CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP021646	Pseudoalteromonas piscicida strain DE2-B chromosome 1, complete sequence	3 crisprs	DEDDh,WYL,DinG,cas3,csx1,csa3	2	0	3	0
NZ_CP021647	Pseudoalteromonas piscicida strain DE2-B chromosome 2	0 crisprs	DEDDh,csa3,cas3,DinG	0	0	86	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021646_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021646_1

471557-472104

Orphan

Consensus_repeat	Method
TGGTGGGTTGTACTGGACTTGAACCAGTGACCCTCGCCTTG	PILER-CR

5 spacers

The CRISPR arrays of NZ_CP021646_1

>merge|NZ_CP021646|1|471557-472104|PILER-CR
TGGTGGGTTGTACTGGACTTGAACCAGTGACCCTTGCCTTGCTCAGGCTTAGTGCGATGCTTTGCATCGACCACTCTATCTAAAAATAAAGTGGTGGGTTGTACTGGACTTGAACCAGTGACCCTCGCCTTGTAAGGGCGATGCTCTCCCAACTGAGCTAACAACCCAAATTGTGTTTCAATTTATACTCTTGAATAGAGTTATGGTGGGTTGTACTGGACTTAAACCAGTGACCCTTGCCTTGCTCAGGCTTAGGCTTAGTGCGATGCTTTGCATCGGCCACTCTATCTAAAAAAATAAAGTGGTGGGTTGTACTGGACTTGAACCAGTGACCCTCGCCTTGTAAGGGCGATGCTCTCCCAACTGAGCTAACAACCCAAATTGTGTTTCAATTTATACTCTTGAATAGAGTTATGGTGGGTTGTACTGGACTTGAACCAGTGACCCTTGCCTTGCTCAGGCTTAGTGCGATGCTTTGCATCGGCCACTCTATCCAAAAAAATAAAGTGGTGGGTTGTACTGGACTTGAACCAGTGACCCTCGCCTTG

>NZ_CP021646|1|1|471557-472104|PILER-CR
TGGTGGGTTGTACTGGACTTGAACCAGTGACCCTTGCCTTG	CTCAGGCTTAGTGCGATGCTTTGCATCGACCACTCTATCTAAAAATAAAG
TGGTGGGTTGTACTGGACTTGAACCAGTGACCCTCGCCTTG	TAAGGGCGATGCTCTCCCAACTGAGCTAACAACCCAAATTGTGTTTCAATTTATACTCTTGAATAGAGTTA
TGGTGGGTTGTACTGGACTTAAACCAGTGACCCTTGCCTTG	CTCAGGCTTAGGCTTAGTGCGATGCTTTGCATCGGCCACTCTATCTAAAAAAATAAAG
TGGTGGGTTGTACTGGACTTGAACCAGTGACCCTCGCCTTG	TAAGGGCGATGCTCTCCCAACTGAGCTAACAACCCAAATTGTGTTTCAATTTATACTCTTGAATAGAGTTA
TGGTGGGTTGTACTGGACTTGAACCAGTGACCCTTGCCTTG	CTCAGGCTTAGTGCGATGCTTTGCATCGGCCACTCTATCCAAAAAAATAAAG
TGGTGGGTTGTACTGGACTTGAACCAGTGACCCTCGCCTTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021646.1\|WP_088529754.1\|476103_477024_-\|GTP-cyclohydrolase-I-FolE2	unknown	unknown	gnl\|CDD\|237466
NZ_CP021646.1\|WP_088529758.1\|481018_482641_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP021646.1\|WP_088529749.1\|465402_466128_+\|cell-division-protein-ZipA	unknown	unknown	gnl\|CDD\|367907
NZ_CP021646.1\|WP_010378832.1\|468731_469172_+\|peptide-methionine-(R)-S-oxide-reductase-MsrB	unknown	unknown	gnl\|CDD\|376583
NZ_CP021646.1\|WP_088529757.1\|480500_481022_-\|YfiR-family-protein	unknown	unknown	gnl\|CDD\|379335
NZ_CP021646.1\|WP_088529753.1\|474409_475999_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP021646.1\|WP_088529759.1\|482805_483834_-\|methyltransferase	unknown	unknown	gnl\|CDD\|181902
NZ_CP021646.1\|WP_088529755.1\|477345_479667_+\|aerobic-respiration-two-component-sensor-histidine-kinase-ArcB	unknown	unknown	gnl\|CDD\|236842
NZ_CP021646.1\|WP_088529745.1\|460257_460695_+\|energy-transducer-TonB	unknown	unknown	gnl\|CDD\|367555
NZ_CP021646.1\|WP_010379401.1\|485916_486189_+\|oxidative-damage-protection-protein	unknown	unknown	gnl\|CDD\|180059
NZ_CP021646.1\|WP_088529750.1\|466194_468213_+\|NAD-dependent-DNA-ligase-LigA	unknown	unknown	gnl\|CDD\|236137
NZ_CP021646.1\|WP_088529744.1\|459153_460161_+\|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|234629
NZ_CP021646.1\|WP_088529752.1\|469195_470827_-\|response-regulator	unknown	unknown	gnl\|CDD\|381123
NZ_CP021646.1\|WP_088529746.1\|460771_461068_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021646.1\|WP_088529751.1\|468217_468730_+\|DUF2919-domain-containing-protein	unknown	unknown	gnl\|CDD\|378569
NZ_CP021646.1\|WP_088529760.1\|483919_484645_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
NZ_CP021646.1\|WP_088529756.1\|479673_480393_-\|two-component-system-response-regulator-ArcA	unknown	unknown	gnl\|CDD\|183013
NZ_CP021646.1\|WP_088529748.1\|461994_465384_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274008
NZ_CP021646.1\|WP_174694546.1\|461195_461930_+\|RNA-methyltransferase	unknown	unknown	gnl\|CDD\|349982
NZ_CP021646.1\|WP_088529761.1\|484789_485851_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|182805

Protein	Function_ID	Function_description	E-value
NZ_CP021646.1\|WP_088529754.1\|476103_477024_-\|GTP-cyclohydrolase-I-FolE2	gnl\|CDD\|237466	PRK13674, PRK13674, GTP cyclohydrolase I FolE2.	1.20221e-117
NZ_CP021646.1\|WP_088529758.1\|481018_482641_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	4.36643e-31
NZ_CP021646.1\|WP_088529749.1\|465402_466128_+\|cell-division-protein-ZipA	gnl\|CDD\|367907	pfam04354, ZipA_C, ZipA, C-terminal FtsZ-binding domain. This family represents the ZipA C-terminal domain. ZipA is involved in septum formation in bacterial cell division. Its C-terminal domain binds FtsZ, a major component of the bacterial septal ring. The structure of this domain is an alpha-beta fold with three alpha helices and a beta sheet of six antiparallel beta strands. The major loops protruding from the beta sheet surface are thought to form a binding site for FtsZ.	2.70354e-48
NZ_CP021646.1\|WP_010378832.1\|468731_469172_+\|peptide-methionine-(R)-S-oxide-reductase-MsrB	gnl\|CDD\|376583	pfam01641, SelR, SelR domain. Methionine sulfoxide reduction is an important process, by which cells regulate biological processes and cope with oxidative stress. MsrA, a protein involved in the reduction of methionine sulfoxides in proteins, has been known for four decades and has been extensively characterized with respect to structure and function. However, recent studies revealed that MsrA is only specific for methionine-S-sulfoxides. Because oxidized methionines occur in a mixture of R and S isomers in vivo, it was unclear how stereo-specific MsrA could be responsible for the reduction of all protein methionine sulfoxides. It appears that a second methionine sulfoxide reductase, SelR, evolved that is specific for methionine-R-sulfoxides, the activity that is different but complementary to that of MsrA. Thus, these proteins, working together, could reduce both stereoisomers of methionine sulfoxide. This domain is found both in SelR proteins and fused with the peptide methionine sulfoxide reductase enzymatic domain pfam01625. The domain has two conserved cysteine and histidines. The domain binds both selenium and zinc. The final cysteine is found to be replaced by the rare amino acid selenocysteine in some members of the family. This family has methionine-R-sulfoxide reductase activity.	1.13738e-69
NZ_CP021646.1\|WP_088529757.1\|480500_481022_-\|YfiR-family-protein	gnl\|CDD\|379335	pfam13689, DUF4154, Domain of unknown function (DUF4154). This family of proteins is found in bacteria. Proteins in this family are typically between 172 and 207 amino acids in length. Many members are annotated as valyl-tRNA synthetase but this could not be confirmed.	1.42497e-21
NZ_CP021646.1\|WP_088529753.1\|474409_475999_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	1.25598e-58
NZ_CP021646.1\|WP_088529759.1\|482805_483834_-\|methyltransferase	gnl\|CDD\|181902	PRK09489, rsmC, 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC.	3.32403e-85
NZ_CP021646.1\|WP_088529755.1\|477345_479667_+\|aerobic-respiration-two-component-sensor-histidine-kinase-ArcB	gnl\|CDD\|236842	PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional.	0
NZ_CP021646.1\|WP_088529745.1\|460257_460695_+\|energy-transducer-TonB	gnl\|CDD\|367555	pfam03544, TonB_C, Gram-negative bacterial TonB protein C-terminal. The TonB_C domain is the well-characterized C-terminal region of the TonB receptor molecule. This protein is bound to an inner membrane-bound protein ExbB via a globular domain and has a flexible middle region that is likely to help in positioning the C-terminal domain into the iron-transporter barrel in the outer membrane. TonB_C interacts with the N-terminal TonB box of the outer membrane transporter that binds the Fe3+-siderophore complex. The barrel of the transporter, consisting of 22 beta-sheets and an inside plug, binds the iron complex in the barrel entrance.	2.13276e-13
NZ_CP021646.1\|WP_010379401.1\|485916_486189_+\|oxidative-damage-protection-protein	gnl\|CDD\|180059	PRK05408, PRK05408, oxidative damage protection protein; Provisional.	9.66757e-55
NZ_CP021646.1\|WP_088529750.1\|466194_468213_+\|NAD-dependent-DNA-ligase-LigA	gnl\|CDD\|236137	PRK07956, ligA, NAD-dependent DNA ligase LigA; Validated.	0
NZ_CP021646.1\|WP_088529744.1\|459153_460161_+\|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|234629	PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase.	0
NZ_CP021646.1\|WP_088529752.1\|469195_470827_-\|response-regulator	gnl\|CDD\|381123	cd17589, REC_TPR, phosphoacceptor receiver (REC) domain of uncharacterized tetratricopeptide repeat (TPR)-containing response regulators. Response regulators share the common phosphoacceptor REC domain and different output domains. This subfamily contains uncharacterized response regulators with TPR repeats as the effector or output domain, which might contain between 3 to 16 TPR repeats (each about 34 amino acids). TPR-containing proteins occur in all domains of life and the abundance of TPR-containing proteins in a bacterial proteome is not indicative of virulence. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays. Some members in this subfamily may contain inactive REC domains lacking canonical metal-binding and active site residues.	6.57418e-42
NZ_CP021646.1\|WP_088529751.1\|468217_468730_+\|DUF2919-domain-containing-protein	gnl\|CDD\|378569	pfam11143, DUF2919, Protein of unknown function (DUF2919). This bacterial family of proteins has no known function. Some members are annotated as YfeZ however this cannot be confirmed.	2.38408e-32
NZ_CP021646.1\|WP_088529760.1\|483919_484645_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	2.27753e-109
NZ_CP021646.1\|WP_088529756.1\|479673_480393_-\|two-component-system-response-regulator-ArcA	gnl\|CDD\|183013	PRK11173, PRK11173, two-component response regulator; Provisional.	3.9818e-153
NZ_CP021646.1\|WP_088529748.1\|461994_465384_+\|AAA-family-ATPase	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	0
NZ_CP021646.1\|WP_174694546.1\|461195_461930_+\|RNA-methyltransferase	gnl\|CDD\|349982	cd18109, SpoU-like_RNA-MTase, SAM-dependent RNA methylase related to SpoU-TrmH. RNA 2'-O ribose methyltransferase catalyzes the methyltransfer from S-adenosyl-L-methionine (AdoMet) to the 2'-OH group of ribose in tRNA or rRNA. It is part of the SpoU family of MTases, a subfamily of the SPOUT methyltransferase superfamily. The SPOUT methyltransferase superfamily is a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	7.42779e-71
NZ_CP021646.1\|WP_088529761.1\|484789_485851_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|182805	PRK10880, PRK10880, adenine DNA glycosylase.	0

>NZ_CP021646.1|WP_088529752.1|469195_470827_-|response-regulator
MSAPSIQNAKMLIVEDQPLALSYMKQSLEQLDFRNLKFAESADSAKELCTINKFDLIVCSFGLTKKQNGYQFYEELRYKQLIRSSTAFIFISSETSPELVHSVIELQPDDFLVKPFSIKELQNRIERVLKRKQALRHINLLVDDKNYSKALKALDSELDNKEHNYTSLLLKLKGELLLRLNQLEEAKSFYKSVLALQKFTWAKLGLVEALITNNEDVIAQKMLKTLIERPETRLPALDLLSKLEIKLNQYENAQQLLEQAIEMAPRNINRQQSLGRVAQINHDYEASYKAHKDIASFARYSIHDKPEVYLNAARAGIDFALSTDQSDQVTRLTRQTQQYLSDLKQQFPNAQTQAQIDVLNARVHYLKDEHKKAKQLLEQLEDEPVIRSVDSTLDKAKALHEVGLNHKAQELFSQVIAHCERHNSSADPVTMHYLYQQQQEKKEITMGPRELNNHAVTQFNKGQYETALEAFTQAFRIMPKNSGIALNLLQCMSDSCAKSGSTFNSNLAKRCTTLLNQSELDSEQQIRYGKLKAKLNEMKLDFE
>NZ_CP021646.1|WP_010378832.1|468731_469172_+|peptide-methionine-(R)-S-oxide-reductase-MsrB
MLKWLDILNFARNGNPVAPRRVDKSDQQWQSELAPETYMITRKKGTERPFSSQSCQLFEPGKYYCVCCGELLFDAEEKFDSGSGWPSFTQPAAVEAVAYHGDKSHGMTRVEITCNVCDSHLGHVFPDGPEPSGLRYCVNALAMEKK
>NZ_CP021646.1|WP_088529751.1|468217_468730_+|DUF2919-domain-containing-protein
MKPVIRYGPEYWDKYGVYRTPIAFNLALVVLLRPLLIWGFSALARRPDLDLMSLFFESKFHFFVATGIACIALIPTVVFSLRRPTSSPKLAAVWRYMRLPLILTAVLDLAWLILQAGKTHYSFSPYIAVQIVLVSWVLLYLIKSRYLSCFFGDWPLPVEEQKTEVNKREN
>NZ_CP021646.1|WP_088529750.1|466194_468213_+|NAD-dependent-DNA-ligase-LigA
MSDNIESQVAALRQQLEDYNYQYYVLDNPSVPDAEYDRVMRQLMALEQQHPELQSPDSPSQKVGGEALSKFEQVTHRVPMLSLDNAFDESEFTAFNRRLKERLLTSKDVTFCCEPKLDGLAVSILYRDGVLVQAATRGDGQVGENITENVKTIRNIPLKLRGDHIPHEVEVRGEVFMDTAGFIKLNETAQAKGDKTFANPRNAAAGSLRQLDSKITAKRPLMFYAYSMGLVEGGELANEHYAQLQQLQGWGLPMSPETKLVDNAQQALAYYQDIMTRRAELPYEIDGVVIKVNDKAQQEQLGFVARAPRWAIAFKFPAQEEITQLLDVEFQVGRTGAITPVARLEPVFVGGVTVSNATLHNGDEIARLGVKIGDTVIVRRAGDVIPQVTQVVLDRRPDDAKEIEFPDTCPVCDSHVERVEGEAVARCTGGLVCRAQRKEAIKHFASRKALDIDGLGDKIVEQLVERELIKTPADLFILRQGHFESLERMGPKSAKNLVAALEEAKQTTLAKFLYSLGIREVGEATAQNLANHFLTLEKVMAASIDTLQQVSDVGVVVAQHIHSFFAEQHNQEVVTALIEVGVTWQDVAAPSEDTQPLAGLTYVLTGTLSQLNRNDAKSRLQALGAKVAGSVSKNTDAVYAGEKAGSKLTKAQELGVEVFDEEALIALLNKYE
>NZ_CP021646.1|WP_088529749.1|465402_466128_+|cell-division-protein-ZipA
MATELRWALIVISALVIGGLLIHGLWSVRKKSSDKVSKKEPNELKEQTPNHDKEPDEPEIGEMTFSAVDDEPATEGIIATEAPETEVQTESSGSEEAEPEENAIEPQDFIILHVEMPEGLKMAGSRLLPTVLSLGFKYSDEGFFNRHLEPSGNGPVLFRLVNMYNPGTFDIDNMEQFSTAGISLFMTLPCEGDNLAAFNMLHSASKKLAEEFGATVLDKDREPLTVEAVRGYVEKVREFAA
>NZ_CP021646.1|WP_088529748.1|461994_465384_+|AAA-family-ATPase
MRLSSIKLAGFKSFVEPTKIPFPDQMTCVVGPNGCGKSNVIDAVRWVLGESSAKNLRGDAMTDVIFNGSTKRKPISQASVELIFDNTQGRLPGTFADRNQIAIKRLVTRDGQSLYFLNGSKCRKRDITDIFLGTGLGPRSYAIIEQGMISRLIESKPQELRVFLEEAAGISKYKERRRETQTRIKSTRENMERLLDVRQELQGQLDKLALQAQQASEYKSLKSQERDLKSWIAILKWQSLEQKQAIKAKEIAKLNEKLAFFNEAHSGHDSILATLEHEIKHFNDGYEQAQHSVHRIETQLATLEQQKVNLTDKKRQLIEQSQILKSQQQEVIEAQDEQAEYVASSAEKVDEVSEQLEIALLQLEEIQLTNEQSDAEQTQLEAQFSSAQKQYQQIHAKVQQGASQLAQQQQAKLHIEKRLVELQEQAEAHRASMLENDLAEAQDAHHQLVQAMAKLQSQAGKLQSQEQANKEEILLAESHAQKALQALQEVQSEIKALSRWANEASETSATTMLSQLVVESGYEECVEAALLGLTHLVVEQSEINTLWPIELEVPCDSIATKISSGLFPSFLSKIKLCAEPTDFRSCEQFLLGVTKSGVIVGDNFKAKAKSNEESGALKRYAQLQSCHIQLSHLQKLAEEAEQVVAQKRIALEDTQACLLKTQQCVHEKAQAIASHKTKVEMLDENLSAWRELGQKIQEQLDIIAQERAEVIEQLELYTEQQLQRDELLAQAQETQQLAEAKLTEFKQHSQSRRAALQEAQQLVHTTKLTSQQAESELQLSNSKLEHLQHRHDEINQRIEQTQEDILLCEEPLAEAHEDIELLLAQHLEAKAQKQTMLDTLNQAKENLSQKQAALKDAQGEVSKLNASLQQVKLEEQSLMIKAQAALEPLQELGRTLKAELAQLPEDANLGQYQANLSRVSNDLGKLGAVNLAAIEEFEEAKARKTYLDTQLDDLTNALETLEAVIRKIDKETKTRFSATFNQVNEDLAELFPKVFGGGSAYLELTSDDLLESGVSIMARPPGKKNSTIHLLSGGEKALTALSLVFSIFRLNPAPFCMLDEVDAPLDDANVGRFCRLVEEMSQTVQFIYISHNKVAMEMAGRLTGVTMAEPGVSRMVAVDIEQAVQMAQA
>NZ_CP021646.1|WP_174694546.1|461195_461930_+|RNA-methyltransferase
MISKNQQKLLRALGQKKYRKQHGLYLVQGEKNVIELVDAGLAVEQLFATSEFMTKYKSKLVNIACVEAEEEVLSKVSTLVSNNAAIAVVAMPPTEEINTAGLVLALDGVSDPGNLGTIIRLADWYGLTQLVVSENCADQFNPKVISATMGSFVRVNVVRTDLEAFLQQYQGECYGAFLGGESVHQCQFSRNAVLVMGSESHGISDSIAAHINKKVTIPAFGGAESLNVAMATGIILDNIKRCHS
>NZ_CP021646.1|WP_088529746.1|460771_461068_-|hypothetical-protein
MSPELTLILLNFILLFVAYVFVYPKLKEKSLASISKQDLLVTAVSLAVSGSLYYGKDIEFSLMFFESNWVVFTIVAFSVIEIPFLLWFKRRYNVKFGE
>NZ_CP021646.1|WP_088529745.1|460257_460695_+|energy-transducer-TonB
MKVQLLISVLVAGTCWEAEAKTLHGDVKSTQLSPSIEASIWQKKGNSIPKYPPALAKRKLAGCTVLKVMIDADGKTEDIEQIASIPSKTLAKHAKQLIKSWQWSPIDTQHLGREEKLMRIDFCLGGADLANAQMRCEAQAKLDCE
>NZ_CP021646.1|WP_088529744.1|459153_460161_+|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase
MSTAKSAVTVLGAGSYGTALAICFARNGHQVTLWGRNSEHVEALAAERKNQRYLPDIQFPNTLELEADLETAVKSSECILVVVPSHAFADTLKKIKPMLLENAKVAWATKGLEPNTGRLLQEVALDVLGDDVPLAVLSGPTFAKEMAAGLPTAISVSSICAKFREELAELLHCGRSFRVYSNEDFIGIQLGGAVKNVIAIGAGMSDGFGFGANARTALITRGLAELCRLGCALGARSETFMGMAGLGDLILTCTDNQSRNRRFGLALGTGKSVDEAMSSIGQVVEGYRNTKEVYLLAKRTGIEMPITEQIYQVLYEQKDVKEAAMALLGREKRAE
>NZ_CP021646.1|WP_088529753.1|474409_475999_+|methyl-accepting-chemotaxis-protein
MTKGRADYTGKENDYPSSYNLLSTTNVKGQIKYANSQFCEVAGFSLSELEGKPHNIVRHPTMPKAAFKNLWDYIEAGKPWMGMVKNRCKNGDHYWVNAFVTPIKDSSGKTVEYQSVRTKPSREVVNRAEGIYADLNNGVSLSKFTRSSWSLSAQMMAIIVVFYALSMLVSTLSSPWNYLAETLLTLTVLFVTYSRLAPVRSLSEKAKKVYDNPLMQKVYLNKVNDVASIELALLARESELRAVLGRVKDASATVSEYATKTVQECKTSSDILNRQQAQTGSLATAINQMTVSIGEIASNTNNAAQQSEAALESVVKGNKAVDDNMENNYALSEELSRTQKDIEDLNAQTVNIEGVVDVIRGISEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAQRTQDSTAEINGIIADLRQRAERAVTAIQSGVERSSECVLKAEGTKVSLETINTIVNEISGLNYQIATSTEEMSSVSNELNANAVTISGLADESMESARKTHETMKKTEQALDNQEVLVEQFIRKLNSTHR
>NZ_CP021646.1|WP_088529754.1|476103_477024_-|GTP-cyclohydrolase-I-FolE2
MQNNMPDIAHNASALQTGTLDWVGMGNIELPLVLESKGLNQVTVTAKADAFVNLQKEDAKGIHMSRLFLALDILSCEQVLTPSTLKQLLDNFLSTHSDLSTGAKVTLRFELPIRRPSLLSKKMGWKSYPITLDATLNNGIFKLELALDVAYSSTCPCSAALSRQLIQNAFQQSFDGKQLDFHSVHDWLGSTEGIVATPHSQRSIANIKVKLIDNCNEFEILELIELVENELKTPVQAAVKREDEQEFARLNGQNLMFCEDAARKLKALLNQQTYSDFYVKINHYESLHAHDAVAYAVKGVEDGYSV
>NZ_CP021646.1|WP_088529755.1|477345_479667_+|aerobic-respiration-two-component-sensor-histidine-kinase-ArcB
MTENSFGSWARILSNLVEKYGNKRAFAIAYAFTLFVAVILSCMFYYVALGVVEIVDISALFFLTAVIAPALIMMSVAAMREVHSSKAYLESATQQEKMLNQTLKDNINRLNSEIDERKIALHAKHRAIDELRKEIAERKKTQQELAQQGMLLRSIVDSSPDLFYYRDENGVFAGCNKMFELVMGKSSEELIGKSVEQIYSKQYLPKVLETDSQVSETQQPLTLDVEYPVKGEPRWFEMRKLPFINDKGEYIGLLAFGRDITSRKEAEQALETAYKDKGKFIATLSHELRTPLNGIVGLTRMMLDTDLTAQQKSWCNTVFSSAETLGNIFNDIIDLDKIDREQLDIATDSINVSDFINDVVNFAGLIADQKGLEFTINRSGVLDVYALLDPTRLRQVLWNLINNAVKFTHKGNVTLECRRENRDDGPWLTISVIDTGMGISEDQLERIFEMYYKAPDASGSNAIGSGIGLAVTKALVQAMQGTIAVTSQEGKGSRFDVEIPLQLCNAPKEQSYAGRSLYILLVEDVPLNAEIATNLLEQRGHEVIWAETGEDALSFVETEDDLDLILLDMQLPDINGDVVARQIREDSHFDHLPIVALTANVRSAEQELEGINVQGALAKPINTTKLDKMLAELFGIEAQKNKQSIDIREALSQPEYSDLDIETICDFVESMGAAAFQRSCDLFTKLNPKYCQELREAVAQNDIEEYGAVAHKVKGAAGSVGLQLAQLQAKKMELESEGKEVKTLLDWVSELEAKIEEGQEALHPLIAKLAEDQ
>NZ_CP021646.1|WP_088529756.1|479673_480393_-|two-component-system-response-regulator-ArcA
MQTPVILIVEDEDVTRLNLVSLFEAEGYKVIEAIDGDDMHDKLTSHDDVNLVIMDINLPGKNGLILARELRQKKNIGLIFLTGRDNDVDRILGLEIGADDYITKPFNPRELTIRARNLISRTGSSAEESTIDSNGVITFNGWELDENSRCLTSPTGDSKRLPKGEYRALRLMLDSPGRIFSREQLIKHMTGRELRANDRTVDVTIRRIRKHFETDNNTPELISTIHGEGYRFIGKLDAQ
>NZ_CP021646.1|WP_088529757.1|480500_481022_-|YfiR-family-protein
MRLINLVILLLFVSLNTAAKSPDQVRSAFLYQMAKFVEFPDENTKTSIQFCFYSLESGPASELKSATKLNVRGKPIELVEAKKTWSYSELSSACDITYIDETSENDILSAWTDTIESNMLTVGESIEFLERGGIASLVQEGSKIRLYINKQALEKQYFIVRSRLLAVSKFHPN
>NZ_CP021646.1|WP_088529758.1|481018_482641_-|HAMP-domain-containing-histidine-kinase
MSKQLTKTSIRKVLISAVMLVTALCLSLSISISTYLDVKEQKQLIINKIEMIADIVAFNSQITILFDDRKTEDARLKSFQQVDIIKNIHIYAMDDVTNSPVFFTSYNASRTPPVPLKVNQIEELKTPKVSEDYIELIKPVIYEGNIEGYVYVRGGLERLSNYINKKILVDIALTLFVLLLVLLVSRGIQKRIATPIEGLSALLQDVSKNHNYSARAPGSNIAELNVLANNLNIMLARTENQLERHKADKQEIKQLNQSLEEKVNQRTIALREANQELLNALERMHQYQNQIIENEKMASLGQMVAGVAHEVNTPIGLGITGSTLLRDKLSDIREAFQTKSLTSKQLERFVNDGIENLDLIYRNLNRAAELVSSFKRLAVSQDLEVNSQIDLSNLLTEVVASMRAELSTKQPEVTIDCDTGLAIESKAGPLQQVLEQLISNSLLHGFKDQQNNSISITVKSSMGQLTIEYADNGMGVPKAIKKRIFDPFVTTRRGEGGSGLGMHLVYNLVTQALGGSITLDEEFSQGAKFIITLPLSGNLK
>NZ_CP021646.1|WP_088529759.1|482805_483834_-|methyltransferase
MQFTNPSLLLLRNEEELIANNILVINHQRDGFLRELKALNPSSAIHAFSFDFADHLHADKIADVKSYVAHQLPQLQNIDLVIYYYPKSKPEAQMVFDNIRHLSTAETRLLVVGENKSGVKSAEKQLKEHAAHCYKLESAKHCILYEFDQLTANPSFDVSHYVQTFSVRIAKTEFTAASLPGVFNHGKLDAGTQLLLENVTLPYKGKVLDFGCGAGLIACYALLNSPTLKFTCLDVNALALFATQQTLALNNLSATLLLSDGLSELNGKFNLILSNPPFHTGLSTDYDIAEQFLHNIKRHMDTKSNIQLVANSFLKYPPILEAQFEQFEVVTKNTKFAIYKAQ
>NZ_CP021646.1|WP_088529760.1|483919_484645_-|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MNESSKSALEQAQEEGKYIRKVRSFVKREGRLTKGQAASLEKCWPAMGLEHQQGLLDFTEVFGNSNEVVLEIGFGMGKSLVEMAKNNPQQNFIGIEVHRPGVGACLMDADEQGVTNLRVFEHDAVEILADCIADGSLAKLQLFFPDPWHKKRHHKRRIVQLEFAEKIRQKLKVGGVFHMATDWENYAEHMLEVMSAAPGYQNQSQSNDYVPRPDFRPLTKFEQRGHRLGHGVWDLMFKRIS
>NZ_CP021646.1|WP_088529761.1|484789_485851_+|A/G-specific-adenine-glycosylase
MKVSQQQAKWFGEQVVSWYHLHGRKTLPWQLGKTPYKVWISEVMLQQTQVTTVIPYFERFMARFPTVIALADAPEDEVLHHWTGLGYYARARNLHKAAKVIRDSYKGEFPQTLEAVMDLPGIGRSTAGAILSLALGQHHPILDGNVKRVLARFYMVEGWYGVKKVENQLWALSDAVTPSCDVRAFNQAMMDLGSGVCTRSKPNCKACPLVEECAAFNNNRVNEFPNPKPKKAKPKKHAHHLIIKCDDKVLMEKRPSSGIWGGLFGFFEFAEQGELDAFIKQQELKLECTNTLEPFVHIFTHFELTITPVVVDVKSMPDCVHDQQLLWFDIHNPPEVGLAAPTKKLVKVLTAIG
>NZ_CP021646.1|WP_010379401.1|485916_486189_+|oxidative-damage-protection-protein
MARTVFCQKLQKEAPGLDFQLYPGEVGERIFNNISKEAWQQWQHKQTMLINEKHLNMMDPEHRQMLEEQMVGFLFEDKEVEIEGYRPPEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021646_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021646_2

644018-644128

Orphan

Consensus_repeat	Method
AAAGATTTGCCCAGATAGCTCATTCGGTAGAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021646_2

>merge|NZ_CP021646|2|644018-644128|CRISPRCasFinder
AAAGATTTGCCCAGATAGCTCATTCGGTAGAGCTGCTTGGAGTTGTATTGAAAATCCCTTTAGGATTCAGATACTAAAAAAGATTTGCCCAGATAGCTCAGTCGGTAGAGC

>NZ_CP021646|2|1|644018-644128|CRISPRCasFinder
AAAGATTTGCCCAGATAGCTCATTCGGTAGAGC	TGCTTGGAGTTGTATTGAAAATCCCTTTAGGATTCAGATACTAAA
AAAGATTTGCCCAGATAGCTCAGTCGGTAGAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021646.1\|WP_088529876.1\|652642_653104_+\|Spy/CpxP-family-protein-refolding-chaperone	unknown	unknown	gnl\|CDD\|197366
NZ_CP021646.1\|WP_088532232.1\|632474_632870_-\|polymer-forming-cytoskeletal-protein	unknown	unknown	gnl\|CDD\|377376
NZ_CP021646.1\|WP_088529864.1\|634132_635446_-\|fumarylacetoacetase	unknown	unknown	gnl\|CDD\|162276
NZ_CP021646.1\|WP_045987718.1\|646831_647107_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021646.1\|WP_088529870.1\|645850_646576_-\|sulfate-transporter-CysZ	unknown	unknown	gnl\|CDD\|179898
NZ_CP021646.1\|WP_088529862.1\|630665_631844_-\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NZ_CP021646.1\|WP_088529865.1\|635578_636625_-\|4-hydroxyphenylpyruvate-dioxygenase	unknown	unknown	gnl\|CDD\|273528
NZ_CP021646.1\|WP_088529875.1\|651748_652435_-\|response-regulator	unknown	unknown	gnl\|CDD\|223816
NZ_CP021646.1\|WP_088529873.1\|649418_650381_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
NZ_CP021646.1\|WP_088529872.1\|647851_648316_-\|tRNA-(uridine(34)/cytosine(34)/5--carboxymethylaminomethyluridine(34)-2'-O)--methyltransferase-TrmL	unknown	unknown	gnl\|CDD\|182406
NZ_CP021646.1\|WP_088529866.1\|637044_638481_-\|peptide-MFS-transporter	unknown	unknown	gnl\|CDD\|340904
NZ_CP021646.1\|WP_088529861.1\|628585_630424_-\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173803
NZ_CP021646.1\|WP_088529863.1\|632907_633990_-\|M23-family-metallopeptidase	unknown	unknown	gnl\|CDD\|366703
NZ_CP021646.1\|WP_088529868.1\|642216_643425_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP021646.1\|WP_088529874.1\|650383_651745_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|236532
NZ_CP021646.1\|WP_088532231.1\|632007_632478_+\|DUF4442-domain-containing-protein	unknown	unknown	gnl\|CDD\|373120
NZ_CP021646.1\|WP_088529867.1\|639068_641951_-\|response-regulator	unknown	unknown	gnl\|CDD\|236848
NZ_CP021646.1\|WP_088532233.1\|648621_649467_+\|cation-diffusion-facilitator-family-transporter	unknown	unknown	gnl\|CDD\|181919
NZ_CP021646.1\|WP_088529871.1\|647154_647748_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341398
NZ_CP021646.1\|WP_088529869.1\|644552_645770_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176503

Protein	Function_ID	Function_description	E-value
NZ_CP021646.1\|WP_088529876.1\|652642_653104_+\|Spy/CpxP-family-protein-refolding-chaperone	gnl\|CDD\|197366	cd09916, CpxP_like, CpxP component of the bacterial Cpx-two-component system and related proteins. This family summarizes bacterial proteins related to CpxP, a periplasmic protein that forms part of a two-component system which acts as a global modulator of cell-envelope stress in gram-negative bacteria. CpxP aids in combating extracytoplasmic protein-mediated toxicity, and may also be involved in the response to alkaline pH. Functioning as a dimer, it inhibits activation of the kinase CpxA, but also plays a vital role in the quality control system of P pili. It has been suggested that CpxP directly interacts with CpxA via its concave polar surface. Another member of this family, Spy, is also a periplasmic protein that may be involved in the response to stress. The homology between CpxP and Spy suggests similar functions. A characteristic 5-residue sequence motif LTXXQ is found repeated twice in many members of this family.	1.36348e-13
NZ_CP021646.1\|WP_088532232.1\|632474_632870_-\|polymer-forming-cytoskeletal-protein	gnl\|CDD\|377376	pfam04519, Bactofilin, Polymer-forming cytoskeletal. This is a family of bactofilins, a functionally diverse class of cytoskeletal, polymer-forming, proteins that is widely conserved among bacteria. In the example species C. crescentus, two bactofilins assemble into a membrane-associated laminar structure that shows cell-cycle-dependent polar localization and acts as a platform for the recruitment of a cell wall biosynthetic enzyme involved in polar morphogenesis. Bactofilins display distinct subcellular distributions and dynamics in different bacterial species, suggesting that they are versatile structural elements that have adopted a range of different cellular functions.	3.32822e-24
NZ_CP021646.1\|WP_088529864.1\|634132_635446_-\|fumarylacetoacetase	gnl\|CDD\|162276	TIGR01266, fum_ac_acetase, fumarylacetoacetase. This enzyme catalyzes the final step in the breakdown of tyrosine or phenylalanine to fumarate and acetoacetate. [Energy metabolism, Amino acids and amines].	2.41711e-178
NZ_CP021646.1\|WP_088529870.1\|645850_646576_-\|sulfate-transporter-CysZ	gnl\|CDD\|179898	PRK04949, PRK04949, putative sulfate transport protein CysZ; Validated.	6.09533e-117
NZ_CP021646.1\|WP_088529862.1\|630665_631844_-\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.0289e-77
NZ_CP021646.1\|WP_088529865.1\|635578_636625_-\|4-hydroxyphenylpyruvate-dioxygenase	gnl\|CDD\|273528	TIGR01263, 4-hydroxyphenylpyruvate_dioxygenase, 4-hydroxyphenylpyruvate dioxygenase. This protein oxidizes 4-hydroxyphenylpyruvate, a tyrosine and phenylalanine catabolite, to homogentisate. Homogentisate can undergo a further non-enzymatic oxidation and polymerization into brown pigments that protect some bacterial species from light. A similar process occurs spontaneously in blood and is hemolytic (see . In some bacterial species, this enzyme has been studied as a hemolysin. [Energy metabolism, Amino acids and amines].	7.62555e-141
NZ_CP021646.1\|WP_088529875.1\|651748_652435_-\|response-regulator	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	2.06378e-82
NZ_CP021646.1\|WP_088529873.1\|649418_650381_-\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	1.4227e-47
NZ_CP021646.1\|WP_088529872.1\|647851_648316_-\|tRNA-(uridine(34)/cytosine(34)/5--carboxymethylaminomethyluridine(34)-2'-O)--methyltransferase-TrmL	gnl\|CDD\|182406	PRK10358, PRK10358, tRNA (uridine(34)/cytosine(34)/5-carboxymethylaminomethyluridine(34)-2'-O)-methyltransferase TrmL.	1.40322e-88
NZ_CP021646.1\|WP_088529866.1\|637044_638481_-\|peptide-MFS-transporter	gnl\|CDD\|340904	cd17346, MFS_DtpA_like, Dipeptide and tripeptide permease A (DtpA)-like subfamily of the Major Facilitator Superfamily of transporters. The DtpA-like subfamily includes four Escherichia coli proteins: dipeptide and tripeptide permeases A (DtpA, TppB or YdgR), B (DtpB or YhiP), C (DtpC or YjdL), and D (DtpD or YbgH). They are proton-dependent permeases that transport di- and tripeptides. DtpA and DtpB display a preference for di- and tripeptides composed of L-amino acids. DtpC shows higher specificity for dipeptides compared to tripeptides, and prefers dipeptides containing a C-terminal lysine residue. The DtpA-like subfamily belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.20445e-153
NZ_CP021646.1\|WP_088529861.1\|628585_630424_-\|S8-family-serine-peptidase	gnl\|CDD\|173803	cd07477, Peptidases_S8_Subtilisin_subset, Peptidase S8 family domain in Subtilisin proteins. This group is composed of many different subtilisins: Pro-TK-subtilisin, subtilisin Carlsberg, serine protease Pb92 subtilisin, and BPN subtilisins just to name a few. Pro-TK-subtilisin is a serine protease from the hyperthermophilic archaeon Thermococcus kodakaraensis and consists of a signal peptide, a propeptide, and a mature domain. TK-subtilisin is matured from pro-TK-subtilisin upon autoprocessing and degradation of the propeptide. Unlike other subtilisins though, the folding of the unprocessed form of pro-TK-subtilisin is induced by Ca2+ binding which is almost completed prior to autoprocessing. Ca2+ is required for activity unlike the bacterial subtilisins. The propeptide is not required for folding of the mature domain unlike the bacterial subtilases because of the stability produced from Ca2+ binding. Subtilisin Carlsberg is extremely similar in structure to subtilisin BPN'/Novo thought it has a 30% difference in amino acid sequence. The substrate binding regions are also similar and 2 possible Ca2+ binding sites have been identified recently. Subtilisin Carlsberg possesses the highest commercial importance as a proteolytic additive for detergents. Serine protease Pb92, the serine protease from the alkalophilic Bacillus strain PB92, also contains two calcium ions and the overall folding of the polypeptide chain closely resembles that of the subtilisins. Members of the peptidases S8 and S35 clan include endopeptidases, exopeptidases and also a tripeptidyl-peptidase. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The S53 family contains a catalytic triad Glu/Asp/Ser. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	4.00579e-75
NZ_CP021646.1\|WP_088529863.1\|632907_633990_-\|M23-family-metallopeptidase	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	1.31219e-43
NZ_CP021646.1\|WP_088529868.1\|642216_643425_+\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	9.45465e-45
NZ_CP021646.1\|WP_088529874.1\|650383_651745_-\|HAMP-domain-containing-protein	gnl\|CDD\|236532	PRK09470, cpxA, envelope stress sensor histidine kinase CpxA.	5.2657e-86
NZ_CP021646.1\|WP_088532231.1\|632007_632478_+\|DUF4442-domain-containing-protein	gnl\|CDD\|373120	pfam14539, DUF4442, Domain of unknown function (DUF4442). This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 139 and 165 amino acids in length. There is a conserved PYF sequence motif. There is a single completely conserved residue N that may be functionally important.	6.27753e-68
NZ_CP021646.1\|WP_088529867.1\|639068_641951_-\|response-regulator	gnl\|CDD\|236848	PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional.	6.90638e-92
NZ_CP021646.1\|WP_088532233.1\|648621_649467_+\|cation-diffusion-facilitator-family-transporter	gnl\|CDD\|181919	PRK09509, fieF, CDF family cation-efflux pump FieF.	9.84173e-104
NZ_CP021646.1\|WP_088529871.1\|647154_647748_+\|CBS-domain-containing-protein	gnl\|CDD\|341398	cd04640, CBS_pair_proteobact, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in proteobacteria. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	1.20777e-14
NZ_CP021646.1\|WP_088529869.1\|644552_645770_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176503	cd08560, GDPD_EcGlpQ_like_1, Glycerophosphodiester phosphodiesterase domain similar to Escherichia coli periplasmic phosphodiesterase (GlpQ) include uncharacterized proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized glycerophosphodiester phosphodiesterases (GP-GDE, EC 3.1.4.46) and their hypothetical homologs. Members in this subfamily show high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	0

>NZ_CP021646.1|WP_088529868.1|642216_643425_+|serine-hydrolase
MFLRQSRLVFGWLIILLGCALLTACNNSDNAIVIENSASENITATPPRYGKVGDGLLSEQLEAIRAEFAMPALGGFIVYGDELIELDVAGVRVSTGQALVTKLDKWSIGSFSKSMTATVAARLVEQGLIRFDSRVSDVFPELVGKINPEFESVTLTALLSMTSGLKRDLDSMYSGKWHLDKRGMVEQRYAWTQEVLTTQPEVTHGTYLYSNAGYVVAGHMLERVTGQSWEALVKQEVFIPLGMANIGFGPASYGDPEGQPSGHQMREGQWHPITPADRVDLPNVVGPAGLVSTTLTDLSHYLRAYLAGARGGDNLIGANSYTRLLTPVSPEYGLGWILTPNNNSFHHNGFTGTFYLDNLVLPEKNIAILAVTNGDTSNAKQAVEKAILVMQQRFEAQYKDNL
>NZ_CP021646.1|WP_088529867.1|639068_641951_-|response-regulator
MPNSASTNANGRILFLFIAILTVGLCSAAGAYLLPKQTSAPTASTVNLKQQATTIAAPLAKVVTQHGFDNAKQIISALLASNERLGAYLYVNTGMGQPNLVFQQSAGEQIIALNREESYNKDTMQVYHMPLLLDEQNVGELILTYTPPVATTSSGDPFIAYILLAAAILSALMIVVIAARRLSGASSNDTEELISEINHLTMDKNYKSTVGTYYSGGLAEVAGAINALLKQVQSSIESDQATQNELKQLQESLETEVQARTLALEKAILNAERASDAKTTFLATMSHEIRTPMNGVIGTIDLLRQTDLDGAQHRLTTIIRDSAFSLLGILDDILDFSKIEAGKLRIDNSAFSVAETTEEVARVLSSVAKKRKLDLQLFIAPDIPTNLVGDTVRVRQVLYNLCSNAIKFTTTDDSTQGYVKISVEVAQNTSEHYTLRFTVTDNGKGMTKAQLREIFNPFIQAEGSITREFGGTGLGLSICKSLIELMLGSIHVNSDIGMGSEFVVELPFSVDGKVNYANKQMLNGRTVALLTPNSERRTILNRYLSFMGANVIIIDESEIAENQHEDKLIWVLDGLDGMNKVNEELRTVVYSLEKNEQQVVVLSKMDEAALNHKNIFYLNASPLCKSSFMTAILVAAGLHKPKEIKPSRTINDFLSVDDARATNKLVLLVEDNVLNQQVLTDQLHLLGFGVEVAENGEEGLELWKKEYFPIVLTDLHMPKMSGYDMVKHIRDYVETTTDNVEQPYIIAVTANALKGERERCEAGGMNDYITKPVELNVLEATLNKCIESLPKAQQPRQSAEPSAAEPVAVSQVQAGSKQETELEPAVDEAMIVEPEIIETETSEPAPAINMDMLDKYVNHDEAKRNRFFRMYLEQSSQLTRDVNGAVITMSQEEIIEACHQLKSISKTIGAEKVAETAVEFETLCKEGTLTTDQLILMRDKLEQDFLAATEFIQQYLSQEA
>NZ_CP021646.1|WP_088529866.1|637044_638481_-|peptide-MFS-transporter
MNSVPKAGEFLGHPKGLFLLFGTEMWERFGYYGMRAILVLYLVAQVQNGGFGWSNADALSLYGTFTMAVYLTPLFGGWLADNVLGQRKAIIIGGILMAAGHFIMGIPHSVVAGQEVNVFYLGLALLCLGNGLFKPNISTMVGDLYQEGDKRRDGAFTIFYMGINLGGALGPLVAGYVAAVINWQAGFIAAGVGMIISVVMQLILSQKYLGDIGKVPSAKLSQQMSDSLTKEPLTKKEKDRIRVIFTMSVFSIIFWMGFEQAGGLMNLFANDYTNRMFMGFEIPASWFQSLNSIFIIVFAPLVAMIWLKLDNKEPNSPVKFAIGLVFLALGFLTMMLALATEGGEAGGTLQISMIWLVLFYMFHTLGELCLSPIGLSMVSKLAPLRLASLLMGIWFLCTAIANKLAGLVGSFIGEGQEAMENAMSIFIGLGGVALLSAVLMYLLSNKLVDWMHGAEGKHEPHTQEHYLAEELEVSAEKQ
>NZ_CP021646.1|WP_088529865.1|635578_636625_-|4-hydroxyphenylpyruvate-dioxygenase
MSEVNNPLGLVGIEFTEYATPDADYMDKVFTDFGFSKLKKFKDKDIVYYNQHDIHFLLNNEREGFSAQFAKSHGPAICSMGWRVENAQKAFDTAVERGAKPATDSTHKDLPYPAIYGIGDSLIYFIENFGDKGSIYEQDFVDLEEQKIVEDKGFKRIDHLTNNVYKGTMETWANFYKDVFGFTEVRYFDIKGQKTALLSYALKSPCGTFSIPINEGKDDNNNQIDEYLDEYNGPGVQHLAFLTDDLVGSLDKLDKSTIATLDIVDHYYDTIFDRVPWVKEDKEKIKQHQILVDSQSEDCYLLQIFTKNLFGPIFIEMIQRVDDGGFGEGNFQALFESIERDQERRGVI
>NZ_CP021646.1|WP_088529864.1|634132_635446_-|fumarylacetoacetase
MSQINETHDIQLKSWVASANATGTDFPIQNLPFAVFRRKNSNEEFRGGVAIGDQVLDLGAVVDANLFSGDAAEAAEAANAPALNEFMGMGQQYWSALRLALSRALREGSELQSSLEGALVAQDDVEYALPCHIGDYTDFYTSIYHATAVGSLFRPDNPLLPNYKWVPIGYHGRASSIGVSGQTFPRPKGQTKAPDADTPSFGPCKRLDYELELGIYLGKGNELGDSIAIKDAEDHVFGFCLFNDWSARDLQAWEYQPLGPFLAKNFASTVSPWVVTTEALAPYRTHWHRDESDPQPLEYLESTQNRESGAIDIRMDVLLETEKMRSEGAKPSKLSESSFKHSYWTVAQMVTHHTVNGCNFLPGDMLGSGTQSGPEHVEAGSLLELSRGGKETITLENGEERKFLEDGDKVIMRGWCEAQGYNRIGFGCVEGTVLPAK
>NZ_CP021646.1|WP_088529863.1|632907_633990_-|M23-family-metallopeptidase
MLQVLKRLYLKLFKPTQLIVRQDATVKMLKLPSWVQACSILILLAVAIWIANASLKLQENGDKLTKEQQNLAQLQAKWQTEKSQLQAQLAQQKGMLDQLSQQHSVLESLVDSTQTTDDSAVEGELEETPTDIDGAQPSTTTEFAPQASLLLIQQRQLSEQLGQSFGAEIAAMQESIDSAGLQLSSDFSEAQGGPYFQADLELVEASFINAIDQYAVYAQLSTMIGQLPDTLPVAQEKYYVSSAFGFRKDPITGRRAYHKGIDLAGWHKTQIVAPASGTVKRAGKNGGYGNFIEIEHANNITTRYGHLHTIKVKAGQQINKGDVIALMGSTGRSTATHLHYEVIQGKKHLNPIKIARAFNK
>NZ_CP021646.1|WP_088532232.1|632474_632870_-|polymer-forming-cytoskeletal-protein
MFNSFKNQRNDVPAIIAQSTRITGDIVCEGELQLDGTVHGNLDIEKLIIGSKGLVQGHIQANELTILGRVEGDIQAKQVTLLPSAQVLGNIEHETLTIEAGAHVDGKLTHRNERANNVTPIDSADDQTINH
>NZ_CP021646.1|WP_088532231.1|632007_632478_+|DUF4442-domain-containing-protein
MSAPLLKIYKRISWLPFGKWMFSKAVCRKAPYFGTIKPKITQLKPGVCRATIRNRKAIHNHIGTVHAIAQCNLAELCAGVMTDATIDHKTHRWIPKGMSVQYLAKAETDLHAVAQIEYPRPWQDKEELVVPVEVFNTAGEKVFHADINMYISAKRS
>NZ_CP021646.1|WP_088529862.1|630665_631844_-|multidrug-effflux-MFS-transporter
MTQSNSKALIFILALLVIFCPLGIDLYLPAFVDMQTSLQVSESQIQQTVSIYMLAVGLGQLIAGPLADKYGRKPVALVGIILFALGAAMASTVSTWPLMMVARVLQGLGACATFVSAFAIVRDSFGHKGSGQMITYLNGIVCFIPALAPILGAWLTVEFGWQSNFSFLFGFAVVGLVLVSLIYKETRPEDTHYSGHILDLRRFKPMLSSSTFIYNAALAMLGMAAMLVFVISAPGWIMAKMGGSVSDFTFWFTGNAVLSIVASFIAPHFIKRNSQKSLTFGLAVFSFSGLLLLALPQTEIAHFVLPMYMASVGFAFTIGAAAGKALSGFAKQAGTASALIGVLQMSGAGILATMTQPLALDAPMQLALHLLLALPFLLLLATKHRHQLHSAA
>NZ_CP021646.1|WP_088529861.1|628585_630424_-|S8-family-serine-peptidase
MKLNKLTGALLIAGACAMSQAQASDDRYIIQVDNSKKGVVKALAKKLGAELHVDGDGFFAATFTGKDLSQVKGLLNNPHIKLVEADQKRYPLGIYNDDAGNPMQQQVTPYAVYQSQADQLTFDANAGMKVCVIDSGLDQSNPDFIWGNITGDNDSGTGNWYENGGPHGTHVAGTIGAADNNIGVIGMAPGVPMHIIKVFNAEGWGYSSDLAHAANLCSQAGANIINMSLGGGGSNNTESNAFENFRNAGGLVVAAAGNDGNNVRSYPAGYPSVMMIGANDADNQIADFSQYPSCTSGRGKRATNDEHICVEVTAGGVDTLSTYPADMATSSSMTADGAAFASSAMENSGNASGSLYFMGTAEATDGAANGKVCLIDRGNVSFHDKVANCEASGGIGAIIVNNEAGMLYGTLGDTNSTSIPAVGAAFEDRTALMAATNANISIGTSDYGLMSGTSMATPAVAGLAALVWSNHPECTGEEIRSALKATAADAGAAGKDVYFGYGIVKAADASAYLTANGCAGGGTGSGGGDNTTSVELSASGYKQKGNSYVDLSWNGASTSQVDIYRNGSKIVTTSNDNSHTDSISVKGGGTYGYQVCEQGSTATCSATQTVVF
>NZ_CP021646.1|WP_088529869.1|644552_645770_-|glycerophosphodiester-phosphodiesterase
MRQIIWITWLAVVLTGCQAIQRFDVGTRPQFLVSQLPDGELKEKLTGCLDKPIMRTRFSIGHRGAPLFYPEHTKESYMAAAKMGAGTLECDVTFTKDKTLVCRHAQCDLHATTDILLQPKLASKCRQPFTPANPDSSTLASAQCCTSDITLAEFKQLKGKMDGVNRQATTVAEFVRGTPYWRTDLYASSGTLMTHSESIALFKQLGVNMSPELKAPEVPMPFNGLSQSQLAQKMLDEYTEHNVPPSQVFPQSFSYQDIQYWIKHAPEFANHAVFLDGREAGEQFDINKPSTWQPSMEDLVKNKVKIIAPPIWMLISEDKNGDIIPSQYALAAKRAGLKIIAWSLERSGPLANGGGWYYQSVKNAVKHDGDILRVLDILTKQVGVVAVFSDWPATTSFYASCMGIE
>NZ_CP021646.1|WP_088529870.1|645850_646576_-|sulfate-transporter-CysZ
MQLSRGIEYFIAGFSLITQKGLKRFVFIPLTINVLLFGASLFFLYDWLTQGFNYLNGLLPDWLSWLEWLMWPIAILVILFSYSMIFTVITNFIAAPFNGLLSEKVELYLTNQQINDDKLIDTVKDVPRMLGREWTKLCYYLPRALGFFILLWMLPIVGQILWIMFTCWMYSVQYNDYPFDNHKIHFKQMKDDLKSKQGLSYGFGFAVFVLTSIPFVNLIVMPVAVCGATKLWVENYRQQYR
>NZ_CP021646.1|WP_045987718.1|646831_647107_+|hypothetical-protein
MRLVRWMITFCMLSLLTVSTADAAKCDTTLSIAPIVVDLDNSNSSPDLDDCVVSTTHRFVVASSFIIAQSQPTYSYSNSVCESIRAPPVAN
>NZ_CP021646.1|WP_088529871.1|647154_647748_+|CBS-domain-containing-protein
MNTYTVLKTQPVANYELAENNFPACNTDNLEQAPAHCLMHNLHLAPMQHIDENSSIDEATLVLDKTHRRASFVVNSKEKLVGMISNARIGSRYVLSIAERRGCTRRDLNVNDVMIPLSDLRQITLKQTSQTVVGNVLKTMEEGGFEFLLVIDEVTQHPVGYFDLIDMMKACGRAVNSMKPANKFSDIVGTILHHAEI
>NZ_CP021646.1|WP_088529872.1|647851_648316_-|tRNA-(uridine(34)/cytosine(34)/5--carboxymethylaminomethyluridine(34)-2'-O)--methyltransferase-TrmL
MLDIVLYQPEIPPNTGNIIRLCANTGYSLHLIEPLGFEWDDKRVRRAGLDYHEFSEVERHPNFEAYLAKRSPKRVFACTTKGTKYHHEVAYEAGDCLLFGPETRGLPEDIIFSLPEPQRVRIPMRPDSRSMNLSNAVSVFVYESWRQLGFAGAK
>NZ_CP021646.1|WP_088532233.1|648621_649467_+|cation-diffusion-facilitator-family-transporter
MVGLMIAAKCWAWLSSGSAAMLGSLTDSLLDISASLMNFFVLSYALRPADDDHRFGHGKAEALAGLGQAAFIAGSASLLAFHGVERIINPTHIPHSLFGVWVSLFAIVCTLLVVAVQYQVVKRTQSIAIKADSLHYKGDILLNLAVLLAVLLNFYGVGYADPIFGILVAMYLLYNSWDIAKESAAHLMDKELPDEEKAQIILIASSHEDVYGVHDLRTRQGGKIKFIQLHLELDDDMPLMRAHQVADEVVASIKEEFDCEMDVLIHQDPVSLALSSSAANA
>NZ_CP021646.1|WP_088529873.1|649418_650381_-|alpha/beta-hydrolase
MFYSQSQQLESHLPEIDEHWQGCQKGFFDTPHGRLFYAYHIPEKATFSLVLVNGRIESAHKYRELLWEFAQNNIAVFTYDHPGQGYSPRLLKDKQVGYVRRFEDYAATLHCFMDQIVAKQNTLPLFILAHSMGGAITCDYLSLFRPHNIEGIYLSAPMLGINTTPYPAWFAEGLAGAACLFGLGKHYALGQVHYHSKPFQDNDLTDCPIRYALFRGLYDQFPELQLGGVSFAWLYTALHKCRSFRDSKLDLPIRIATASEDSIVDNQAQSQFAAHRDNVTLTEFTGKHELLCEQDNTRKAVLDDFYAFAAELLSAKETGS
>NZ_CP021646.1|WP_088529874.1|650383_651745_-|HAMP-domain-containing-protein
MKRYLLVKVFAWFWLTIIATMLLLLGISMLQPDVVETHRISKPMLQNLKHIEQALVRASERPNFELSKVAKLRKRKARNIYLSHRDAEKSVAADPNIKTLNLDLLSFTEDAKPVAIFTPEYKAFGPLELTLLGESYRLYLIFENHTPSALIKLRTLPLWVKIAVVLGASLLLCFWFTRDLLSPIKELQKAAAKLSRGELSSRANINTKRQDELSQLGHDFNLMADKLESLVNNQKRLLADISHELRSPLTRLQMATGLAAGHATAQSQSYIERIEREAQLVENMLSDILHLSKLEADQVPIDKQIIKLNELLDPILEDALFEAQQLGKDLVVTALPEATLYGDPMLLNRAFENIIRNAIKYATSRISVDIESDGNQLRCSISDDGKGVSEDMLDKLCIPFFRVSSARTPTKNQMGGFGLGLAIAQHALKVHDAHIEFSNNIGLQVSIRIPLHR
>NZ_CP021646.1|WP_088529875.1|651748_652435_-|response-regulator
MKHSILLIDDDQELCSLLKEYFTAEGFEVAMAHTGTQGLQLALKKNFDLILLDVMLPEMDGFEVLKALRVQKMTPVIMLTAKGDDFDRIFGLELGADDYIPKPFNHRELLARVKAITRRVDHYKQHSQDDTFTIQQLRLDVASRSATVNGEVLSLTGTEYEVLHLLVRTAGEVVDKQTISRQVLGRPLVPYDRSIDMHVSNVRKKIAALSEHTYIKTIRGAGYIFLKA
>NZ_CP021646.1|WP_088529876.1|652642_653104_+|Spy/CpxP-family-protein-refolding-chaperone
MKLLSTLALVTALGVSTFSFTANASPMGRQLEHSARLLLSDKGQKLLELTEAQQSQLKTIYADYKTAKKALKESGKEAHSAYREEMKALMAAPTFDKVQAQLLLEKGQDKKQAWALLSMETRHKVFHVLNEEQRDKLQALKSRRSHKGHKKVD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021646_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021646_3

2175640-2175751

Orphan

Consensus_repeat	Method
TCGGAGTAGGAGCTGCTTTACGCAGCGATCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021646_3

>merge|NZ_CP021646|3|2175640-2175751|CRISPRCasFinder
TCGGAGTAGGAGCTGCTTTACGCAGCGATCTCTAAAAGCCATTACCACACAACATCACCACCCGATATAACCAGCTTTGCATCGGAGTGGGAGCTGCTTTACGCAGCGATCT

>NZ_CP021646|3|2|2175640-2175751|CRISPRCasFinder
TCGGAGTAGGAGCTGCTTTACGCAGCGATCT	CTAAAAGCCATTACCACACAACATCACCACCCGATATAACCAGCTTTGCA
TCGGAGTGGGAGCTGCTTTACGCAGCGATCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021646.1\|WP_017218861.1\|2170499_2170859_-\|cytochrome-o-ubiquinol-oxidase-subunit-IV	unknown	unknown	gnl\|CDD\|131894
NZ_CP021646.1\|WP_088530932.1\|2169040_2169268_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021646.1\|WP_088530935.1\|2174689_2175121_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021646.1\|WP_010606488.1\|2170858_2171479_-\|cytochrome-o-ubiquinol-oxidase-subunit-III	unknown	unknown	gnl\|CDD\|131889
NZ_CP021646.1\|WP_088530845.1\|2181698_2182043_+\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	unknown	unknown	gnl\|CDD\|377551
NZ_CP021646.1\|WP_088530937.1\|2176334_2176841_+\|redox-sensitive-transcriptional-activator-SoxR	unknown	unknown	gnl\|CDD\|133385
NZ_CP021646.1\|WP_088530938.1\|2176854_2178639_+\|DUF885-domain-containing-protein	unknown	unknown	gnl\|CDD\|377577
NZ_CP021646.1\|WP_088530886.1\|2182123_2183611_+\|IS66-family-transposase	unknown	unknown	gnl\|CDD\|376980
NZ_CP021646.1\|WP_088530931.1\|2168188_2168719_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP021646.1\|WP_088530940.1\|2184755_2185286_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021646.1\|WP_088530939.1\|2178796_2180956_-\|S46-family-peptidase	unknown	unknown	gnl\|CDD\|371067
NZ_CP021646.1\|WP_045965423.1\|2169607_2170486_-\|protoheme-IX-farnesyltransferase	unknown	unknown	gnl\|CDD\|184001
NZ_CP021646.1\|WP_088530934.1\|2173467_2174376_-\|ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|182518
NZ_CP021646.1\|WP_088530933.1\|2171482_2173465_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|131890
NZ_CP021646.1\|WP_088530930.1\|2167616_2168078_-\|HPP-family-protein	unknown	unknown	gnl\|CDD\|377434
NZ_CP021646.1\|WP_088530941.1\|2185282_2187349_-\|DUF2235-domain-containing-protein	unknown	unknown	gnl\|CDD\|370774
NZ_CP021646.1\|WP_088530887.1\|2181399_2181702_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021646.1\|WP_088530942.1\|2187596_2189192_+\|ABC-F-family-ATPase	unknown	unknown	gnl\|CDD\|237894
NZ_CP021646.1\|WP_026001061.1\|2168708_2169008_-\|GTP-cyclohydrolase	unknown	unknown	gnl\|CDD\|225225
NZ_CP021646.1\|WP_088530936.1\|2175797_2176253_-\|flavodoxin-family-protein	unknown	unknown	gnl\|CDD\|223728

Protein	Function_ID	Function_description	E-value
NZ_CP021646.1\|WP_017218861.1\|2170499_2170859_-\|cytochrome-o-ubiquinol-oxidase-subunit-IV	gnl\|CDD\|131894	TIGR02847, Cytochrome_bo3_ubiquinol_oxidase_subunit_4, cytochrome o ubiquinol oxidase subunit IV. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	1.13887e-33
NZ_CP021646.1\|WP_010606488.1\|2170858_2171479_-\|cytochrome-o-ubiquinol-oxidase-subunit-III	gnl\|CDD\|131889	TIGR02842, Cytochrome_bo3_ubiquinol_oxidase_subunit_3, cytochrome o ubiquinol oxidase, subunit III. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	2.85126e-103
NZ_CP021646.1\|WP_088530845.1\|2181698_2182043_+\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	3.62396e-49
NZ_CP021646.1\|WP_088530937.1\|2176334_2176841_+\|redox-sensitive-transcriptional-activator-SoxR	gnl\|CDD\|133385	cd01110, HTH_SoxR, Helix-Turn-Helix DNA binding domain of the SoxR transcription regulator. Helix-turn-helix (HTH) transcriptional regulator SoxR. The global regulator, SoxR, up-regulates gene expression of another transcription activator, SoxS, which directly stimulates the oxidative stress regulon genes in E. coli. The soxRS response renders the bacterial cell resistant to superoxide-generating agents, macrophage-generated nitric oxide, organic solvents, and antibiotics. The SoxR proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the unusually long spacer between the -35 and -10 promoter elements. They also harbor a regulatory C-terminal domain containing an iron-sulfur center.	4.78228e-89
NZ_CP021646.1\|WP_088530886.1\|2182123_2183611_+\|IS66-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	7.65077e-126
NZ_CP021646.1\|WP_088530931.1\|2168188_2168719_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.65363e-14
NZ_CP021646.1\|WP_088530939.1\|2178796_2180956_-\|S46-family-peptidase	gnl\|CDD\|371067	pfam10459, Peptidase_S46, Peptidase S46. Dipeptidyl-peptidase 7 (DPP-7) is the best characterized member of this family. It is a serine peptidase that is located on the cell surface and is predicted to have two N-terminal transmembrane domains.	0
NZ_CP021646.1\|WP_045965423.1\|2169607_2170486_-\|protoheme-IX-farnesyltransferase	gnl\|CDD\|184001	PRK13362, PRK13362, protoheme IX farnesyltransferase; Provisional.	1.15477e-151
NZ_CP021646.1\|WP_088530934.1\|2173467_2174376_-\|ubiquinol-oxidase-subunit-II	gnl\|CDD\|182518	PRK10525, PRK10525, cytochrome o ubiquinol oxidase subunit II; Provisional.	2.12192e-147
NZ_CP021646.1\|WP_088530933.1\|2171482_2173465_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	gnl\|CDD\|131890	TIGR02843, Cytochrome_bo3_ubiquinol_oxidase_subunit_1, cytochrome o ubiquinol oxidase, subunit I. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	0
NZ_CP021646.1\|WP_088530936.1\|2175797_2176253_-\|flavodoxin-family-protein	gnl\|CDD\|223728	COG0655, WrbA, Multimeric flavodoxin WrbA [General function prediction only].	9.43654e-18
NZ_CP021646.1\|WP_088530941.1\|2185282_2187349_-\|DUF2235-domain-containing-protein	gnl\|CDD\|370774	pfam09994, DUF2235, Uncharacterized alpha/beta hydrolase domain (DUF2235). This domain, found in various hypothetical bacterial proteins, has no known function.	1.13765e-25
NZ_CP021646.1\|WP_088530942.1\|2187596_2189192_+\|ABC-F-family-ATPase	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP021646.1\|WP_026001061.1\|2168708_2169008_-\|GTP-cyclohydrolase	gnl\|CDD\|225225	COG2350, COG2350, Uncharacterized protein conserved in bacteria [Function unknown].	2.16544e-14
NZ_CP021646.1\|WP_088530938.1\|2176854_2178639_+\|DUF885-domain-containing-protein	gnl\|CDD\|377577	pfam05960, DUF885, Bacterial protein of unknown function (DUF885). This family consists of several hypothetical bacterial proteins several of which are putative membrane proteins.	5.42651e-120
NZ_CP021646.1\|WP_088530930.1\|2167616_2168078_-\|HPP-family-protein	gnl\|CDD\|377434	pfam04982, HPP, HPP family. These proteins are integral membrane proteins with four transmembrane spanning helices. The most conserved region of the alignment is a motif HPP. The function of these proteins is uncertain but they may be transporters.	5.33643e-29

>NZ_CP021646.1|WP_088530935.1|2174689_2175121_-|hypothetical-protein
MPLLSYVRHTATADDTTYQGCTITRAQLFGRIFSVLSALMMFNTALLFTGMLGDVAELEVLFADNSLPDSVLVMLGEFLAQPILSLQLLIGLYWLVFHTILPTRAGIVLRKTAFASTEAIQPQPVPSAHGCRAPPFGYRCLFA
>NZ_CP021646.1|WP_088530934.1|2173467_2174376_-|ubiquinol-oxidase-subunit-II
MNKRSVVNYAFASLGLMLTGCSGGILDPKGQIGMDEKSLIIIATVLMLLVVVPVIILTLYFAWKYRDGRDHEIYAPKWAHSNKIEAVVWTIPIVIIIVLGVITWRSTQSLDPYKPLEGKGEHLTVQVVSLNWKWLFIYPEQGIATVNELVFPANVPVEYKITSESTMNSFFIPQLGSQIYSMAGMETQLHLIANEPGTFKGFSANYSGAGFTGMKFDATATKDKASFDNWVADIKANGEALTAGRYTKLAEPSEYHPVEYFGSVEQGLFHTIVMKYMQGHGEMSYYAKPEHAAHPHHGKAEE
>NZ_CP021646.1|WP_088530933.1|2171482_2173465_-|cytochrome-o-ubiquinol-oxidase-subunit-I
MSLFGKLSIEAIPYHEPIIMVTLAVVAIVGLIVAAMVTKHKKWGVLWHDWITSIDHKRLGVMYIILALIMLMRGFADAVMMRTQLAMATSGAAGYLPPEHYDQIFTAHGVIMIIFMAMPFMIGLMNIILPLQIGARDVAFPFLNNLSFWLTAGGAILINLSLAFGEFAKTGWVAYPPLSELSFSPGVGVDYYIWALQISGLGTLLTAVNFLVTVFKMRAPGMTLMKMPIFTWTCTWANILVAASFPILTAVLAMLTLDRYMDFHFFTNEAGGNAMMYINLFWAWGHPEVYILILPAFGIFSEIISTFTGKRLFGYKSMVYASGAISILGFIVWLHHFFTMGSSANVNAFFGVMTMVIAVPTGVKLFNWLFTMYRGRLRITVPVLWTLGFMVTFTVGGMTGVLLAIPGADYVLHNSLFLIAHFHNTIIGGAVFGYLAGFAYWFPKVMGYKLDERWGKASFWCWLVGFFVAFMPLYVLGFLGMTRRLNHTNTPEWNIWLYIACIGAFIIMFGIVFQVVQLVVSYKNREQLQDTTGDPWNGHTLEWSTDSPPQYYNFAKTPVVDDIDAWTEMKEQGQAYQKPAHYQPIHMPKNTPAGVLISASLTVFCFAMIWHIWWLAAVGFVSAIAVFIKRCYTRDVDYYVQVDEIEQIESAHLSRALQEG
>NZ_CP021646.1|WP_010606488.1|2170858_2171479_-|cytochrome-o-ubiquinol-oxidase-subunit-III
MSAITPATLHALEDAHEHADHDTGSNTVFGFWLYLMTDCLLFASFFATYAVLYMNTAGGVSGKDIFELGFVAVETAALLLSSITFGFAMIAANKQKKSQTLSWLAVTFAFGAVFIGMEVYEFHHLIVHGHGPQHSAFLTSFFSLVGLHGMHVTAGLIWMTVMMIEVTRRGLKPQTVTRLSCLSLFWHFLDIVWICVFTVVYLMGAM
>NZ_CP021646.1|WP_017218861.1|2170499_2170859_-|cytochrome-o-ubiquinol-oxidase-subunit-IV
MSHSESQALAQMDVHEHEHDSHGSVKSYLIGFVLSVILTAIPFAAVMSGSLSSSTTFWTLVTTALVQIWVHLKYFLHLNFVTEEGKASTLSFIFSALIIVMVVGLSVWIIYESNAMMMY
>NZ_CP021646.1|WP_045965423.1|2169607_2170486_-|protoheme-IX-farnesyltransferase
MLRRYFQVTKPGIIMGNLISVAGGFLLASRGEVDWLLFALTLLGLSLVVASGCVVNNVIDRDIDAAMARTKTRVTVTGEISSVAALSHSLVLGLSGFGLLAYFTNWIALSFAAFGFFIYVGVYSLYMKRNSVYGTVVGSLSGAVPPVVGYCAVSGVFDSGAAILLLMFCLWQMPHSYAIAIFRFEDYRVANIPVLPVAQGVEKAKHHIVLYIAIYALVVMLLPLSGYTGIAFMAVACTTSFWWLLMALKGYQRDLDLHGWARQVFAFSIVNITVLSIAMAIDNHSTVSAMLY
>NZ_CP021646.1|WP_088530932.1|2169040_2169268_-|hypothetical-protein
MDIGITEVLLLFAAIFIASFLLFKVVLRAKKMPKGAYLFLALMPLISLFPIPPPVFKNVAKAKQEQRKKAPKSEP
>NZ_CP021646.1|WP_026001061.1|2168708_2169008_-|GTP-cyclohydrolase
MFIVNLTYVTEIEQVEPLLAPHIAFLERFYANGTFIASGRKIPRTGGVILAKASSEAELLDIVRQDPFYVAEVARYDIIEFVPSKFASCFTEVEKYLNS
>NZ_CP021646.1|WP_088530931.1|2168188_2168719_+|TetR/AcrR-family-transcriptional-regulator
MSTKRQQLIDCAMGLFYQHGIHAIGINEVLKSSGIAKKTLYNHFESKEALVLATLEQRHHLFISWLSRCLENAQTNEQLTEQLFSALDQWINNKVAVLGDFRGCYFINTAAEFGELTNPINQLCQRHKLAVKALLKQALNDADDAAVERLFLLSEGIISTAYTCHDTDVAKRALKN
>NZ_CP021646.1|WP_088530930.1|2167616_2168078_-|HPP-family-protein
MREIQLALIAGAGAFIAIAILAFSQTISAEHIFLMAPLGATAVLVFGVPESPLAQPKNVIFGHIITATIGIIFAQYIGVNEFTLALATGLGVFSMLVTKTTHPPAGANPILIMLALEGWSFLFTPVIIGAVVLVLVGKATLAAKTKLTTVTAA
>NZ_CP021646.1|WP_088530936.1|2175797_2176253_-|flavodoxin-family-protein
MKTVVIYSSSNPNGNTYQSAKALAEEKRAELIYLDRYKIGEYCYKHSHSDDDFVNLFRWVLGFEHIIFASPVYWYAVTPRMKAFIDRITDFMDIEALKPELRALREKQFSILSTSCQEKAPAPFTEMLVGTFEYLGMKLQEQRHVHYPYAD
>NZ_CP021646.1|WP_088530937.1|2176334_2176841_+|redox-sensitive-transcriptional-activator-SoxR
MKTEKLLRDEPNLSVGKVAQRADVAVSALHFYENKGLIRSWRNNGNQRRYKKDVLRRIAIIKAGQKMGITLGEIKETLDTLPDSRTPTKADWAKLSRAWQTKLDEKIAYMQRLRDYVDGCIGCGCLSMKSCPIYNPDDIVAKEANGAVWLDEPDKANKAKSCYDSENH
>NZ_CP021646.1|WP_088530938.1|2176854_2178639_+|DUF885-domain-containing-protein
MKKTALCMALAMAMGLTGCSLSPSSVETTPSASQQTVATNTQFADFSQQFINNLWKQYPEASLWAGFGKYDDIITVPTQATRDASVAFSRAQLAKLQQFDLANLSNSQKIDYHLIENRLKRDIWHIETFKSWQWNPSNYNVSYGFATILNSRFKTDDEKLKLVLARLQYVPAYYEAAQNNISNPTLEYTQLAIAQNQGAFSVLNDELLDKLATSLLTAEEKALFKQRFAAAKSAINGYVSYLTNLEKELSESGNARSFRIGEKLYEEKFAFDIQSGYTAKQMYEKAMADKTRVTNEMVKIVDQLWPKYFADKPRPESDIDAIATLIKHLSVKHVKRENFVSEIKAQIPELEKFVMEKDLITLDPEKPLVVRETPEYMRGFAGASISAPGPYDKKENTYYNVSPLDSMSDEQAESYLREYNHWILQILNIHEAVPGHYTQLVYSNESPSLVKSILSNGAMIEGWAVYTERMMLEEGYGNFEPEMWLMYYKWNLRVICNTILDYGIQVKGISKEEGLDLLMNGAFQERAEAEGKWRRATLSQVQLTSYYSGYREIYDFRETQKQKLGKEFDLKAFHEEFLSFGSAPVKYIRQLMAK
>NZ_CP021646.1|WP_088530939.1|2178796_2180956_-|S46-family-peptidase
MRIKAISAAMVLAFSQYVAADEGMWQPHQLPELESILKSKGLEIDAKSISKLTEFPMNAVISLGGCTASFVSPKGLVVTNHHCAYGSIQYNSTTDNNILENGFLAKQPSEDLPAAPGSRVYVTKEVSNVTDKVNAGTDSLTGKARFDAIDSKRKQLVAECEQDESYRCNVYTFHGGLEYYLIKSLEIKDVRLAYTPAMGVGKYGGDIDNWMWPRHTGDFAFYRAYVGKDGKPAEFSKDNVPYNPESFLSVSAKGVQEGDFVMVTGYPGRTNRYRIASEVDYVFNTVYPMVRKHNSKYVALIEENAPEGSQARIAYESTIAGYNNYIKNFGSMIESFKKGSMYSRKQQFERDLSTWINADADRKAKYGAVLNELSELVAQSQSHYERDMMVGYIHRSQMMSTARQLYRLAVEKQKPDAERESGYQERDMPKIKAGLQRMTRRYDETVDKAIMLYFMELYAALPKEARLAEVDKQLQLENGFNKAKHQALLDEMYANSKLADEKARLWMLDLELEQLNQSSDPFIQYAKAIFAVMKQIEDEEKELAGKQQSARPALMEAIIAYNKSQNKPVYADANSTLRVTYGTVGGYSPQDGLVATPFTSLEGLLAKNTDVEPFNAPKKQQQLIREKVYGQYTGGMNTVPVNFLSNVDTTGGNSGSPTLNGKAELVGLLFDGVYESIIGDWDYDKNLNRSIHVDSRYMLWVMDKVDNAQNLLDEMKIVK
>NZ_CP021646.1|WP_088530887.1|2181399_2181702_+|hypothetical-protein
MPKHKTAQQWLQLFEQQELSGLSVSDFCTQHNLSIKSFYNRRSKIRKQTPPQSSFVAAKPAAPESVSPPELLQLKHGQSTVLLPSTTDTLWLAALLKALS
>NZ_CP021646.1|WP_088530845.1|2181698_2182043_+|IS66-family-insertion-sequence-element-accessory-protein-TnpB
MICWQNKVVYLHRQPVDFRKSINGLAAIVEQAMATSAMTGNVFAFCNKSKDKLKVLYWDKTGFALWYKRLEKDKFKWPDKEDDDVITLTAEQWQWLLSGLSVIAHKPLSYGYNV
>NZ_CP021646.1|WP_088530886.1|2182123_2183611_+|IS66-family-transposase
MQNELDVLRQQLAKQEEIIAQLQARNNYLEEQFILAQQKRFGASSESHPAQADLFNEAETLVEEVPEQDVETIEYQRKKPTRQPLPKDLPRERVVHDIDNKQCGCCGGELHKMGEDVSEKLEFIPAQVKVIEHVRPKYSCRQCEKTQTQIRIVQAPVPPSPIPKGIATASLLSQIITSKYQYGLPLYRQESLFKQYGIALCRRTMADWMIRCASLFKPLYDRLHDVLLQQPVIQADETTVKVVKEDKQTNYMWLYCSGTDSPAPEASIPNIALFDYQNSRAGRCPVAFLKGYNGYLQVDGYAGYEQTQATLVGCWAHARRKFKEAADAQAKGKTGKANWALNHIQKLYRVETAIKGMSLQEKQATREKQSTPLLAQFKTWLEKSAQTVVPKSKLGEAIHYTLRQWPKLIRYLDDGHLKIDNNRAERAIKPFVIGRKNWLFSFTTSGAESSAILYSVIETARANGLTPFDYVMHCLNELAQPDCDINSLLPWNVKL
>NZ_CP021646.1|WP_088530940.1|2184755_2185286_-|hypothetical-protein
MNNKLYTVLLAVILLCSCSSHSELEKLHIGISAYEKSDLMVKLIFDDRFSPPAGAIGCCWGNAQKKGVFWGAEIPHKVQAEWWDYKQGRHYNAEFSVKRDKAYKIAGNLPSVTYYTGKTETDVDPYIIFGFGEKGEVKMWISNSQFASGVKGRILEEIGSAQATWEPFELTDEMFN
>NZ_CP021646.1|WP_088530941.1|2185282_2187349_-|DUF2235-domain-containing-protein
MKIVEEKHNWLIDQQIDELEVLPPHTTTAHLPSEIRTQLKPHASDWIVLQQRHNWRHVKRDEFTRVFIKTKKGLQSVRSGSAAGSREQLIIVKRKSYFKAEIRNNAFTSSGGVDLNQPIGASQLDPLTPVEQVLASINVDKSPEVAEKRILVSLEGELAVSFVIQGANTPTLSRASEGATQTPLIFGKLSEDGRYSLKAKILGVPEQVLFNNVPYADLLDIEKVKALKIGAEGGVQLIKHRVSGEGNVHLYFISEPPSIGIFFDGTGNNKYNDILDPFDDKEPTNIAKLHELYENEGKFTTSSYIEGVGTSAGKKDSTIDLAIAYSFDERLIEAVSDLDKFINNNGLIELCNTLLVDCFGFSRGAAAARAFVNLINEMREKQDTKLANKEVVFRFVGIFDTVASIGGDGDNDHGELYARDELDDAARLDLNQASAGAVYHLTAWDERRDKFPLSSLKNKDGSLFANHKEDYLPGVHSDIGGGYAPISIDIEYPLKRIRGIPGNPEHEAKVQQEKLAIEHKYQWPGINVDMVYRFKRLRYGASRSGRDKDFYTTYRPVWRRKIDNTLAHFGLHQMYNEAVQHGVPLRAMARLQSIYPYELSNEVATLVPKALKAGPASQAWQKLYEHYIHISSRFTGAVDKMAHGAERKAKYATENGQREMFYNNAKALPQVQIWKAYKNGNKSIWRKG
>NZ_CP021646.1|WP_088530942.1|2187596_2189192_+|ABC-F-family-ATPase
MLSCNNITMQFGAKPLFENISVKFGDGNRYGLIGANGCGKSTFMKILSKELEPSSGNVNYDPNERIAKLNQDQFAYEQYTVVDTVIMGHKELWEIKQERDRIYSLPEMSEEDGMRVADLETQFAEMDGYSAEAKAGELLLGVGIPTEQHYGLMSEVAPGWKLRVLLAQVLFAEPDIMLLDEPTNNLDIYTIKWLEDVLNQRDCTMIIISHDRHFLNSVCTHMADIDYGDLRIYSGNYDEYMFAATQARERLLSDNAKKKAQIAELQQFVSRFSANASKAKQATSRAKQIDKIQLEEVKASSRQNPFIRFEQEKPLFRNALELISLSQGYDDTLFSDLNGLVEVGEKVAIIGENGAGKTTLLNTLAGRKAPQAGEYKWSENANIGYYAQDHADEFEKDLDLFQWMEQWQQPGDDEQVVRGFLGRMLFSQNDIKKSVKVISGGEQGRMLFGKIMMHKPNILLMDEPTNHMDMESIESLNLALEQYEGTLFFVSHDRQFVSSLATRIWEIKDGKITDFHGTYDEYLAKKAAEAV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP021646_1	1.2\|471689\|71\|NZ_CP021646\|PILER-CR	471689-471759	71	NZ_CP021646.1	471262-471332	11	0.845
NZ_CP021646_1	1.2\|471689\|71\|NZ_CP021646\|PILER-CR	471689-471759	71	NZ_CP021646.1	471374-471444	11	0.845
NZ_CP021646_1	1.4\|471900\|71\|NZ_CP021646\|PILER-CR	471900-471970	71	NZ_CP021646.1	471262-471332	11	0.845
NZ_CP021646_1	1.4\|471900\|71\|NZ_CP021646\|PILER-CR	471900-471970	71	NZ_CP021646.1	471374-471444	11	0.845

1. spacer 1.2|471689|71|NZ_CP021646|PILER-CR matches to position: 471262-471332, mismatch: 11, identity: 0.845

taagggcgatgctctcccaactgagctaacaacccaaattgtgtttcaatttatactctt	CRISPR spacer
taagggcgatgctctcccaactgagctaacaacccaaattgtgtttcaatttatactctt	Protospacer
************************************************************

2. spacer 1.2|471689|71|NZ_CP021646|PILER-CR matches to position: 471374-471444, mismatch: 11, identity: 0.845

taagggcgatgctctcccaactgagctaacaacccaaattgtgtttcaatttatactctt	CRISPR spacer
taagggcgatgctctcccaactgagctaacaacccaaattgtgtttcaatttatactctt	Protospacer
************************************************************

3. spacer 1.4|471900|71|NZ_CP021646|PILER-CR matches to position: 471262-471332, mismatch: 11, identity: 0.845

taagggcgatgctctcccaactgagctaacaacccaaattgtgtttcaatttatactctt	CRISPR spacer
taagggcgatgctctcccaactgagctaacaacccaaattgtgtttcaatttatactctt	Protospacer
************************************************************

4. spacer 1.4|471900|71|NZ_CP021646|PILER-CR matches to position: 471374-471444, mismatch: 11, identity: 0.845

taagggcgatgctctcccaactgagctaacaacccaaattgtgtttcaatttatactctt	CRISPR spacer
taagggcgatgctctcccaactgagctaacaacccaaattgtgtttcaatttatactctt	Protospacer
************************************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2480662 : 2607095

111

Vibrio_phage(17.07%)

transposase,integrase,tail,plate

attL 2542864:2542879|attR 2610236:2610251

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088531123.1\|2480662_2481701_-\|transposase	IS630 family transposase	M4M9P8	Vibrio_phage	1.7e-08	63.0
WP_088531124.1\|2481843_2483046_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_088531125.1\|2483255_2483726_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_088531126.1\|2483736_2484702_+	FecR domain-containing protein	NA	NA	NA	NA
WP_088531127.1\|2484786_2487510_+	TonB-dependent receptor	NA	NA	NA	NA
WP_088531128.1\|2487580_2488171_+	biliverdin-producing heme oxygenase	NA	NA	NA	NA
WP_088531129.1\|2488167_2488560_+	YbaN family protein	NA	NA	NA	NA
WP_088531130.1\|2488579_2490604_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.0e-18	32.3
WP_088531131.1\|2490889_2492581_-	50S ribosome-binding GTPase	NA	NA	NA	NA
WP_088531132.1\|2492564_2494997_-	hypothetical protein	NA	NA	NA	NA
WP_088531133.1\|2495629_2496082_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_088531135.1\|2496821_2498276_+	hypothetical protein	NA	NA	NA	NA
WP_088531136.1\|2498319_2499591_-	histidine kinase	NA	NA	NA	NA
WP_088531137.1\|2499583_2500918_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_088531138.1\|2500958_2503385_-	ABC transporter permease	NA	NA	NA	NA
WP_088531139.1\|2503384_2504107_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-34	39.4
WP_088531140.1\|2504118_2505372_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_088531141.1\|2505637_2505865_-	DUF1496 domain-containing protein	NA	NA	NA	NA
WP_088531142.1\|2506184_2507285_-	hypothetical protein	NA	NA	NA	NA
WP_088531143.1\|2507361_2508153_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_088531144.1\|2508232_2510740_-	ATP-dependent helicase HrpB	A0A2H4UU36	Bodo_saltans_virus	1.1e-37	29.2
WP_088531145.1\|2510926_2512777_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.9e-19	33.7
WP_088531146.1\|2512776_2513661_-	hypothetical protein	NA	NA	NA	NA
WP_088531149.1\|2517576_2518524_-	homoserine O-succinyltransferase	NA	NA	NA	NA
WP_088531150.1\|2518701_2519592_+	DMT family transporter	NA	NA	NA	NA
WP_088531151.1\|2519637_2520369_-	Ig-like domain-containing protein	NA	NA	NA	NA
WP_088531152.1\|2520621_2522238_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_088531153.1\|2522270_2522741_-	hypothetical protein	NA	NA	NA	NA
WP_088531154.1\|2523092_2524694_+	hypothetical protein	NA	NA	NA	NA
WP_088531155.1\|2526823_2528269_+	metallophosphoesterase	NA	NA	NA	NA
WP_151201425.1\|2528403_2528628_-	hypothetical protein	NA	NA	NA	NA
WP_088531157.1\|2528728_2529265_-	hypothetical protein	NA	NA	NA	NA
WP_088531158.1\|2529487_2530063_-	hypothetical protein	NA	NA	NA	NA
WP_088531159.1\|2530059_2530368_-	hypothetical protein	NA	NA	NA	NA
WP_088531160.1\|2532958_2534113_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_088531161.1\|2534119_2534593_+	hypothetical protein	NA	NA	NA	NA
WP_088531162.1\|2534819_2536562_-	gamma-glutamyltransferase	NA	NA	NA	NA
WP_088531163.1\|2536866_2537049_+	hypothetical protein	NA	NA	NA	NA
WP_088531164.1\|2537080_2537293_+	hypothetical protein	NA	NA	NA	NA
WP_088531165.1\|2537338_2537956_-	HAD family phosphatase	NA	NA	NA	NA
WP_088531166.1\|2538052_2538979_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_088531167.1\|2539091_2539511_+	lactoylglutathione lyase	NA	NA	NA	NA
WP_088531168.1\|2539524_2540646_+	alkene reductase	NA	NA	NA	NA
WP_088531169.1\|2540642_2541194_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_088531170.1\|2541196_2542135_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
2542864:2542879	attL	NA	NA	NA	NA
WP_088531172.1\|2543891_2544971_-	tryptophan 7-halogenase	NA	NA	NA	NA
WP_088531173.1\|2547182_2548193_-\|tail	phage tail protein	A0A1B2LRT8	Wolbachia_phage	3.8e-29	25.5
WP_010378405.1\|2548194_2548410_-\|tail	tail protein X	O80307	Escherichia_phage	6.3e-11	51.7
WP_010378403.1\|2548435_2548867_-\|tail	phage tail protein	Q9ZXJ9	Pseudomonas_virus	1.5e-16	38.5
WP_010378399.1\|2552293_2552551_-\|tail	phage tail assembly protein	Q75QK8	Wolbachia_phage	3.1e-12	43.8
WP_010378397.1\|2552554_2553064_-\|tail	phage major tail tube protein	K4I1G5	Acidithiobacillus_phage	1.1e-34	47.9
WP_017218948.1\|2553063_2554227_-\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A1B2LRR3	Wolbachia_phage	2.3e-131	60.4
WP_017218947.1\|2554676_2555012_-	GPW/gp25 family protein	Q75QM0	Wolbachia_phage	2.0e-27	50.5
WP_017218946.1\|2555021_2555219_-	hypothetical protein	D4HTV1	Vibrio_phage	1.8e-12	62.5
WP_088531175.1\|2555315_2555909_-\|plate	phage baseplate assembly protein V	A0A1B2LRU5	Wolbachia_phage	3.3e-25	39.9
WP_088531176.1\|2555905_2556484_-	hypothetical protein	NA	NA	NA	NA
WP_088531177.1\|2556562_2556790_-	hypothetical protein	NA	NA	NA	NA
WP_088531178.1\|2556792_2557620_-	hypothetical protein	NA	NA	NA	NA
WP_088531179.1\|2557629_2558382_-\|tail	phage tail protein	K7RVY3	Vibrio_phage	4.4e-43	51.6
WP_088531180.1\|2558381_2559491_-\|tail	phage tail protein I	K7R2P6	Vibrio_phage	3.6e-41	46.2
WP_088531181.1\|2559483_2560368_-\|plate	baseplate J/gp47 family protein	D4HTV3	Vibrio_phage	2.3e-54	42.1
WP_088531182.1\|2560551_2561091_-	hypothetical protein	NA	NA	NA	NA
WP_088531184.1\|2564893_2565445_-\|tail	phage tail protein I	K7R2P6	Vibrio_phage	8.6e-20	35.0
WP_088532276.1\|2565441_2566347_-\|plate	baseplate J/gp47 family protein	D4HTV3	Vibrio_phage	9.4e-48	35.2
WP_088531185.1\|2566510_2566930_-	hypothetical protein	NA	NA	NA	NA
WP_088531186.1\|2566939_2568409_-	hypothetical protein	NA	NA	NA	NA
WP_088531187.1\|2568429_2568651_-	hypothetical protein	NA	NA	NA	NA
WP_088531188.1\|2568659_2569856_-	hypothetical protein	A0A1B2LRR4	Wolbachia_phage	3.8e-89	45.6
WP_017218928.1\|2571825_2572308_-	hypothetical protein	Q75QL7	Wolbachia_phage	6.6e-24	41.9
WP_088531189.1\|2572369_2573092_-	hypothetical protein	NA	NA	NA	NA
WP_088531190.1\|2573084_2576168_-	hypothetical protein	A0A2D1GMY2	Pseudoalteromonas_phage	1.3e-104	32.9
WP_088531191.1\|2576171_2576720_-	hypothetical protein	A2I2X8	Vibrio_virus	6.6e-20	36.9
WP_088531192.1\|2576746_2577673_-\|tail	phage tail protein	K4I1F8	Acidithiobacillus_phage	3.4e-37	46.5
WP_088531193.1\|2577674_2578517_-\|plate	baseplate J/gp47 family protein	K4HZB7	Acidithiobacillus_phage	4.3e-47	43.4
WP_088531194.1\|2578525_2578753_-	hypothetical protein	NA	NA	NA	NA
WP_088531195.1\|2578764_2579655_-	hypothetical protein	NA	NA	NA	NA
WP_045988676.1\|2579656_2580193_-\|tail	phage tail protein	B0ZSG1	Halomonas_phage	7.6e-21	40.3
WP_088531196.1\|2580254_2581001_-\|tail	phage tail protein I	A0A2H4EUL3	Aeromonas_phage	3.1e-20	44.6
WP_088531197.1\|2580981_2581938_-\|plate	baseplate J/gp47 family protein	A0A088FQL4	Escherichia_phage	1.0e-52	38.2
WP_088531198.1\|2581997_2582462_-	hypothetical protein	NA	NA	NA	NA
WP_088531199.1\|2582473_2583244_-	hypothetical protein	NA	NA	NA	NA
WP_088531200.1\|2583370_2583685_-	hypothetical protein	NA	NA	NA	NA
WP_088531201.1\|2583695_2584472_-\|tail	phage tail protein	NA	NA	NA	NA
WP_010378336.1\|2584481_2585066_-\|tail	phage tail protein	B0ZSG1	Halomonas_phage	3.3e-22	38.1
WP_088531202.1\|2585232_2586129_-\|tail	phage tail protein I	M1T2R2	Escherichia_phage	1.0e-22	35.6
WP_069020304.1\|2586137_2586980_-\|plate	baseplate J/gp47 family protein	K4HZB7	Acidithiobacillus_phage	1.7e-35	37.8
WP_010378331.1\|2587040_2587289_-	hypothetical protein	NA	NA	NA	NA
WP_017218912.1\|2587285_2587693_-	hypothetical protein	A0A1B1ITB4	uncultured_Mediterranean_phage	9.8e-21	41.4
WP_017218911.1\|2587680_2588100_-	glycoside hydrolase family protein	A0A1Q1PW74	Pseudoalteromonas_phage	2.4e-30	52.9
WP_039496108.1\|2588120_2588483_-	hypothetical protein	NA	NA	NA	NA
WP_010378322.1\|2588457_2588736_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010378320.1\|2589160_2590825_+	energy-dependent translational throttle protein EttA	A0A2K9L3Z8	Tupanvirus	9.5e-38	26.4
WP_088531203.1\|2591052_2591418_+	PilZ domain-containing protein	NA	NA	NA	NA
WP_088531204.1\|2591462_2591867_+	DUF350 domain-containing protein	NA	NA	NA	NA
WP_088531205.1\|2591876_2592473_+	DUF1190 domain-containing protein	NA	NA	NA	NA
WP_088531206.1\|2592586_2593756_+	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	1.3e-81	42.3
WP_088531207.1\|2594297_2596265_+	FAD-dependent oxidoreductase	M1NNK7	Moumouvirus	3.5e-07	32.4
WP_088531208.1\|2596823_2597522_+	spondin domain-containing protein	NA	NA	NA	NA
WP_088531209.1\|2597531_2598239_+	spondin domain-containing protein	NA	NA	NA	NA
WP_088531210.1\|2598291_2599023_+	response regulator transcription factor	W8CYM9	Bacillus_phage	6.0e-29	33.0
WP_088531211.1\|2599019_2600477_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	6.0e-20	25.8
WP_088531212.1\|2600920_2601154_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157757235.1\|2601187_2601436_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_088531215.1\|2601913_2602105_-	hypothetical protein	NA	NA	NA	NA
WP_088531216.1\|2602094_2602340_-	hypothetical protein	NA	NA	NA	NA
WP_088531217.1\|2602333_2602723_-	transcriptional regulator	NA	NA	NA	NA
WP_088531218.1\|2602715_2603189_-	regulatory protein GemA	NA	NA	NA	NA
WP_088531219.1\|2603199_2603829_-	DUF3164 family protein	A0A2D1GNM4	Pseudomonas_phage	1.3e-27	32.2
WP_088531220.1\|2603841_2604159_-	hypothetical protein	NA	NA	NA	NA
WP_088531221.1\|2604161_2605310_-	Flp pilus assembly complex ATPase component TadA	Q5ZR05	Pseudomonas_phage	1.8e-27	26.4
WP_088531222.1\|2605313_2607095_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q5ZR04	Pseudomonas_phage	1.1e-68	32.8
2610236:2610251	attR	NA	NA	NA	NA

DBSCAN-SWA_2

2613498 : 2621095

Shigella_phage(50.0%)

capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088531234.1\|2613498_2614086_+	secretion activator protein	A0A2I7S9B9	Vibrio_phage	9.1e-36	46.7
WP_088531235.1\|2614078_2614339_+	hypothetical protein	NA	NA	NA	NA
WP_088531236.1\|2614331_2614781_+	hypothetical protein	R9ZVQ5	Cellulophaga_phage	1.6e-08	34.8
WP_088531237.1\|2614767_2614992_+	TraR/DksA C4-type zinc finger protein	NA	NA	NA	NA
WP_088531238.1\|2614991_2615306_+	DUF2730 family protein	NA	NA	NA	NA
WP_088531239.1\|2615292_2615544_+	hypothetical protein	NA	NA	NA	NA
WP_010604410.1\|2615530_2615833_+	hypothetical protein	NA	NA	NA	NA
WP_088531240.1\|2615835_2616420_+	DUF3486 family protein	A0A0C4UQU5	Shigella_phage	1.9e-57	62.5
WP_088531241.1\|2616419_2618063_+	hypothetical protein	A0A0C4UR29	Shigella_phage	1.9e-200	64.3
WP_157757239.1\|2618062_2618209_+	hypothetical protein	NA	NA	NA	NA
WP_088531242.1\|2618211_2619771_+	DUF935 domain-containing protein	A0A0C4UQR8	Shigella_phage	1.8e-118	44.3
WP_088531243.1\|2619763_2621095_+\|capsid	minor capsid protein	Q6QIB9	Burkholderia_phage	4.7e-64	46.5

DBSCAN-SWA_3

3126648 : 3134421

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088531592.1\|3126648_3127359_-	glycosyltransferase	L7Y3U4	Megavirus	3.7e-07	22.4
WP_157757247.1\|3127365_3128562_-	hypothetical protein	NA	NA	NA	NA
WP_088531594.1\|3128628_3129483_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	3.6e-41	36.4
WP_088531595.1\|3129483_3130548_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	7.6e-97	52.5
WP_088531596.1\|3130561_3131107_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.3e-49	54.1
WP_088531597.1\|3131103_3131988_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	4.8e-97	57.8
WP_088531598.1\|3131992_3133261_-	UDP-N-acetyl-D-mannosamine dehydrogenase	NA	NA	NA	NA
WP_088531599.1\|3133305_3134421_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	6.2e-25	27.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP021647

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6822

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151208262.1\|117_312_-	hypothetical protein	NA	NA	NA	NA
WP_088532312.1\|1083_2607_-	dGTPase	NA	NA	NA	NA
WP_088532313.1\|3221_3824_+	class I SAM-dependent methyltransferase	A0A2H4J5G6	uncultured_Caudovirales_phage	5.0e-13	45.7
WP_088532314.1\|3828_6822_+	DEAD/DEAH box helicase family protein	A0A2H4PJ08	Corynebacterium_phage	2.6e-30	31.4

DBSCAN-SWA_2

16693 : 19519

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532324.1\|16693_19519_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	3.6e-45	25.6

DBSCAN-SWA_3

26890 : 29545

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532334.1\|26890_29545_+	glycoside hydrolase family 16 protein	M1ICB6	Acanthocystis_turfacea_Chlorella_virus	4.9e-28	33.8

DBSCAN-SWA_4

38433 : 40854

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532340.1\|38433_39777_+	beta-glucosidase	A0A0B5JD41	Pandoravirus	7.9e-75	35.9
WP_088532341.1\|39846_40854_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.2e-32	33.8

DBSCAN-SWA_5

58315 : 72385

Hokovirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532351.1\|58315_63010_-	response regulator	A0A1V0SGX0	Hokovirus	1.5e-43	28.2
WP_088532352.1\|63080_63566_+	GAF domain-containing protein	NA	NA	NA	NA
WP_088532353.1\|64071_64962_+	cation transporter	NA	NA	NA	NA
WP_088532354.1\|65066_67850_+	response regulator	A0A1V0SGX0	Hokovirus	1.6e-50	35.4
WP_088532355.1\|67897_72385_-	EAL domain-containing protein	G3MA91	Bacillus_virus	4.7e-23	34.4

DBSCAN-SWA_6

76142 : 85099

Leptospira_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532359.1\|76142_79271_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.5e-63	23.6
WP_088532360.1\|79327_80212_+	cation transporter	A0A1V0SED0	Indivirus	2.0e-10	48.2
WP_088532361.1\|80319_80838_+	hypothetical protein	NA	NA	NA	NA
WP_088532362.1\|80852_81464_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.2e-72	66.8
WP_088532363.1\|81798_83157_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_088532364.1\|83153_83615_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	7.2e-28	42.2
WP_088532365.1\|83687_84464_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_088532366.1\|84520_85099_+	thymidine kinase	A0A2H4YFP5	Citrobacter_phage	1.1e-54	56.3

DBSCAN-SWA_7

91477 : 92200

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532373.1\|91477_92200_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-31	37.8

DBSCAN-SWA_8

96185 : 97475

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532377.1\|96185_97475_+	GHKL domain-containing protein	A0A1V0SGX0	Hokovirus	1.1e-06	38.3

DBSCAN-SWA_9

105762 : 111305

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532387.1\|105762_109074_+	response regulator	A0A1V0SGX0	Hokovirus	4.3e-66	33.3
WP_088533130.1\|109151_111305_+	VRR-NUC domain-containing protein	A0A1X9I5C8	Streptococcus_phage	1.2e-19	35.8

DBSCAN-SWA_10

117004 : 118537

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532394.1\|117004_118537_-	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	1.4e-35	58.7

DBSCAN-SWA_11

132869 : 137851

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532402.1\|132869_135527_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	3.4e-13	22.2
WP_088532403.1\|136059_136434_+	hypothetical protein	NA	NA	NA	NA
WP_088532404.1\|136489_137851_+	leucyl aminopeptidase family protein	Q6GYZ8	Mycoplasma_phage	1.1e-31	32.2

DBSCAN-SWA_12

143393 : 143654

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532411.1\|143393_143654_+	hypothetical protein	A0A1B0Z0G5	Vibrio_phage	6.5e-10	54.1

DBSCAN-SWA_13

149173 : 149695

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532416.1\|149173_149695_-	sigma-70 family RNA polymerase sigma factor	A0A0F6TH34	Sinorhizobium_phage	5.5e-08	28.7

DBSCAN-SWA_14

174143 : 178805

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532436.1\|174143_177260_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.5e-65	22.2
WP_088532437.1\|177480_178140_+	hypothetical protein	NA	NA	NA	NA
WP_088532438.1\|178211_178805_+	sulfotransferase family 2 domain-containing protein	A0A142EZT6	Stenotrophomonas_phage	1.9e-09	28.8

DBSCAN-SWA_15

185928 : 189870

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532445.1\|185928_189870_-	TOMM system kinase/cyclase fusion protein	A0A2R8FF19	Brazilian_cedratvirus	1.8e-18	29.4

DBSCAN-SWA_16

193890 : 196967

Arthrobacter_phage(50.0%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532448.1\|193890_194412_+\|tail	phage tail protein	A0A218M5J9	Arthrobacter_phage	1.4e-16	38.5
WP_088532449.1\|194423_194948_+\|tail	phage tail protein	E3T4R8	Cafeteria_roenbergensis_virus	1.0e-17	34.8
WP_088532450.1\|194959_195493_+\|tail	phage tail protein	A0A222ZFV4	Arthrobacter_phage	1.3e-12	30.2
WP_088532451.1\|195635_196967_+	S8 family serine peptidase	A0A218KC60	Bacillus_phage	7.7e-06	26.1

DBSCAN-SWA_17

220795 : 222645

Leptospira_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088530886.1\|220795_222283_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.5e-69	34.1
WP_088532459.1\|222363_222645_-	IS66 family insertion sequence element accessory protein TnpB	S5WJH4	Leptospira_phage	1.7e-11	43.1

DBSCAN-SWA_18

228498 : 230234

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532463.1\|228498_229533_+	PAS domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	1.5e-09	22.7
WP_010373790.1\|229532_230234_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.7e-26	32.6

DBSCAN-SWA_19

243453 : 244212

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532474.1\|243453_244212_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	6.7e-23	47.4

DBSCAN-SWA_20

268726 : 269452

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532493.1\|268726_269452_-	SDR family NAD(P)-dependent oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	1.3e-52	50.6

DBSCAN-SWA_21

285192 : 286053

Heliothis_virescens_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532505.1\|285192_286053_-	S1/P1 nuclease	A4KXI8	Heliothis_virescens_ascovirus	4.1e-08	23.4

DBSCAN-SWA_22

290622 : 293508

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532511.1\|290622_293508_+	insulinase family protein	A0A1V0SH69	Hokovirus	1.6e-72	26.9

DBSCAN-SWA_23

298671 : 301881

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532517.1\|298671_300594_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	4.0e-149	50.5
WP_088532518.1\|300747_301881_+	molecular chaperone DnaJ	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	1.3e-25	36.3

DBSCAN-SWA_24

307077 : 308721

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532521.1\|307077_308721_-	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	3.2e-38	34.8

DBSCAN-SWA_25

312421 : 315250

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532525.1\|312421_315250_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	3.4e-80	27.4

DBSCAN-SWA_26

320695 : 321979

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532530.1\|320695_321979_+	DEAD/DEAH box helicase	A0A1V0SBR7	Catovirus	4.9e-50	33.9

DBSCAN-SWA_27

335368 : 336847

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532544.1\|335368_336847_-	deoxyribodipyrimidine photo-lyase	A0A1V0S949	Catovirus	1.8e-24	23.8

DBSCAN-SWA_28

344509 : 346495

Microcystis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532552.1\|344509_345451_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BUR2	Microcystis_phage	8.9e-09	25.6
WP_088532553.1\|345592_346495_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BUR2	Microcystis_phage	4.7e-07	29.0

DBSCAN-SWA_29

360751 : 363235

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532562.1\|360751_363235_+	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	9.6e-18	48.3

DBSCAN-SWA_30

377461 : 380711

Pigeonpox_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532574.1\|377461_378646_+	alkaline phosphatase family protein	A0A068EE11	Pigeonpox_virus	1.3e-52	33.1
WP_088532576.1\|379121_380711_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	5.4e-22	39.5

DBSCAN-SWA_31

386242 : 387796

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532580.1\|386242_387796_+	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	3.0e-41	50.6

DBSCAN-SWA_32

399708 : 400632

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532591.1\|399708_400632_-	diguanylate cyclase	G3MA91	Bacillus_virus	3.2e-11	29.3

DBSCAN-SWA_33

406282 : 411981

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532594.1\|406282_407194_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	4.0e-30	33.8
WP_088532595.1\|407195_409028_-	protein translocase subunit SecD	NA	NA	NA	NA
WP_088532596.1\|409165_409642_-	hypothetical protein	NA	NA	NA	NA
WP_088532597.1\|409792_410068_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.6e-19	56.2
WP_088532598.1\|410222_410747_-	DUF2878 family protein	NA	NA	NA	NA
WP_088532599.1\|410718_411981_-	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	1.7e-47	33.3

DBSCAN-SWA_34

415100 : 418725

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532604.1\|415100_416480_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	1.5e-60	33.1
WP_088532605.1\|416482_417442_-	DUF1722 domain-containing protein	NA	NA	NA	NA
WP_088532606.1\|417457_418108_-	cupin domain-containing protein	NA	NA	NA	NA
WP_010377183.1\|418104_418725_-	sigma-70 family RNA polymerase sigma factor	A0A0F6TH34	Sinorhizobium_phage	2.5e-07	29.2

DBSCAN-SWA_35

426178 : 427831

Hepacivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532612.1\|426178_427831_-	long-chain-fatty-acid--CoA ligase FadD	Q75ZG1	Hepacivirus	4.8e-42	26.7

DBSCAN-SWA_36

431471 : 433394

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_174694588.1\|431471_433394_-	DEAD/DEAH box helicase	A0A127AW80	Bacillus_phage	1.2e-89	31.0

DBSCAN-SWA_37

438138 : 451293

Faustovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532623.1\|438138_439206_+	histidinol-phosphate transaminase	A0A142C026	Faustovirus	4.9e-11	23.5
WP_088532624.1\|439202_440264_+	bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_088532625.1\|440260_440851_+	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_088532626.1\|440863_441598_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	A0A1V0SIZ6	Klosneuvirus	5.0e-07	22.9
WP_088532627.1\|441579_442353_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_088532628.1\|442349_442961_+	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	A0A2H4UVM0	Bodo_saltans_virus	1.1e-18	34.9
WP_088532629.1\|443182_443683_+	hypothetical protein	NA	NA	NA	NA
WP_088532630.1\|443986_444748_+	glycosyltransferase family 25 protein	A0A1V0S9H0	Catovirus	2.4e-12	29.7
WP_045990127.1\|444943_445492_+	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_088533134.1\|445582_447361_-	M61 family metallopeptidase	NA	NA	NA	NA
WP_088532631.1\|447539_449072_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.7e-20	36.3
WP_088532632.1\|449173_450517_+	LOG family protein	NA	NA	NA	NA
WP_088532633.1\|450522_451293_+	flap endonuclease Xni	A0A218MKA5	uncultured_virus	1.3e-10	28.1

DBSCAN-SWA_38

458233 : 465394

Yellowstone_lake_phycodnavirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010605491.1\|458233_459955_+	acetolactate synthase 3 large subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	1.5e-54	30.1
WP_088532636.1\|459954_460452_+	acetolactate synthase small subunit	NA	NA	NA	NA
WP_088532637.1\|460607_461108_+	DUF4240 domain-containing protein	NA	NA	NA	NA
WP_088532638.1\|461323_462547_+	FG-GAP repeat protein	E5ERA2	Bathycoccus_sp._RCC1105_virus	4.8e-47	30.8
WP_088532639.1\|462949_463393_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_088532640.1\|463399_465394_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.5e-18	26.6

DBSCAN-SWA_39

492647 : 502615

Acanthamoeba_polyphaga_lentillevirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532654.1\|492647_494582_-	RecQ family ATP-dependent DNA helicase	J2YAJ8	Acanthamoeba_polyphaga_lentillevirus	4.8e-57	35.8
WP_088532655.1\|494578_495340_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_088532656.1\|495506_497975_-	chitinase	Q6R8F1	Orgyia_ericae_nucleopolyhedrovirus	1.6e-153	50.0
WP_088532657.1\|498027_499455_-	lytic polysaccharide monooxygenase	Q91BI7	Spodoptera_litura_multicapsid_nucleopolyhedrovirus	6.2e-38	37.1
WP_088532658.1\|499501_502615_-	chitinase C-terminal domain-containing protein	A0A2K9KZQ8	Tupanvirus	4.7e-30	26.7

DBSCAN-SWA_40

507929 : 510305

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532661.1\|507929_510305_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	1.1e-180	38.4

DBSCAN-SWA_41

518641 : 532611

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532664.1\|518641_519874_+	AAA family ATPase	Q1MVJ3	Enterobacteria_phage	8.7e-20	26.5
WP_088532665.1\|519887_520850_+	ParB N-terminal domain-containing protein	Q6UAV8	Klebsiella_phage	1.0e-15	26.4
WP_088532666.1\|521020_524113_+	DEAD/DEAH box helicase	Q8B9K8	Rachiplusia_ou_multiple_nucleopolyhedrovirus	2.9e-48	29.2
WP_010376203.1\|524617_524821_+	hypothetical protein	NA	NA	NA	NA
WP_088532668.1\|524826_525513_+	response regulator	W8CYM9	Bacillus_phage	6.7e-30	32.1
WP_088532669.1\|525575_527057_+	DNA recombination protein RmuC	NA	NA	NA	NA
WP_088532670.1\|527124_527610_-	hypothetical protein	NA	NA	NA	NA
WP_088532671.1\|527968_530512_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	1.2e-12	35.7
WP_088532672.1\|530562_532611_-	tetratricopeptide repeat protein	W8CYF6	Bacillus_phage	1.9e-16	24.9

DBSCAN-SWA_42

539953 : 540190

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532678.1\|539953_540190_+	helix-turn-helix transcriptional regulator	S5M643	Brevibacillus_phage	9.7e-05	52.2

DBSCAN-SWA_43

543595 : 545263

Catovirus(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_174694589.1\|543595_545263_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	6.1e-61	31.9

DBSCAN-SWA_44

549520 : 556373

Acinetobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532688.1\|549520_551515_+	ligand-gated channel protein	A0A0P0I887	Acinetobacter_phage	9.1e-11	30.7
WP_088532689.1\|551514_552606_+	PepSY-associated TM helix domain-containing protein	NA	NA	NA	NA
WP_088532690.1\|552608_553436_+	DUF4198 domain-containing protein	NA	NA	NA	NA
WP_157757271.1\|553670_554723_-	DNA topoisomerase IB	A0A0G2Y4T8	Acanthamoeba_polyphaga_mimivirus	1.8e-26	27.0
WP_088533135.1\|554840_556373_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.0e-22	26.3

DBSCAN-SWA_45

563603 : 563978

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532699.1\|563603_563978_-	PH domain-containing protein	A5GZ63	Lactococcus_phage	7.4e-07	34.4

DBSCAN-SWA_46

567324 : 570486

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532705.1\|567324_570486_+	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	1.8e-24	39.1

DBSCAN-SWA_47

578510 : 579224

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010376092.1\|578510_579224_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.6e-34	43.3

DBSCAN-SWA_48

587486 : 594584

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532725.1\|587486_588686_+	exonuclease subunit SbcD	A0A217ER54	Bacillus_phage	4.9e-12	25.9
WP_088532726.1\|588690_592350_+	AAA family ATPase	A0A1D8KN42	Synechococcus_phage	4.1e-09	25.1
WP_088532727.1\|592360_593023_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_088532728.1\|593332_593872_-	hypothetical protein	NA	NA	NA	NA
WP_088532729.1\|594047_594584_+	lipocalin family protein	A0A1W6JNX6	Morganella_phage	4.0e-38	41.7

DBSCAN-SWA_49

608131 : 618360

Anomala_cuprea_entomopoxvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532739.1\|608131_609019_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.9e-21	28.7
WP_010376030.1\|609167_609677_-	DUF2141 domain-containing protein	NA	NA	NA	NA
WP_088532740.1\|609947_610775_+	pirin family protein	NA	NA	NA	NA
WP_088532741.1\|610784_611768_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_088532742.1\|611939_615338_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	1.5e-42	29.1
WP_088532743.1\|615381_615957_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_088532744.1\|616194_618360_+	M3 family metallopeptidase	A0A1V0SID3	Klosneuvirus	1.1e-38	24.4

DBSCAN-SWA_50

623372 : 624101

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532748.1\|623372_624101_-	glutathione peroxidase	A0A1D8KSL1	Synechococcus_phage	5.6e-43	55.3

DBSCAN-SWA_51

632646 : 651905

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532753.1\|632646_633429_+	MBL fold metallo-hydrolase	U5PU04	Bacillus_phage	2.3e-10	30.7
WP_088532754.1\|633425_633782_-	Hpt domain-containing protein	NA	NA	NA	NA
WP_088533137.1\|633778_636517_-	response regulator	A0A1V0SGX0	Hokovirus	4.7e-42	41.2
WP_088532755.1\|636819_637710_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_088532756.1\|637835_639566_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.3e-85	35.8
WP_151201446.1\|639790_639973_+	hypothetical protein	NA	NA	NA	NA
WP_088532757.1\|640252_640714_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_088532758.1\|640702_640942_-	Rho-binding antiterminator	NA	NA	NA	NA
WP_088532759.1\|641169_643311_-	S9 family peptidase	A0A1V0SHT0	Klosneuvirus	6.9e-73	32.1
WP_088532760.1\|643542_644073_-	DUF3833 domain-containing protein	NA	NA	NA	NA
WP_088532761.1\|644844_645321_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_088532762.1\|645381_645657_-	SelT/SelW/SelH family protein	NA	NA	NA	NA
WP_088532763.1\|645860_647021_-	aspartyl/asparaginyl beta-hydroxylase domain-containing protein	H8ZJK8	Ostreococcus_tauri_virus	1.6e-07	25.2
WP_088532764.1\|647038_648838_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_088532765.1\|649061_651905_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	5.6e-38	23.9

DBSCAN-SWA_52

658157 : 658847

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532773.1\|658157_658847_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-29	38.0

DBSCAN-SWA_53

678117 : 680050

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532789.1\|678117_679353_-	ATP-binding protein	W8CYF6	Bacillus_phage	1.6e-13	27.5
WP_010375648.1\|679360_680050_-	response regulator	W8CYM9	Bacillus_phage	2.8e-36	37.0

DBSCAN-SWA_54

683594 : 699352

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532792.1\|683594_684848_-	two-component sensor histidine kinase	A0A1V0SGX0	Hokovirus	1.6e-13	27.9
WP_088532793.1\|684847_685540_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.1e-39	37.3
WP_088532794.1\|685548_685920_-	DUF3019 domain-containing protein	NA	NA	NA	NA
WP_088532795.1\|686967_688125_+	serine hydrolase	A0A218M8S6	Mycobacterium_phage	1.1e-13	25.0
WP_088532796.1\|688171_691207_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	2.1e-30	24.0
WP_088532797.1\|691547_693617_+	PD40 domain-containing protein	NA	NA	NA	NA
WP_088532798.1\|693736_694210_+	peroxiredoxin	M1I839	Pelagibacter_phage	7.1e-23	46.0
WP_088532799.1\|694808_695225_-	hypothetical protein	NA	NA	NA	NA
WP_088532800.1\|696616_699352_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.3e-11	54.3

DBSCAN-SWA_55

726293 : 728477

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532819.1\|726293_728477_+	EAL domain-containing protein	G3MA91	Bacillus_virus	4.5e-19	31.5

DBSCAN-SWA_56

732596 : 734882

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532823.1\|732596_734882_+	family 20 glycosylhydrolase	A0A2H4UUW7	Bodo_saltans_virus	2.3e-10	29.9

DBSCAN-SWA_57

743112 : 743325

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010375758.1\|743112_743325_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	6.6e-21	70.1

DBSCAN-SWA_58

762606 : 764037

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532844.1\|762606_764037_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	9.1e-21	25.7

DBSCAN-SWA_59

771822 : 773886

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532851.1\|771822_772887_+	zinc-binding dehydrogenase	E3SJ82	Synechococcus_phage	5.0e-08	24.0
WP_088532852.1\|772896_773886_+	NAD-dependent epimerase/dehydratase family protein	A0A0M3ZHF0	Turkeypox_virus	9.1e-12	24.8

DBSCAN-SWA_60

781144 : 782476

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532859.1\|781144_782476_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	3.8e-21	22.6

DBSCAN-SWA_61

785532 : 791103

Lactococcus_phage(25.0%)

integrase

attL 779542:779555|attR 797969:797982

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
779542:779555	attL	NA	NA	NA	NA
WP_088532864.1\|785532_785742_+	cold shock domain-containing protein	Q9AZD3	Lactococcus_phage	3.4e-17	66.1
WP_010370222.1\|786398_786794_+	DUF4879 domain-containing protein	NA	NA	NA	NA
WP_088532865.1\|787469_787811_+	alkylphosphonate utilization protein	NA	NA	NA	NA
WP_088532866.1\|788506_788962_-\|integrase	phage integrase N-terminal SAM-like domain-containing protein	A0A1P8DJJ6	Virus_Rctr41k	1.8e-10	31.5
WP_088532867.1\|789357_790062_+	hypothetical protein	NA	NA	NA	NA
WP_088533140.1\|790063_790504_+	DUF488 domain-containing protein	A0A1B3AYW8	Gordonia_phage	4.8e-05	26.9
WP_088532868.1\|790503_791103_+	DUF4326 domain-containing protein	A0A0A0YQT2	Escherichia_phage	2.7e-11	39.4
797969:797982	attR	NA	NA	NA	NA

DBSCAN-SWA_62

805628 : 810291

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532880.1\|805628_806642_-	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	8.1e-40	32.3
WP_088532881.1\|806787_810291_-	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	3.3e-08	29.5

DBSCAN-SWA_63

815136 : 815853

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010370144.1\|815136_815853_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.0e-41	41.4

DBSCAN-SWA_64

823102 : 824092

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532893.1\|823102_824092_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.1e-17	35.1

DBSCAN-SWA_65

837799 : 841258

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532905.1\|837799_838210_+	NUDIX domain-containing protein	A0A1L7N0J3	Ralstonia_phage	4.0e-22	45.2
WP_088532906.1\|838230_838671_+	DUF2214 family protein	NA	NA	NA	NA
WP_017217706.1\|838667_839084_+	VOC family protein	NA	NA	NA	NA
WP_088532907.1\|839080_839740_+	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_088532908.1\|840451_841258_-	heme ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	1.3e-11	26.1

DBSCAN-SWA_66

886851 : 888301

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532942.1\|886851_887544_+	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	7.8e-10	27.6
WP_088532943.1\|887644_888301_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.4e-31	36.7

DBSCAN-SWA_67

891994 : 895273

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532946.1\|891994_895273_+	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	2.3e-59	28.5

DBSCAN-SWA_68

902266 : 903778

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532949.1\|902266_903778_+	S8 family peptidase	A0A1B0T6A2	Bacillus_phage	1.1e-32	39.8

DBSCAN-SWA_69

914874 : 915504

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010603723.1\|914874_915504_-	uridine kinase	A0A2K9L505	Tupanvirus	2.9e-32	37.6

DBSCAN-SWA_70

926058 : 932479

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532965.1\|926058_928824_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-11	33.3
WP_088532966.1\|929080_929827_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_088532967.1\|929890_932479_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	3.7e-113	30.2

DBSCAN-SWA_71

936145 : 936586

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532971.1\|936145_936586_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	2.7e-08	31.4

DBSCAN-SWA_72

941852 : 942713

Tanapox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532976.1\|941852_942713_-	alpha/beta fold hydrolase	A7XCB7	Tanapox_virus	9.4e-05	32.2

DBSCAN-SWA_73

960834 : 962700

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088532992.1\|960834_962700_-	S8 family peptidase	A0A1B0T6A2	Bacillus_phage	1.2e-28	35.2

DBSCAN-SWA_74

980005 : 992377

uncultured_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088533002.1\|980005_982384_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.1e-119	38.5
WP_010369762.1\|982389_982800_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_088533003.1\|984222_985431_-	cysteine desulfurase	Q2XUY6	environmental_halophage	4.5e-21	24.1
WP_088533004.1\|985488_986349_-	hypothetical protein	NA	NA	NA	NA
WP_088533005.1\|986984_988859_+	FAD-dependent oxidoreductase	A0A2K9L5Z9	Tupanvirus	9.4e-26	25.7
WP_088533006.1\|988845_990609_+	alpha-keto acid decarboxylase family protein	NA	NA	NA	NA
WP_088533007.1\|990601_992377_+	FAD-dependent oxidoreductase	S4VRT3	Pandoravirus	8.3e-24	35.0

DBSCAN-SWA_75

997228 : 1001475

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088533014.1\|997228_998686_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.9e-21	23.7
WP_088533015.1\|998678_999011_+	hypothetical protein	NA	NA	NA	NA
WP_088533016.1\|999007_999412_+	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_088533017.1\|999486_1000176_-	DUF4386 family protein	NA	NA	NA	NA
WP_069022850.1\|1000335_1001475_-	S8 family serine peptidase	A0A2K9L199	Tupanvirus	5.5e-29	34.4

DBSCAN-SWA_76

1015087 : 1015585

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088533030.1\|1015087_1015585_+	GrpB family protein	A0A2K5B2B6	Erysipelothrix_phage	3.1e-08	30.6

DBSCAN-SWA_77

1029222 : 1029777

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088533034.1\|1029222_1029777_+	type 1 glutamine amidotransferase	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	6.0e-21	33.5

DBSCAN-SWA_78

1033600 : 1033813

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010369631.1\|1033600_1033813_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.0e-21	72.1

DBSCAN-SWA_79

1047504 : 1054750

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088533050.1\|1047504_1048680_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.1e-16	35.5
WP_088533051.1\|1048775_1049573_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_088533052.1\|1050000_1050210_+	hypothetical protein	NA	NA	NA	NA
WP_088533053.1\|1050267_1052436_-	S9 family peptidase	F2Y2Z7	Organic_Lake_phycodnavirus	5.6e-38	27.1
WP_088533054.1\|1052797_1054750_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.2e-16	26.1

DBSCAN-SWA_80

1060947 : 1061394

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010379331.1\|1060947_1061394_-	Hsp20 family protein	A0A218MMV3	uncultured_virus	7.7e-19	41.3

DBSCAN-SWA_81

1089113 : 1119750

Bacillus_virus(40.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088533081.1\|1089113_1090196_-	CZB domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.2e-11	66.1
WP_088533082.1\|1090370_1091150_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	1.5e-09	28.5
WP_088533083.1\|1091280_1091703_-	DUF3429 domain-containing protein	NA	NA	NA	NA
WP_088533084.1\|1091931_1092501_+	peroxiredoxin	NA	NA	NA	NA
WP_088533085.1\|1092607_1094176_+	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	7.3e-40	32.8
WP_088533086.1\|1094682_1096056_+	diaminobutyrate--2-oxoglutarate transaminase family protein	A0A1V0SKB7	Klosneuvirus	1.1e-26	27.9
WP_088533087.1\|1096061_1097360_+	hypothetical protein	NA	NA	NA	NA
WP_157757279.1\|1097400_1098549_+\|protease	aspartyl protease family protein	NA	NA	NA	NA
WP_088533089.1\|1098585_1119750_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	1.1e-143	26.3

DBSCAN-SWA_82

1127373 : 1130463

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157757282.1\|1127373_1130463_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.4e-39	20.6

DBSCAN-SWA_83

1136812 : 1141051

Lymantria_dispar_multicapsid_nuclear_polyhedrosis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088533099.1\|1136812_1138387_+	lytic polysaccharide monooxygenase	Q90166	Lymantria_dispar_multicapsid_nuclear_polyhedrosis_virus	1.1e-30	36.7
WP_088533100.1\|1138408_1141051_+	chitinase	B0FDP2	Orgyia_leucostigma_nucleopolyhedrovirus	3.0e-155	49.2

DBSCAN-SWA_84

1156705 : 1160383

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088533110.1\|1156705_1160383_-	PKD domain-containing protein	A0A1V0SLL0	Klosneuvirus	1.6e-08	27.7

DBSCAN-SWA_85

1166230 : 1168553

Planktothrix_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045989271.1\|1166230_1166917_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-38	41.5
WP_088533116.1\|1167144_1167597_-\|protease	activity regulator of membrane protease YbbK	NA	NA	NA	NA
WP_088533117.1\|1167602_1168553_-	paraslipin	A0A1V0SB59	Catovirus	3.9e-20	35.1

DBSCAN-SWA_86

1175913 : 1181140

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088533123.1\|1175913_1177212_+	PAS domain-containing methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.6e-16	43.5
WP_088533124.1\|1177420_1179268_-	choice-of-anchor I family protein	NA	NA	NA	NA
WP_088533125.1\|1179586_1181140_+	CHRD domain-containing protein	A0A2K9L200	Tupanvirus	2.5e-08	34.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021646

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP021647

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection