|3729342_3731262_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|225814
NZ_CP022282.1\|WP_089028802.1\|3724728_3726441_-\|single-stranded-DNA-specific-exonuclease-RecJ	unknown	unknown	gnl\|CDD\|273193
NZ_CP022282.1\|WP_089028817.1\|3742464_3743448_+\|stage-II-sporulation-protein-M	unknown	unknown	gnl\|CDD\|376676
NZ_CP022282.1\|WP_089028815.1\|3741305_3741596_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|379642
NZ_CP022282.1\|WP_089028804.1\|3727440_3728256_+\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|372666
NZ_CP022282.1\|WP_089028812.1\|3738722_3739463_+\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237084
NZ_CP022282.1\|WP_089028803.1\|3726702_3727413_+\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|372666
NZ_CP022282.1\|WP_089028820.1\|3745198_3746362_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022282.1\|WP_089028801.1\|3724322_3724688_-\|four-helix-bundle-protein	unknown	unknown	gnl\|CDD\|319869
NZ_CP022282.1\|WP_089028813.1\|3739521_3740349_+\|UDP-2,3-diacylglucosamine-diphosphatase	unknown	unknown	gnl\|CDD\|277343
NZ_CP022282.1\|WP_089028805.1\|3728363_3729176_+\|M48-family-metallopeptidase	unknown	unknown	gnl\|CDD\|320693

Protein	Function_ID	Function_description	E-value
NZ_CP022282.1\|WP_089028808.1\|3732121_3734767_+\|T9SS-type-A-sorting-domain-containing-protein	gnl\|CDD\|380191	NF033187, internalin_J, class 1 internalin InlJ. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface-anchored proteins with an N-terminal signal peptide, leucine-rich repeats, and a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin J (InlJ).	5.06674e-32
NZ_CP022282.1\|WP_089028821.1\|3746432_3747464_+\|MoxR-family-ATPase	gnl\|CDD\|223786	COG0714, COG0714, MoxR-like ATPases [General function prediction only].	3.33601e-98
NZ_CP022282.1\|WP_089028809.1\|3734842_3736462_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP022282.1\|WP_089028816.1\|3741688_3742438_-\|RDD-family-protein	gnl\|CDD\|377640	pfam06271, RDD, RDD family. This family of proteins contain three highly conserved amino acids: one arginine and two aspartates, hence the name of RDD family. This region contains two predicted transmembrane regions. The arginine occurs at the N-terminus of the first helix and the first aspartate occurs in the middle of this helix. The molecular function of this region is unknown. However this region may be involved in transport of an as yet unknown set of ligands (Bateman A pers. obs.).	4.6146e-20
NZ_CP022282.1\|WP_089028814.1\|3740345_3741317_+\|glycosyl-transferase	gnl\|CDD\|273203	TIGR00661, conserved_hypothetical_protein, conserved hypothetical protein. This model represents nearly the full length of MJ1255 from Methanococcus jannaschii and of an unpublished protein from Vibrio cholerae, as well as the C-terminal half of a protein from Methanobacterium thermoautotrophicum. A small region (~50 amino acids) within the domain appears related to a family of sugar transferases. [Hypothetical proteins, Conserved].	3.0376e-40
NZ_CP022282.1\|WP_089028807.1\|3731267_3732026_+\|response-regulator-transcription-factor	gnl\|CDD\|225818	COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms].	4.0424e-43
NZ_CP022282.1\|WP_089028810.1\|3736582_3737041_+\|SsrA-binding-protein-SmpB	gnl\|CDD\|376590	pfam01668, SmpB, SmpB protein.	3.65369e-69
NZ_CP022282.1\|WP_089028806.1\|3729342_3731262_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|225814	COG3275, LytS, Putative regulator of cell autolysis [Signal transduction mechanisms].	2.0617e-32
NZ_CP022282.1\|WP_089028802.1\|3724728_3726441_-\|single-stranded-DNA-specific-exonuclease-RecJ	gnl\|CDD\|273193	TIGR00644, recJ, single-stranded-DNA-specific exonuclease RecJ. All proteins in this family are 5'-3' single-strand DNA exonucleases. These proteins are used in some aspects of mismatch repair, recombination, and recombinational repair. [DNA metabolism, DNA replication, recombination, and repair].	5.28876e-165
NZ_CP022282.1\|WP_089028817.1\|3742464_3743448_+\|stage-II-sporulation-protein-M	gnl\|CDD\|376676	pfam01944, SpoIIM, Stage II sporulation protein M. SpoIIM is on e of four stage II sporulation proteins that is necessary for the forespore inside the mother-cell to be properly internalized through the breakdown of peptidoglycans trapped between the membranes of the septum separating the forespore and the mother-cell. The four proteins working in sequence are SpoIIB, pfam05036, SpoIIM, SpoIIP, pfam07454, and finally SpoIID, pfam08486. D, M and P are in a complex with each other and the complex assembles in a hierarchical manner such that M, which serves as a membrane anchor, recruits P to the septum and P, in turn, recruits D to the septum.	2.66148e-25
NZ_CP022282.1\|WP_089028815.1\|3741305_3741596_-\|N-acetyltransferase	gnl\|CDD\|379642	pfam14542, Acetyltransf_CG, GCN5-related N-acetyl-transferase. This family of GCN5-related N-acetyl-transferases bind both CoA and acetyl-CoA. They are characterized by highly conserved glycine, a cysteine residue in the acetyl-CoA binding site near the acetyl group, their small size compared with other GNATs and a lack of of an obvious substrate-binding site. It is proposed that they transfer an acetyl group from acetyl-CoA to one or more unidentified aliphatic amines via an acetyl (cysteine) enzyme intermediate. The substrate might be another macromolecule.	7.52606e-16
NZ_CP022282.1\|WP_089028804.1\|3727440_3728256_+\|ferritin-like-domain-containing-protein	gnl\|CDD\|372666	pfam13668, Ferritin_2, Ferritin-like domain. This family contains ferritins and other ferritin-like proteins such as members of the DPS family and bacterioferritins.	3.09072e-38
NZ_CP022282.1\|WP_089028812.1\|3738722_3739463_+\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|237084	PRK12378, PRK12378, YebC/PmpR family DNA-binding transcriptional regulator.	1.68357e-110
NZ_CP022282.1\|WP_089028803.1\|3726702_3727413_+\|ferritin-like-domain-containing-protein	gnl\|CDD\|372666	pfam13668, Ferritin_2, Ferritin-like domain. This family contains ferritins and other ferritin-like proteins such as members of the DPS family and bacterioferritins.	1.11729e-47
NZ_CP022282.1\|WP_089028801.1\|3724322_3724688_-\|four-helix-bundle-protein	gnl\|CDD\|319869	cd16377, 23S_rRNA_IVP_like, 23S rRNA-intervening sequence protein and similar proteins. A family of functionally uncharacterized bacterial proteins, some of which are encoded by an atypically large intervening sequence present within some 23S rRNA genes. The distantly related bAvd protein, which also forms a homopentamer of four-helix bundles, has been suggested to interact with nucleic acids and a reverse transcriptase.	2.86043e-60
NZ_CP022282.1\|WP_089028813.1\|3739521_3740349_+\|UDP-2,3-diacylglucosamine-diphosphatase	gnl\|CDD\|277343	cd07398, MPP_YbbF-LpxH, Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain. YbbF/LpxH is an Escherichia coli UDP-2,3-diacylglucosamine hydrolase thought to catalyze the fourth step of lipid A biosynthesis, in which a precursor UDP-2,3-diacylglucosamine is hydrolyzed to yield 2,3-diacylglucosamine 1-phosphate and UMP. YbbF belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	9.17679e-53
NZ_CP022282.1\|WP_089028805.1\|3728363_3729176_+\|M48-family-metallopeptidase	gnl\|CDD\|320693	cd07334, M48C_loiP_like, Peptidase M48C Ste24p loiP-like, integral membrane protein. This subfamily contains peptidase M48 Ste24p protease loiP (formerly yggG)-like family are mostly uncharacterized proteins that include E. coli loiP and ycaLG, considered to be putative metallopeptidases, containing a zinc-binding motif, HEXXH, and a COOH-terminal ER retrieval signal (KKXX). They proteolytically remove the C-terminal three residues of farnesylated proteins. They are integral membrane proteins associated with the endoplasmic reticulum and golgi, binding one zinc ion per subunit. In eukaryotes, Ste24p is required for the first NH2-terminal proteolytic processing event within the a-factor precursor, which takes place after COOH-terminal CAAX modification (C is cysteine; A is usually aliphatic; X is one of several amino acids) is complete. Mutation studies have shown that the HEXXH protease motif, which is extracellular but adjacent to a transmembrane domain and therefore close to the membrane surface, is critical for Ste24p activity. LoiP has been shown to be a metallopeptidase that cleaves its targets preferentially between Phe-Phe residues. It is upregulated when bacteria are subjected to media of low osmolarity, thus yggG was named LoiP (low osmolarity induced protease). Proper membrane localization of LoiP may depend on YfgC, another putative metalloprotease in this subfamily.	3.95561e-109

>NZ_CP022282.1|WP_089028810.1|3736582_3737041_+|SsrA-binding-protein-SmpB
MKIEKTVNILNRRARFEYEIVEEVEAGMVLTGTEIKSLRSSKASIAESFCQFIDGELYIINMMIDEYKLGTFYNHKTKRERKLLLHKKELQKFEKKLKDAGNTIIPLKLYITDKGKAKVLIALARGKKLFDKREAIKDRENKRTLDRILKKS
>NZ_CP022282.1|WP_089028809.1|3734842_3736462_-|ATP-binding-cassette-domain-containing-protein
MLTVSNLSLQFGKRVLFDEVNIMFAKGNCYGIIGANGAGKSTFLKILTGKQDPTTGSVSLEPGKRMSVLEQDHFAYDQYNVLETVLRGNKKLFEIKAEMDALYAKEDFSDEDGIKAGELGVVYDEMGGWNSESDAQTMLSNVGIKDDMHWQMMGELENKDKVKVLLAQALFGNPDVLILDEPTNDLDIDTIAWLENFLADYENTVIVVSHDRHFLDTVCTHIGDLDYAKLNLYTGNYSFWYQASQLATRQRAQANKKAEEKKKELQDFIARFSSNVAKAKQATARKKMIDKLNIDDIKPSSRRYPAIIFEMEREAGDQILDVKGLEKTKDGELLFSNIDLNLKKGDKVAVLSKNSLAITEFFEILAGNIEADKGVVAWGVTTNQSHMPLDNTNFFQEDINLVDWLRQFTKNDEERHEEFMRGFLGRMLFSGDEALKSCKVLSGGEKMRCMFSRMMLQKANILLLDEPTNHLDLESITTLNNSLSNFKGNLLLASHDHEMLQTVCNRIIELTPKGIIDREMSYDEYLADKKVKELREKMY
>NZ_CP022282.1|WP_089028808.1|3732121_3734767_+|T9SS-type-A-sorting-domain-containing-protein
MNTKLLSLLFFLLLSFAGKGQIVTIPDWNFKTKLLSADSSNFTAKDLSGNYFKIDANNDGEIQISEAEQVSYILVDYSGISSLVGISSFTNLKNLYCRNNSLVSLDLQGLNNLQYLDCKNNLLTSIAIQGLINLQDLDCTNNQLTALDVQGCTNLKKIYCQFNPIPTLDFSGMSSLEYLDFEYNQITSLNLQGCTNLNDLRVKHNQLSTMNLQGLANLVYLSCEYNQLTSLNLAGCTSLMIFDCSYNNLTSLSVQGLIGLQNLTCSFNQLTSVNLQGAVKLEYFYCDNNSISALDVQGNTNLYFLICHNNLLTSLDLHGLANLNNAVLFNNQLATLNLLGCTNLLTLNCQSNQLTWLNAESSILLQNINCSNNPLSMLFIKNGSNENLTIDNLPGLQYVCCDPSQIGYVQNKVTMAGIVGCNVNAYCSFTPGGNYNTITGTVRFDEDNNGCDSNDEFFEHMKLKINDGTNVGYTFINNLGNYNFYTQAGNFTITGEPENSPLFQVIPASFSTSFADNNNHVFTKDMCVKAIGNSNDLEVVVAPVTAAVPGFNSKYRLMWRNKGNTTISGSVVLTFDHHKMNYVSSSLPVSSVSGDQITINFSNIKPFGNTASEIIFTINPPTHSTYPVHSGDILNFSAMVNPVAADINPLDNVFNYKQTVVNSFDPNDIICLEGNSIPVSMVGNYLHYIVNFENTGTAPAANVVVEMDIDPNDFDISTLQLQNSSHQVYTKVSGNKVEFMMKNANLGNGGHGNVLMKVMSKNNLIPGDHVENKANIYFDYNFPIVTNEEMTQIENVLQVVDVKKDDSVKVYPIPTKGDVTIEAGSKIISVEVYDGQGRILQKHTGVDSHSTKITIRSAGSGVYFMKIYTDKGLMLKKVIKN
>NZ_CP022282.1|WP_089028807.1|3731267_3732026_+|response-regulator-transcription-factor
MISAVIIDDDANLREGMKAMLGLYAPEIMVLGEAESVESGIKLIENIKPEIIFLDILMNDGTGFDILEQLNQKHEPTSNIIFITAHEKFAIKAFRFSALDFLLKPVDPDELKNVIVKIKNLQNKNNNYKHIELFLDNISKKTESFKKIALSTSEGIHLFDIKDIIRCESEDNYTKFYVKNHKTVIISKTLKEYEDLLRDHGFERIHQSHLINLNELKSYIKKDGGFVVMSDSSQLPVSQRKKERLQELINKL
>NZ_CP022282.1|WP_089028806.1|3729342_3731262_+|tetratricopeptide-repeat-protein
MEKKYFLLFFILPMFITAQNFRADSLIHIFKQETDTSKKTELLNMISDAYKTSDPVIMQKYALEALVSARKNNDKEEEAKAFQNLGTSHIILGNYDKALGNFNLSENILLSLKQEDKAVKGILAKVLGSKGIVYSEQNNYAKALENDFRAMRLYESINNRVQLAKIYNNIGVIYNSIDDGEKALNYFLKAYNIQKVIKDPALAVSCSNIGLIYLNNKDLKKAKAFFDESIIEFQKNPNKRDMGELYNNISQYYITKKDLKTAEKYLFDAVKISKDVENQFALSNTYLFLAKIYFEEGELDRSLDFVTKSLEISKELDLPEANMNGEKLLSDIFDKKGNKEQAFIHLKSYNTAKEKLSKIENAKERLKTELNFEFEKKQIEQNEKADWEKVKLIFAVLISATVLAGLFFFYRNKEREKTNLLQKQLTEFQHKALHLQMNPHFVFNCLAAISSFIMQNDKEDAIKYLAKFSKLMRLTLDFSQESAVAIDKEIEALRNYLELEQLRFNQKFDFVIDKDPLIEDDTALPSLLLQPYVENSVIHGVVPQKEKGMIKINFTQNQEFLICEIEDNGVGIETSKKLKENSVSVHKSMALEISRKRLETLEELEKKKVSLEIFELKNEKGESEGTKVLLMLPLQYIKN
>NZ_CP022282.1|WP_089028805.1|3728363_3729176_+|M48-family-metallopeptidase
MKKIILCVCFIGAIHTFQGQKISLGKITDVASKGAKALTFTNEDAVKLSKESVDWMDKNNPVAGAKDPYTIRLNKLFGKHKAQDGLNLNYKVYKVKDINAFACADGSVRVFSSLMDVMTDDELLAVIGHEIGHVKNQDTKDAIKSAYLKAAALDAASSASSTVATLNDSQVGKMANAFLDASHSKKQESEADAYSYDFMKANKYNVVAEYTAFKKLALLSEGSTQSGFQKMFNSHPDSEKRAQNIKKKAEKDGLWKDPGTVTLPTAKLTK
>NZ_CP022282.1|WP_089028804.1|3727440_3728256_+|ferritin-like-domain-containing-protein
MNILKLLDKFSDDKFFTTETSRLETITNISAFGKKAAVAAVPLGLGVAMATPVKAETHTTAVPGSFFKTALTEALQLALTLEYLENEYYSIGLGTAGLIPNADRTVFMQISKHESAHVGFLKSTLTSLGVTPGAMPNFDFTAGGNFAPFSDYSQFLVLAQAFEDTGVRAYKGQAGNVMSNKVVLQAALQIHSVEARHASQVRRMRANKGWIELANGGNMPAATNPVYAGEDVTTQAGYNTATAFGAAAGSAAYDEVLSGSDATSIASLFIV
>NZ_CP022282.1|WP_089028803.1|3726702_3727413_+|ferritin-like-domain-containing-protein
MKKTISVSNQGATLDTGRRNFLKLGGIGLAMAGLALVGCDDNDDFQMDQNQVFDLGKGDVGVLNYAYALEQLEADFYTKVVNSFYTGISNAERELFTDLYHHEVIHRDFFKAAISGVTSNVLPKLEFQYPNVNFSNRSSVLATAKALEDTGVAAYNAAGKYITNPDYLVIAGKIVSVEARHASAIRNLINPGSADFSGDDVIDANGLDVAKEPKDVVMAAGGFFKTPFTWKERGIN
>NZ_CP022282.1|WP_089028802.1|3724728_3726441_-|single-stranded-DNA-specific-exonuclease-RecJ
MSQKWIYRPEPDEEIVDRLSSSLGFGTFESKLLVLRGIDNYQKAREFFKPNLTDIHNPFLMADMQKAVERIATAIENGEKILVYGDYDVDGTTAVALMYLYLSKIVQKKYLDYYIPDRNSEGYGISTEGIDFAKENGFSLIIALDCGIKAIDMISYAQNLGVDFIICDHHLPGEEIPNAVAVLDPKRSDCRYPFKELSGCGVGFKLCQGLNTIYKIPDSELFELTDLLAISIAADIVSMTGENRVLAKMGLKTLRKTRNLGLRLLIPEDKLSHFEISNIVFEIAPKINAAGRISHGKAAVELMVSDNLKHAHQIVSDIMGLNDERRELDMNSTLSALNQIIESQQETKLTTIVYHPEWNKGVIGIVASRLIETYYKPTLVFTDGNNGEMVASARSVSDFDVHEALDLCSEYFLKFGGHHAAAGLSMEKSKFEAFKEKFEKVVTEKIQEHQKEASIIIDSEIEIDEINREFINFHRKLAPFGPHNMKPILSLKNQKLSGYIKTMGKDNNHVKFYIKQESTGRNIECVGFKLGQFSEDFRNKYFDLAFTLEENHWKGNVTHYLNIKDVKFRE
>NZ_CP022282.1|WP_089028801.1|3724322_3724688_-|four-helix-bundle-protein
MGNYKELIVWQKSIDLVTEVYSCTKNFPKEETYGLISQIRRSSISIPSNIAEGHSRRSQADYIQFLKIARGSCAEVETQLIISKNLEYLNLERFQYLNDKSLEISKMLNGLITKIQTNPKS
>NZ_CP022282.1|WP_089028812.1|3738722_3739463_+|YebC/PmpR-family-DNA-binding-transcriptional-regulator
MGRAFEYRKASKMARWDKMAKTFSKIGKDIALAVKAGGTDPEANPALRRCIQNAKGANMPKDNVERAIKKASGADAENYEEVTYEGYGQGGVAFFVECTTNNTTRTVANVRAVFNKFDGNLGKNGELAFIFDRKGIFYIDLAQVKMDWDEFEMEMIDGGAEDIDKDDEEIMITTAFEDFGSLSHKLDELKIEVKSAELQRIPNNTKEVTEEQFKANMKMLDRFEEDDDVQNVYHNMEITEELMNSL
>NZ_CP022282.1|WP_089028813.1|3739521_3740349_+|UDP-2,3-diacylglucosamine-diphosphatase
MRRNVELVVISDVHLGTYGCKAKELLRYLNSIQPKTLVLNGDIIDIWQFKKSYFPKPHLKVIKKILSFATKNTKVYYITGNHDEMFRKFTDFELGKLKVCNKICLDIDQKKTWIFHGDVFDASVQHSKWIAKLGGKGYDMLIVINNVVNWILEKMGKEKYSFSKKIKNNVKKAVKYIGDFELTASELAIDNHYDYVICGHIHQPQIRTVVNKKGSCTYLNSGDWIENLSALEYDNKEWKIFYYDEHKHLLQDDETEEIQDLDTTELLKIVTNFSE
>NZ_CP022282.1|WP_089028814.1|3740345_3741317_+|glycosyl-transferase
MKILYAFQGTGNGHLARAQEIIPILKKYAAVDTLISGHQSQLKADFDINFQYKGISLLYNKTGGLSYRKTFTQNKFVHAIKTLNELELKEYDLIINDYEPLTGWACKLKKLPMIELSHQASMSFAETPKPEKGDFLGELILKYYVPSERKIGFHFENYHPQIKKPVIRHKIRNLNPDKKGFYLVYLPSFSDENIIKILKQIPVQWKVFSKYSKVRIKIKNVEVFPIDETEYLKSFESCDGVLCNAGFEAPAEALFLDKKLFVIPIHNQYEQECNACALDKMGIPNSKVLKLGEIMEWVASDHHLKVDYPDDIENILLNEVLIL
>NZ_CP022282.1|WP_089028815.1|3741305_3741596_-|N-acetyltransferase
MKFENNKSGNGGVLTLNNELKEIGRLTYTIFPEESKFIISFVLVHPEFEGRGMGKYLVEEAIKFARENNWKVYPHCSYARSVMTRMNDVEDIFLKN
>NZ_CP022282.1|WP_089028816.1|3741688_3742438_-|RDD-family-protein
MSQIAINTSQNVNINFNIASVGERMLAFIIDLLIKVAYAVITFYIFFNFFDLGYLLNGLDQWSQMAIYIAITFPIYIYPVVLESLMEGQTPGKKVMKIRVVKIDGYQASFGDYLIRWVFRIIDTSFAGVIGLISMIVSKNNQRLGDIASGTAVISLKNNINISHTILENIQEDYIPSFPQVIALSDNDMRIIKDNYTKALRVDDRQIISKLSDKIKNILKLEIDPVKMTERQFINIVIKDYNYYTGKDS
>NZ_CP022282.1|WP_089028817.1|3742464_3743448_+|stage-II-sporulation-protein-M
MREVYFIKQNKEKWLGIEQVIQGKIKKNPDDLSSLYINLINDLSFAQTYYPKSNTTVYLNHLSSQIFQKIYKTKRIEENRILYFFKTEVPLLVYQYRRYLTYAFLFFALFTAIGVLSAIYDKDFVKIILGESYVNETIENIKKGNAVGVYQSGSTWGSTIGIIFNNIGVGAKLFIYGVFGGVGTLYALLSNSVMLGSFQYFFYDYGALKDSARGIWLHGVFEIFAMVVEAMCGLILGASILFPRTLSRFNSFKNGFKDSFKIFLSTIPFTICAGIIEGYITRHALKMPVILNLIIILGSLTVIGYYYFIYPIVVNKKINKNIHDAVL
>NZ_CP022282.1|WP_089028818.1|3743431_3744394_+|DUF4013-domain-containing-protein
MMQFYKKRDFGTFISDSFNFFKLYGKNYFKNYILLNGLLLILMVTVFIFGYKELFSQLFGSNMNGNSYYFQQYFEDNVGMLIVVGLLTFLLFLILMIVNYLYPVFYLKRISRGEEKIRTDDILSDFKNNAGRIGILCLGMIFIVTPLAFIVMGISYALILIIIGIFIILLVYPTLFNVVTFLMYDYFNSERGFFESLSYSIRSQFSYANGREKSPYWKYWGATIIIFLIIYIVTSIFTFIPMIFFYSSILTSAPDGNFEQNPFQGTMGILFFVVYGISMLLSFFLSNLMYVNSGLMYYDSRADLHQKIEFAEIETIGNNE
>NZ_CP022282.1|WP_089028819.1|3744386_3745184_+|DUF4129-domain-containing-protein
MNKTVFFLLIFFSLGFTYAQNGGDSSPVEEYIEDSLSTGHYKNMYRADSVLIKHPISDNTVYPKKFKKDLKERYKGSEFDYTTIKPKESFWQKLQRKLARIIEGIFGENSFGTSAKITTIVMRLFAIVLIGFLLYFIIRYLISKDGNFFFGKKNKKVNIHTEELHENIHEINFPESISQFEIAGDYRSAVRYQFLFILKKLSDKKLIAWNPQKTNKDYVAELKAEHLKKEFSNLSHIFDYVWYGEFSINEQDYLKFKSQYQTFKP
>NZ_CP022282.1|WP_089028820.1|3745198_3746362_+|hypothetical-protein
MNKTFKIYAVIFIIIMVILALLEVNKKEVTDWRKNFDVNEKSPFGLFVFNKESKDLFSDKLRKIDQTPYDYYNQNKKSSSNILIVEKEIDKESWRSILSEVSKGSDAMLIVSKIPKEISDSIGYYDSQISFNDQNVLKLTDKKYQNDFINLDKFPSGRGFSYVKPGVEILGKTVEKDNSDQANFIKVKFGKGNIYVHCEPLFLTNYYILKSGNIKYAQNVFSYLNDKETLWFVEAAGAKASSRFFMRFILSKPALKYAWWVFLGGLILFIFFNAKRKQRIVPVTEPLKNTSVEFVKSIGNLYLQEGDFHDMMAKKAQYFLNKVRMDLLIDTQNLDDEFAKKLQLKTGKSTEVINEAIDLIRKAQDPYASVMKEDLTRLNRILDEIIR
>NZ_CP022282.1|WP_089028821.1|3746432_3747464_+|MoxR-family-ATPase
MENLENENVENQSSINLDKKENDFQSRIDMIELRVSLEKVKSEIAKVIVGQESMVEHLLAALLSNGHVLIEGVPGVAKTITAKLLAKTIDVDFSRIQFTPDLMPSDILGTSVFSMKNSEFEFKKGPIFSNFILIDEINRSPAKTQAALFEVMEERQVTMDGTRYTMEEPFLVVATQNPIEHEGTYRLPEAQLDRFLFKINVGYPNLQQEILIIKNQHESRTEDKTEAVGRVITAQQLKNYQQLVKEIIVEAQLMEYIAKIIVNTRENQFLYLGASPRASLALLTASKAFAALRGRDFVTPEDIKEASYAVLRHRVIVSPEREMEGLSADEIIRQILEGIEIPR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022282_2	2.1\|2761892\|36\|NZ_CP022282\|CRISPRCasFinder	2761892-2761927	36	AP014362	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S41-C102, * SEQUENCING IN PROGRESS *	7244-7279	8	0.778

1. spacer 2.1|2761892|36|NZ_CP022282|CRISPRCasFinder matches to AP014362 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S41-C102, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.778

tacaaata---gtaaaaataatttctaacttctgcatct	CRISPR spacer
---aaatgtttataaaaataatctctaacttttgcatca	Protospacer
   ****.   .**********.********.******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1378161 : 1400799

Riemerella_phage(90.0%)

terminase,portal,capsid

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089026863.1\|1378161_1379184_-	hypothetical protein	F5A3A0	Riemerella_phage	8.4e-37	32.7
WP_089026864.1\|1379180_1379672_-	hypothetical protein	NA	NA	NA	NA
WP_089026865.1\|1379671_1384105_-	tape measure protein	F5A3A4	Riemerella_phage	5.1e-139	33.7
WP_089026866.1\|1384104_1384302_-	hypothetical protein	F5A3A9	Riemerella_phage	1.6e-16	69.4
WP_089026867.1\|1384319_1384766_-	hypothetical protein	F5A3B0	Riemerella_phage	5.7e-30	49.3
WP_089026868.1\|1384833_1385337_-	hypothetical protein	F5A3B1	Riemerella_phage	3.7e-38	46.4
WP_089026869.1\|1385351_1385759_-	hypothetical protein	F5A3B2	Riemerella_phage	1.9e-32	52.2
WP_089026870.1\|1385755_1386175_-	hypothetical protein	F5A3B3	Riemerella_phage	7.7e-29	50.7
WP_089026871.1\|1386165_1386495_-	hypothetical protein	F5A3B4	Riemerella_phage	6.9e-25	49.1
WP_089026872.1\|1386485_1386806_-	hypothetical protein	F5A3B5	Riemerella_phage	2.3e-25	51.4
WP_089026873.1\|1386808_1387879_-\|capsid	major capsid protein	NA	NA	NA	NA
WP_089026874.1\|1387896_1388265_-	hypothetical protein	F5A3B7	Riemerella_phage	7.5e-20	48.3
WP_089026875.1\|1388251_1388926_-	hypothetical protein	F5A3B8	Riemerella_phage	6.2e-20	46.8
WP_089026876.1\|1389056_1389362_+	hypothetical protein	NA	NA	NA	NA
WP_089026877.1\|1389387_1389669_+	hypothetical protein	NA	NA	NA	NA
WP_089026878.1\|1389676_1390246_+	hypothetical protein	A0A2R2Z2X9	Escherichia_phage	2.1e-13	36.4
WP_089026879.1\|1390422_1390680_+	hypothetical protein	NA	NA	NA	NA
WP_089026880.1\|1390724_1391444_-	hypothetical protein	NA	NA	NA	NA
WP_089026881.1\|1391474_1391885_-	hypothetical protein	NA	NA	NA	NA
WP_157676770.1\|1391886_1392237_-	DUF4160 domain-containing protein	NA	NA	NA	NA
WP_089026883.1\|1392353_1392893_+	hypothetical protein	NA	NA	NA	NA
WP_089026884.1\|1392893_1393937_-	hypothetical protein	F5A3C5	Riemerella_phage	1.4e-95	50.4
WP_089026885.1\|1393933_1395319_-\|portal	phage portal protein	F5A3C6	Riemerella_phage	8.6e-117	49.5
WP_089026886.1\|1395318_1396659_-	hypothetical protein	I6R9R5	Nonlabens_phage	2.5e-97	45.8
WP_089029804.1\|1396639_1397062_-\|terminase	terminase	F5A3C8	Riemerella_phage	1.8e-33	59.3
WP_089026887.1\|1397120_1397333_-	hypothetical protein	NA	NA	NA	NA
WP_089026888.1\|1397512_1398304_-	DNA methylase	F5A3C9	Riemerella_phage	6.1e-67	57.1
WP_089026889.1\|1398287_1399001_-	phosphoadenosine phosphosulfate reductase family protein	F5A3D0	Riemerella_phage	2.8e-87	65.9
WP_089026890.1\|1399143_1399488_-	hypothetical protein	NA	NA	NA	NA
WP_089026891.1\|1399474_1399894_-	recombination protein NinG	F5A3D2	Riemerella_phage	3.2e-27	49.6
WP_089026892.1\|1400035_1400383_-	hypothetical protein	NA	NA	NA	NA
WP_089026893.1\|1400385_1400799_-	DUF2693 domain-containing protein	F5A3D3	Riemerella_phage	2.4e-14	41.2

DBSCAN-SWA_2

3185435 : 3194432

Cellulophaga_phage(11.11%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089028329.1\|3185435_3186173_-	serine/threonine protein phosphatase	S0A0Y6	Cellulophaga_phage	7.2e-46	39.6
WP_089028330.1\|3186175_3186718_-	RNA 2'-phosphotransferase	A0A2R2ZGT8	Clostridioides_phage	2.5e-48	55.6
WP_089028331.1\|3186724_3187666_-	ADP-ribosylglycohydrolase family protein	A0A1S6UB21	Serratia_phage	1.6e-42	35.2
WP_089028332.1\|3187665_3188352_-	NAD-dependent deacylase	R9TG77	Vibrio_phage	1.1e-32	40.3
WP_089028333.1\|3188348_3188870_-	O-acetyl-ADP-ribose deacetylase	A0A0K1L687	Scale_drop_disease_virus	5.1e-30	44.7
WP_089028334.1\|3188853_3189501_-	DUF4291 domain-containing protein	NA	NA	NA	NA
WP_089028335.1\|3189497_3190313_-	TIGR02452 family protein	G3MBH6	Bacillus_virus	7.2e-47	40.4
WP_089028336.1\|3190302_3190689_-	ADP-ribosylation/crystallin J1	NA	NA	NA	NA
WP_089029889.1\|3190758_3191226_-	macro domain-containing protein	A0A2L1IVW3	Streptomyces_phage	7.0e-31	44.0
WP_089028337.1\|3191233_3192142_-	NAD(+)/NADH kinase	NA	NA	NA	NA
WP_089028338.1\|3192222_3193230_-\|protease	membrane protease subunit, stomatin/prohibitin	NA	NA	NA	NA
WP_089028339.1\|3193310_3193862_-	2OG-Fe(II) oxygenase	M1PY53	Moumouvirus	8.3e-15	27.8
WP_089028340.1\|3193889_3194432_-	NADAR family protein	A0A0E3TB23	Enterococcus_phage	9.0e-38	47.3

DBSCAN-SWA_3

3822945 : 3866378

Tupanvirus(50.0%)

tail,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089028875.1\|3822945_3823953_-\|protease	zinc metalloprotease	A0A2K9KZL9	Tupanvirus	5.1e-18	29.2
WP_089028876.1\|3824363_3825371_-\|protease	zinc metalloprotease	A0A2K9KZL9	Tupanvirus	1.2e-19	29.4
WP_089028877.1\|3825916_3826555_-	response regulator transcription factor	NA	NA	NA	NA
WP_089028878.1\|3826551_3827337_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_089028879.1\|3827315_3827963_-	hypothetical protein	NA	NA	NA	NA
WP_089028880.1\|3828002_3828542_-	hypothetical protein	NA	NA	NA	NA
WP_157676844.1\|3828796_3829678_+	hypothetical protein	NA	NA	NA	NA
WP_089028882.1\|3830032_3832627_-	ATP-dependent chaperone ClpB	A0A223W0B1	Agrobacterium_phage	8.2e-121	35.9
WP_089028883.1\|3833000_3833582_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_089028884.1\|3833694_3835014_+	AMP-binding protein	NA	NA	NA	NA
WP_089028885.1\|3835010_3836096_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_089028886.1\|3836171_3837110_+	1,2-phenylacetyl-CoA epoxidase subunit A	NA	NA	NA	NA
WP_089028887.1\|3837117_3837717_+	hypothetical protein	NA	NA	NA	NA
WP_089028888.1\|3837729_3838011_+	1,2-phenylacetyl-CoA epoxidase subunit B	NA	NA	NA	NA
WP_089028889.1\|3838102_3838852_+	phenylacetate-CoA oxygenase subunit PaaC	NA	NA	NA	NA
WP_089028890.1\|3838946_3839411_+	phenylacetate-CoA oxygenase subunit PaaJ	NA	NA	NA	NA
WP_089028891.1\|3839558_3840359_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_089028892.1\|3840483_3841617_+	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
WP_157676845.1\|3841618_3841933_+	hypothetical protein	NA	NA	NA	NA
WP_089028894.1\|3841935_3842349_+	hotdog fold thioesterase	NA	NA	NA	NA
WP_089028895.1\|3842432_3843638_+	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
WP_089028896.1\|3843741_3844335_+	transferase hexapeptide repeat family protein	NA	NA	NA	NA
WP_089028897.1\|3844350_3845178_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_089028898.1\|3845291_3846137_+\|protease	aspartyl protease family protein	NA	NA	NA	NA
WP_089028899.1\|3846177_3848673_+	phenylacetic acid degradation bifunctional protein PaaZ	NA	NA	NA	NA
WP_089028900.1\|3848724_3849420_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_089028901.1\|3849828_3850359_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_089028902.1\|3850373_3851075_+	SMUG2 DNA glycosylase family protein	NA	NA	NA	NA
WP_089028903.1\|3851142_3853821_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_089028904.1\|3853934_3854756_-	T9SS type A sorting domain-containing protein	NA	NA	NA	NA
WP_089028905.1\|3854792_3855338_-\|tail	phage tail protein	NA	NA	NA	NA
WP_089028906.1\|3855626_3856391_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_089028907.1\|3856511_3857129_+	hypothetical protein	NA	NA	NA	NA
WP_089028908.1\|3857191_3857482_+	transcriptional regulator	NA	NA	NA	NA
WP_089028909.1\|3857554_3858394_+	metallophosphoesterase	NA	NA	NA	NA
WP_089028910.1\|3858410_3858896_+	hypothetical protein	NA	NA	NA	NA
WP_089028911.1\|3858903_3860277_+	DUF4173 domain-containing protein	NA	NA	NA	NA
WP_089028912.1\|3860282_3860819_+	hypothetical protein	NA	NA	NA	NA
WP_089028913.1\|3860868_3861381_+	hypothetical protein	NA	NA	NA	NA
WP_089028914.1\|3861443_3863135_-	S8 family peptidase	NA	NA	NA	NA
WP_089028915.1\|3863225_3863675_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_089028916.1\|3863678_3864131_-	hypothetical protein	NA	NA	NA	NA
WP_089028917.1\|3864240_3864711_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_089028918.1\|3864734_3865124_+	HIT family protein	NA	NA	NA	NA
WP_089028919.1\|3865190_3866378_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.2e-105	49.1

DBSCAN-SWA_4

4063704 : 4072436

Caulobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089029070.1\|4063704_4065771_-	elongation factor G	E4ZFJ7	Streptococcus_phage	1.8e-62	29.3
WP_089029071.1\|4066243_4066912_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_089029072.1\|4066923_4067748_+	phosphoribosyltransferase family protein	K4JS16	Caulobacter_phage	1.7e-24	26.3
WP_089029073.1\|4067737_4068292_+	TerD family protein	K4JRX3	Caulobacter_phage	9.9e-32	42.3
WP_172821048.1\|4068298_4069459_+	toxic anion resistance protein	A0A291I9K4	Lactobacillus_phage	2.6e-26	25.9
WP_157676853.1\|4069498_4070419_+	hypothetical protein	NA	NA	NA	NA
WP_089029075.1\|4070588_4071200_+	TerD family protein	K4JRX3	Caulobacter_phage	1.2e-17	31.1
WP_089029076.1\|4071398_4072436_+	TerC/Alx family metal homeostasis membrane protein	A0A291LBC5	Escherichia_phage	7.2e-44	34.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022282

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection