CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP021911	Bacillus sp. MD-5 chromosome, complete genome	1 crisprs	csa3,DEDDh,WYL,DinG,cas3	0	1	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021911_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021911_1

2910720-2910827

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021911_1

>merge|NZ_CP021911|1|2910720-2910827|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>NZ_CP021911|1|1|2910720-2910827|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021911.1\|WP_040082024.1\|2907080_2908223_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NZ_CP021911.1\|WP_040082015.1\|2923571_2925044_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
NZ_CP021911.1\|WP_040082027.1\|2902191_2904588_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
NZ_CP021911.1\|WP_082032952.1\|2900527_2901601_+\|spore-coat-kinase-CotI	unknown	unknown	gnl\|CDD\|131952
NZ_CP021911.1\|WP_040082030.1\|2899204_2900338_-\|spore-coat-protein-CotSA	unknown	unknown	gnl\|CDD\|340831
NZ_CP021911.1\|WP_014665115.1\|2898134_2899190_-\|spore-coat-protein-CotS	unknown	unknown	gnl\|CDD\|131952
NZ_CP021911.1\|WP_040082020.1\|2918404_2918926_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP021911.1\|WP_014665133.1\|2925983_2926529_+\|biofilm-surface-layer-protein-BslA	unknown	unknown	gnl\|CDD\|379999
NZ_CP021911.1\|WP_040082022.1\|2917785_2918364_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
NZ_CP021911.1\|WP_040082017.1\|2921186_2921675_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NZ_CP021911.1\|WP_040082013.1\|2925243_2925786_+\|transcriptional-regulator-GbsR	unknown	unknown	gnl\|CDD\|224427
NZ_CP021911.1\|WP_040082028.1\|2901693_2902161_+\|TspO/MBR-family-protein	unknown	unknown	gnl\|CDD\|226007
NZ_CP021911.1\|WP_040082026.1\|2904574_2906029_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NZ_CP021911.1\|WP_040082025.1\|2906025_2907057_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
NZ_CP021911.1\|WP_040082016.1\|2921680_2922259_-\|molybdenum-cofactor-sulfurase	unknown	unknown	gnl\|CDD\|377051
NZ_CP021911.1\|WP_040082527.1\|2922346_2923555_-\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
NZ_CP021911.1\|WP_040082019.1\|2920493_2921018_-\|membrane-protein	unknown	unknown	gnl\|CDD\|376684
NZ_CP021911.1\|WP_014665126.1\|2918943_2920473_-\|flotillin-lipid-rafts-scaffold-protein-FloT	unknown	unknown	gnl\|CDD\|225177
NZ_CP021911.1\|WP_040082031.1\|2897698_2898133_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021911.1\|WP_040082023.1\|2908219_2910103_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667

Protein	Function_ID	Function_description	E-value
NZ_CP021911.1\|WP_040082024.1\|2907080_2908223_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NZ_CP021911.1\|WP_040082015.1\|2923571_2925044_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
NZ_CP021911.1\|WP_040082027.1\|2902191_2904588_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP021911.1\|WP_082032952.1\|2900527_2901601_+\|spore-coat-kinase-CotI	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	1.96764e-131
NZ_CP021911.1\|WP_040082020.1\|2918404_2918926_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.10771e-10
NZ_CP021911.1\|WP_014665115.1\|2898134_2899190_-\|spore-coat-protein-CotS	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	3.21953e-130
NZ_CP021911.1\|WP_040082030.1\|2899204_2900338_-\|spore-coat-protein-CotSA	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.59234e-73
NZ_CP021911.1\|WP_014665133.1\|2925983_2926529_+\|biofilm-surface-layer-protein-BslA	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	2.32574e-46
NZ_CP021911.1\|WP_040082022.1\|2917785_2918364_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.47961e-71
NZ_CP021911.1\|WP_040082017.1\|2921186_2921675_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	5.37e-18
NZ_CP021911.1\|WP_040082028.1\|2901693_2902161_+\|TspO/MBR-family-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	1.25205e-38
NZ_CP021911.1\|WP_040082026.1\|2904574_2906029_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NZ_CP021911.1\|WP_040082025.1\|2906025_2907057_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP021911.1\|WP_040082016.1\|2921680_2922259_-\|molybdenum-cofactor-sulfurase	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	2.31347e-05
NZ_CP021911.1\|WP_040082527.1\|2922346_2923555_-\|choline-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	2.98957e-175
NZ_CP021911.1\|WP_040082019.1\|2920493_2921018_-\|membrane-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	4.94328e-05
NZ_CP021911.1\|WP_014665126.1\|2918943_2920473_-\|flotillin-lipid-rafts-scaffold-protein-FloT	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	2.05993e-122
NZ_CP021911.1\|WP_040082013.1\|2925243_2925786_+\|transcriptional-regulator-GbsR	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	1.05468e-71
NZ_CP021911.1\|WP_040082023.1\|2908219_2910103_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0

>NZ_CP021911.1|WP_040082023.1|2908219_2910103_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHFRELNGTSGYEFCVWAPHASEVRVAGDFNSWSGEQHVMHRVNDNGIWTLFIPGLGEKERYKYEIVTNCGEIRLKADPYAIYSEVRPNTASLTYDLEGYSWQDQKWQKKQKTKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGTPHDLMRFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVEFLKKLNQTMREAYPQVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKHGEALVIICNFTPAVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVRKRGEIKR
>NZ_CP021911.1|WP_040082024.1|2907080_2908223_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDFHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITQFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLKEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHATVKSSVIMPDVTIGEHVVIENAIVPKGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>NZ_CP021911.1|WP_040082025.1|2906025_2907057_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFWDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKELIYGHSEKGYKTIQEAVEKEASALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
>NZ_CP021911.1|WP_040082026.1|2904574_2906029_-|glycogen-synthase-GlgA
MKILFAVSECTPFVKSGGLADVAGALPKALARLGNEVAVMLPKYSQIPEPWKMSMKKKAECTVAVGWRQQYCGIEHMAEDDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAKVVNVQADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPSYRNEILTPYYGEQLEQVLQYRENDVTGILNGIDDTFYQPKSDPYIEAQYDSEHLACKLENKTRLQRRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRSYQEEEGTGNGFTFSAFNAHDLKFTIERALSFYRQQDVWQSIMKTAMNADYSWGKSAKEYQRIFEHVTRSGRDVLE
>NZ_CP021911.1|WP_040082027.1|2902191_2904588_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIKTNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKDIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGKVHMTEKSGRLHFRHEQATIVTAVPYDIPVIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEEDMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFSPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIENMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIHLESYASDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPDSIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDAGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVADKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADDVLSYQENGGYRSREYYQHDRRIRQVVDQLINGFFEGEADEFESIYDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSERSIVNIAHSGYFSSDRTIREYAKDIWGIKPMI
>NZ_CP021911.1|WP_040082028.1|2901693_2902161_+|TspO/MBR-family-protein
MKKMIGAIAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGSAIGIIWAILFALISLSAAIIYAAFSFKGAKSFWFALLINYVLNQAFSYFQFTQKNLLAASIDCLLVAITAIVLLIIAKKYSRAASYLLLPYFLWSAFATFLSFAIDSMNL
>NZ_CP021911.1|WP_082032952.1|2900527_2901601_+|spore-coat-kinase-CotI
MCPLMAENHEVIEEGNSSELPLSAEDEKKLTELAENVLQGWDVHAEKIDVIQGNQMALVWKVHTGSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMETWKLMARAEKEDPFSQLYLQEIDSFIEDGLRIKDRLLQSAYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDDETFHVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKSNALQQLI
>NZ_CP021911.1|WP_040082030.1|2899204_2900338_-|spore-coat-protein-CotSA
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADRETVDGVHYVHLDEDRYEEAVGEELRRSRFDLVHVCNRPSWVPKLKKQAPKAVFILSVHNEMFAYDKISQAEGEICIDTVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKAYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAEHINDLLRSSEKRERLGKYSRREAESNFGWQRVAENLLSVYEKNR
>NZ_CP021911.1|WP_014665115.1|2898134_2899190_-|spore-coat-protein-CotS
MYQKEHEEQIVSEILSYYPFHIDNVALKSNKSGRKIWEVQTDHGPKLLKEAQMKPERMLFITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALQALDDSEYETWTKETLEHGGFCFQDFTLARLTEIDGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDKVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDSFLDKLPELYKKIKAYREAN
>NZ_CP021911.1|WP_040082031.1|2897698_2898133_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGSMGWQAHDSISAEKEEEEKHLAVGSIRELPHINAPKEYQEETKEKETEHNIINDEEETKFETAREPEEERESKRSMPLFEEEEHDDEEPELAEEARVEIIILPSDSKPAPWFSSAVKRKA
>NZ_CP021911.1|WP_040082022.1|2917785_2918364_+|energy-coupled-thiamine-transporter-ThiT
MDQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVAKTKGKLIVTVVSAVFIGSFLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKADKA
>NZ_CP021911.1|WP_040082020.1|2918404_2918926_-|GNAT-family-N-acetyltransferase
MVTVREARLDDIKDIAKVHVDSWRTTYHEIIPADYLNSLNYKEFEDKWKSRSLKGVFVTQDEKGSVFGFASFGPIRSEQEGYDGELYAIYLLEEHQRQGAGRALLTKGAEFLLQHGFSSMFVWVIEQNPSIIFYQSYSPERVSEDSFEIAGVRLKEAGLGWPDLSALKTLLNR
>NZ_CP021911.1|WP_014665126.1|2918943_2920473_-|flotillin-lipid-rafts-scaffold-protein-FloT
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRLKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKINQLKMAEFRRDQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMIENFSGKGNVKQSINELTNEIKEAKTVQKSE
>NZ_CP021911.1|WP_040082019.1|2920493_2921018_-|membrane-protein
MELFGVPIQTIYLYTLMIAGSLTLLFLFFGDVFAGLSEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVILLHIFVLVPLSSAEESLAYREDDLRGRVGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDISNGVLSVTPHESI
>NZ_CP021911.1|WP_040082017.1|2921186_2921675_+|DinB-family-protein
MSIFNEARLETWNELKGLSDEKLNQKPSADEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKPLEVAQNRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTATIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>NZ_CP021911.1|WP_040082016.1|2921680_2922259_-|molybdenum-cofactor-sulfurase
MWKRMTAKAEGLYIADTESFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGIPDLTTLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPEQPKLAPAFVRHALDIRGIVCIVERPGAVYAGDEIEVHSYQRKVKRKAERV
>NZ_CP021911.1|WP_040082527.1|2922346_2923555_-|choline-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVKELEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>NZ_CP021911.1|WP_040082015.1|2923571_2925044_-|betaine-aldehyde-dehydrogenase
MSQTFYIDGEWISAEKGQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAGLIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAANKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPALQNGFFYEPTIFSNCKSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>NZ_CP021911.1|WP_040082013.1|2925243_2925786_+|transcriptional-regulator-GbsR
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQKVLSKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAEAVQSGEIFKFIPIETK
>NZ_CP021911.1|WP_014665133.1|2925983_2926529_+|biofilm-surface-layer-protein-BslA
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTMNGNALRETQILNNGKTVRIPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP021911_1	1.1\|2910744\|60\|NZ_CP021911\|CRISPRCasFinder	2910744-2910803	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
NZ_CP021911_1	1.1\|2910744\|60\|NZ_CP021911\|CRISPRCasFinder	2910744-2910803	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
NZ_CP021911_1	1.1\|2910744\|60\|NZ_CP021911\|CRISPRCasFinder	2910744-2910803	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
NZ_CP021911_1	1.1\|2910744\|60\|NZ_CP021911\|CRISPRCasFinder	2910744-2910803	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
NZ_CP021911_1	1.1\|2910744\|60\|NZ_CP021911\|CRISPRCasFinder	2910744-2910803	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
NZ_CP021911_1	1.1\|2910744\|60\|NZ_CP021911\|CRISPRCasFinder	2910744-2910803	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
NZ_CP021911_1	1.1\|2910744\|60\|NZ_CP021911\|CRISPRCasFinder	2910744-2910803	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
NZ_CP021911_1	1.1\|2910744\|60\|NZ_CP021911\|CRISPRCasFinder	2910744-2910803	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
NZ_CP021911_1	1.1\|2910744\|60\|NZ_CP021911\|CRISPRCasFinder	2910744-2910803	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 1.1|2910744|60|NZ_CP021911|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 1.1|2910744|60|NZ_CP021911|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 1.1|2910744|60|NZ_CP021911|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 1.1|2910744|60|NZ_CP021911|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 1.1|2910744|60|NZ_CP021911|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 1.1|2910744|60|NZ_CP021911|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 1.1|2910744|60|NZ_CP021911|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 1.1|2910744|60|NZ_CP021911|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 1.1|2910744|60|NZ_CP021911|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

513987 : 522352

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003233955.1\|513987_515283_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
WP_014663061.1\|515356_516082_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	2.7e-45	43.7
WP_003219409.1\|516074_516329_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_014663062.1\|516325_517009_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_014663063.1\|516992_519221_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	7.2e-158	39.9
WP_003233947.1\|519196_520627_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
WP_040083960.1\|520727_521768_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.7e-64	42.0
WP_014663065.1\|521764_522352_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.2e-29	42.1

DBSCAN-SWA_2

1165499 : 1238267

Bacillus_phage(25.58%)

holin,protease,plate,portal,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040083384.1\|1165499_1166771_+	ATPase YjoB	A0A1V0SEI6	Indivirus	8.6e-15	37.1
WP_080478209.1\|1166915_1168052_+	response regulator aspartate phosphatase RapA	A0A1P8CWN8	Bacillus_phage	1.7e-94	47.6
WP_014663627.1\|1168041_1168176_+	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
WP_014663628.1\|1168206_1168461_-	YciI family protein	NA	NA	NA	NA
WP_040083382.1\|1168582_1169536_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	6.8e-65	71.7
WP_014479546.1\|1169573_1169951_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	7.9e-17	42.3
WP_040083381.1\|1170055_1170658_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	1.7e-45	49.2
WP_014663631.1\|1170734_1171571_+	manganese catalase	NA	NA	NA	NA
WP_040083380.1\|1171614_1172211_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	6.2e-40	51.7
WP_014663633.1\|1172375_1172714_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	2.9e-18	45.3
WP_003232712.1\|1172892_1173072_+	hypothetical protein	NA	NA	NA	NA
WP_040083379.1\|1173058_1173895_+	hypothetical protein	S6BFM4	Thermus_phage	1.9e-23	29.7
WP_080478210.1\|1173794_1174595_+	ATP-binding protein	A6XMI1	Bacillus_virus	5.0e-61	52.2
WP_014663637.1\|1174594_1174762_+	hypothetical protein	NA	NA	NA	NA
WP_014663639.1\|1174846_1175197_+	hypothetical protein	NA	NA	NA	NA
WP_040083377.1\|1175193_1175400_+	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	2.1e-11	50.0
WP_014663641.1\|1175514_1176024_+	sigma-70 family RNA polymerase sigma factor	A0A0K2CNQ1	Brevibacillus_phage	3.6e-20	39.5
WP_040083376.1\|1176141_1176939_+\|terminase	terminase	A0A0S2MVB6	Bacillus_phage	9.4e-60	50.2
WP_040083375.1\|1176935_1178237_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.1e-153	60.7
WP_040083374.1\|1178240_1179728_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	3.5e-140	55.7
WP_040083373.1\|1179747_1180575_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	7.3e-55	58.7
WP_003232690.1\|1180600_1181536_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
WP_040083372.1\|1181557_1181941_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	1.4e-13	40.5
WP_040083371.1\|1181937_1182294_+	YqbH/XkdH family protein	NA	NA	NA	NA
WP_014663648.1\|1182290_1182776_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	4.0e-37	46.4
WP_040083370.1\|1182788_1183229_+	hypothetical protein	NA	NA	NA	NA
WP_003220589.1\|1183232_1183451_+	hypothetical protein	NA	NA	NA	NA
WP_040083369.1\|1183447_1184848_+\|portal	phage portal protein	A0A0A7S087	Clostridium_phage	1.8e-77	39.1
WP_003232677.1\|1184849_1185293_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	8.4e-26	45.2
WP_014663652.1\|1185381_1185828_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	7.7e-11	36.8
WP_082033017.1\|1185869_1186007_+	hypothetical protein	NA	NA	NA	NA
WP_040083368.1\|1186017_1190193_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	1.3e-43	45.3
WP_040083367.1\|1190185_1190845_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	3.3e-26	34.0
WP_040083366.1\|1190860_1191838_+\|portal	phage portal protein	H7BV96	unidentified_phage	6.0e-40	32.6
WP_040083365.1\|1191837_1192104_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.7e-05	37.5
WP_040083364.1\|1192161_1192587_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	8.7e-12	37.3
WP_014663658.1\|1192579_1193626_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.3e-72	44.3
WP_040083363.1\|1193609_1194188_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	1.1e-14	33.8
WP_014663660.1\|1194184_1194457_+	hypothetical protein	NA	NA	NA	NA
WP_040083362.1\|1194459_1196547_+	hypothetical protein	A0A1P8CWR7	Bacillus_phage	7.5e-24	38.1
WP_040083361.1\|1196558_1196888_+\|portal	phage portal protein	NA	NA	NA	NA
WP_040083360.1\|1196884_1197049_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	9.3e-15	66.0
WP_040083359.1\|1197093_1197933_+	hypothetical protein	NA	NA	NA	NA
WP_003232655.1\|1197985_1198255_+	hypothetical protein	A0A2H4JD40	uncultured_Caudovirales_phage	6.2e-24	64.8
WP_003232653.1\|1198267_1198531_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	4.7e-24	65.5
WP_040083358.1\|1198543_1199437_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	8.9e-83	69.2
WP_136654612.1\|1199474_1199612_-	hypothetical protein	NA	NA	NA	NA
WP_003239095.1\|1199697_1199868_-	type II toxin-antitoxin system SpoIISB family antitoxin	NA	NA	NA	NA
WP_040083357.1\|1199867_1200614_-	toxin-antitoxin-antitoxin system toxin SpoIISA	NA	NA	NA	NA
WP_014663667.1\|1200723_1201725_-	inorganic phosphate transporter	NA	NA	NA	NA
WP_040083356.1\|1201737_1202355_-	DUF47 domain-containing protein	NA	NA	NA	NA
WP_040083355.1\|1202631_1203948_-	serine/threonine exchanger	NA	NA	NA	NA
WP_040083354.1\|1204333_1205284_+	ring-cleaving dioxygenase	NA	NA	NA	NA
WP_040083353.1\|1205521_1207672_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_014663672.1\|1207683_1208655_+	glycosyltransferase family 2 protein	A0A2H5BFL1	Salmonella_phage	1.9e-62	41.0
WP_040083352.1\|1209174_1210545_-\|protease	serine protease HtrA	A0A1B1IT49	uncultured_Mediterranean_phage	3.8e-24	33.3
WP_040083351.1\|1210710_1211529_+	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
WP_040083350.1\|1211656_1212481_+	D-aminopeptidase DppA	NA	NA	NA	NA
WP_014663677.1\|1212497_1213424_+	dipeptide ABC transporter permease DppB	NA	NA	NA	NA
WP_014663678.1\|1213429_1214392_+	dipeptide ABC transporter permease DppC	NA	NA	NA	NA
WP_040083349.1\|1214396_1215404_+	dipeptide ABC transporter ATP-binding subunit DppD	G9BWD6	Planktothrix_phage	6.8e-15	28.3
WP_082033051.1\|1215406_1217056_+	dipeptide ABC transporter substrate-binding protein DppE	NA	NA	NA	NA
WP_040083347.1\|1217143_1218103_+	LD-carboxypeptidase	NA	NA	NA	NA
WP_040083346.1\|1218099_1219200_+	dipeptide epimerase	NA	NA	NA	NA
WP_040083345.1\|1219196_1220087_+	gamma-D-glutamyl-L-lysine dipeptidyl-peptidase	A0A1J0GW44	Streptomyces_phage	1.7e-17	39.5
WP_040083344.1\|1220099_1221089_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	3.2e-17	33.5
WP_040083343.1\|1221124_1222174_-	6-phosphogluconolactonase	NA	NA	NA	NA
WP_040083342.1\|1222263_1223124_-	hypothetical protein	NA	NA	NA	NA
WP_003232595.1\|1223283_1223802_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_040083341.1\|1224041_1225241_+	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_040083340.1\|1225630_1226362_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_040083339.1\|1226453_1226981_+	DinB family protein	NA	NA	NA	NA
WP_040083338.1\|1226970_1227486_+	GNAT family N-acetyltransferase	G9BWD5	Planktothrix_phage	4.3e-13	31.3
WP_014663694.1\|1227706_1228045_+	multidrug efflux SMR transporter subunit YkkC	NA	NA	NA	NA
WP_014476583.1\|1228044_1228362_+	multidrug efflux SMR transporter subunit YkkD	NA	NA	NA	NA
WP_014663695.1\|1228432_1229335_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_014663696.1\|1229685_1230783_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.8e-70	41.8
WP_014663697.1\|1230794_1232042_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.9e-99	50.8
WP_014663698.1\|1232170_1232596_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_040083337.1\|1232636_1233071_-	organic hydroperoxide resistance transcriptional regulator OhrR	NA	NA	NA	NA
WP_014663700.1\|1233213_1233624_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_040083336.1\|1233960_1234431_-	guanine deaminase	S4VYZ2	Pandoravirus	1.1e-26	46.5
WP_040083335.1\|1234604_1236893_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_014479598.1\|1237307_1238267_-\|protease	serine protease Isp	A0A127AWU5	Bacillus_phage	5.6e-75	49.5

DBSCAN-SWA_3

1720130 : 1726683

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040083097.1\|1720130_1720523_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	1.1e-29	58.3
WP_040083095.1\|1720482_1722585_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
WP_014664066.1\|1722602_1723592_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.1e-155	83.8
WP_040083094.1\|1723640_1724261_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.2e-46	48.4
WP_040083093.1\|1724324_1725092_-	sporulation-specific N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	2.0e-51	49.1
WP_003231746.1\|1725714_1726683_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5

DBSCAN-SWA_4

1925673 : 1937605

Bacillus_phage(90.91%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040082937.1\|1925673_1926048_+	hypothetical protein	A0A1P8CWZ2	Bacillus_phage	9.0e-29	52.8
WP_004399440.1\|1928246_1928369_+	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
WP_157678356.1\|1929004_1929103_-	hypothetical protein	O64031	Bacillus_phage	2.4e-10	96.7
WP_082032990.1\|1929167_1929602_-	type VI secretion protein ImpB	O64031	Bacillus_phage	7.9e-77	97.9
WP_040082935.1\|1929649_1929919_-	YolD-like family protein	A0A1P8CWP2	Bacillus_phage	7.6e-38	89.9
WP_040082934.1\|1930092_1930428_+	hypothetical protein	O64029	Bacillus_phage	5.5e-46	88.3
WP_040082933.1\|1930470_1930827_-	hypothetical protein	O64028	Bacillus_phage	1.2e-59	97.5
WP_040082931.1\|1930832_1931300_-	YolA family protein	O64027	Bacillus_phage	2.8e-80	98.1
WP_052438156.1\|1931531_1931648_+	type I toxin-antitoxin system toxin BsrG	Q96209	Bacillus_phage	9.8e-11	97.4
WP_003231326.1\|1931948_1932407_-	type II toxin-antitoxin system antitoxin YobK	NA	NA	NA	NA
WP_040082929.1\|1932416_1934219_-	type II toxin-antitoxin system toxin ribonuclease YobL	A0A1P8CWI7	Bacillus_phage	3.3e-217	90.2
WP_040082928.1\|1934427_1935888_+	hypothetical protein	NA	NA	NA	NA
WP_040082927.1\|1936146_1936680_-	N-acetyltransferase	A0A1P8CWJ6	Bacillus_phage	1.5e-93	98.9
WP_040082925.1\|1936761_1936971_-\|bacteriocin	bacteriocin-like WGxF protein	NA	NA	NA	NA
WP_040082923.1\|1936984_1937605_-	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	5.3e-18	33.8

DBSCAN-SWA_5

2151174 : 2159069

Staphylococcus_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040082739.1\|2151174_2152323_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	5.0e-22	34.4
WP_040082737.1\|2152445_2152985_-	DUF3907 family protein	NA	NA	NA	NA
WP_014664458.1\|2153039_2153633_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-14	35.4
WP_040083775.1\|2153622_2154378_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.4e-09	29.2
WP_040082736.1\|2154591_2155116_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_040082735.1\|2155129_2155504_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_003223915.1\|2155617_2156082_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
WP_014664462.1\|2156114_2157311_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.1e-115	55.2
WP_040082734.1\|2157325_2157973_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	1.9e-42	45.9
WP_040082733.1\|2157983_2159069_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.3e-56	36.4

DBSCAN-SWA_6

2401188 : 2437258

uncultured_Caudovirales_phage(26.67%)

holin,plate,tail,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040082461.1\|2401188_2402163_-	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	2.7e-64	69.6
WP_040082459.1\|2402207_2402630_-\|holin	holin family protein	D6R405	Bacillus_phage	1.5e-48	73.7
WP_040082458.1\|2402675_2403569_-	hypothetical protein	NA	NA	NA	NA
WP_040082457.1\|2403656_2403821_-	XkdX family protein	NA	NA	NA	NA
WP_040082456.1\|2403817_2404153_-\|portal	phage portal protein	NA	NA	NA	NA
WP_040082454.1\|2404162_2405257_-	hypothetical protein	M4ZRP1	Bacillus_phage	3.4e-20	57.0
WP_040082452.1\|2405260_2405533_-	hypothetical protein	NA	NA	NA	NA
WP_040082450.1\|2405529_2406108_-	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	6.3e-13	33.1
WP_040082448.1\|2406091_2407138_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	2.2e-72	44.0
WP_040082447.1\|2407130_2407556_-	DUF2634 domain-containing protein	A0A0A8WJV8	Clostridium_phage	3.3e-11	34.5
WP_040082446.1\|2407568_2407835_-	DUF2577 domain-containing protein	NA	NA	NA	NA
WP_040082444.1\|2407831_2408812_-	hypothetical protein	H7BV96	unidentified_phage	5.4e-41	32.6
WP_019715086.1\|2408825_2409485_-	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	2.8e-25	34.2
WP_040082442.1\|2409477_2414235_-	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	1.8e-44	47.2
WP_021480099.1\|2414237_2414375_-	hypothetical protein	NA	NA	NA	NA
WP_024122156.1\|2414416_2414866_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.6e-11	38.2
WP_024122157.1\|2415011_2415191_+	type I toxin-antitoxin system toxin TxpA	NA	NA	NA	NA
WP_075058862.1\|2415570_2415660_+	type I toxin-antitoxin system toxin BsrH	NA	NA	NA	NA
WP_003229930.1\|2415952_2416396_-\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	3.2e-25	45.4
WP_040082441.1\|2416398_2417799_-\|portal	phage portal protein	S5MNC1	Brevibacillus_phage	6.9e-74	38.9
WP_082032961.1\|2417799_2417991_-	hypothetical protein	NA	NA	NA	NA
WP_040082440.1\|2417987_2418425_-	hypothetical protein	NA	NA	NA	NA
WP_040082439.1\|2418437_2418941_-	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	3.2e-37	46.3
WP_040082438.1\|2418937_2419300_-	YqbH/XkdH family protein	A0A249XXE9	Clostridium_phage	1.4e-10	39.3
WP_015714318.1\|2419296_2419692_-	DUF3199 family protein	NA	NA	NA	NA
WP_040082437.1\|2419696_2420008_-	hypothetical protein	NA	NA	NA	NA
WP_003229922.1\|2420018_2420954_-\|portal	phage portal protein	A0A1B1P7E3	Bacillus_phage	8.6e-105	65.0
WP_040082429.1\|2420972_2421944_-\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.4e-57	60.7
WP_040082428.1\|2422100_2423006_-	hypothetical protein	NA	NA	NA	NA
WP_040082427.1\|2423050_2423968_-	hypothetical protein	A0A1B1P7D7	Bacillus_phage	4.4e-53	39.4
WP_040082426.1\|2423964_2425497_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.2e-148	51.7
WP_082032960.1\|2425500_2426796_-\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.3e-154	63.2
WP_040082425.1\|2426788_2427508_-	hypothetical protein	A0A2P1JTW4	Anoxybacillus_phage	4.4e-56	55.9
WP_004398685.1\|2427575_2428040_-	hypothetical protein	NA	NA	NA	NA
WP_040082424.1\|2428183_2428639_-	hypothetical protein	A0A2H4J4R7	uncultured_Caudovirales_phage	1.0e-58	72.2
WP_040082422.1\|2428731_2429184_-	hypothetical protein	NA	NA	NA	NA
WP_040082421.1\|2429252_2429921_-	hypothetical protein	NA	NA	NA	NA
WP_040082420.1\|2430183_2430543_+	hypothetical protein	NA	NA	NA	NA
WP_040082419.1\|2430690_2430900_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	7.2e-20	70.1
WP_040082418.1\|2430981_2431410_-	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	1.3e-42	67.2
WP_080332533.1\|2431505_2431655_-	hypothetical protein	NA	NA	NA	NA
WP_082032959.1\|2431645_2432587_-	ATP-binding protein	A6XMI1	Bacillus_virus	1.2e-58	52.2
WP_156122886.1\|2432468_2433146_-	DnaD domain protein	A0A2H4J6G9	uncultured_Caudovirales_phage	1.9e-05	30.8
WP_040082413.1\|2433222_2434077_-	recombinase RecT	A0A2H4JCY8	uncultured_Caudovirales_phage	1.1e-111	82.7
WP_021480130.1\|2434079_2435039_-	YqaJ viral recombinase family protein	A0A2H4JA52	uncultured_Caudovirales_phage	8.8e-137	74.2
WP_021480131.1\|2435145_2435340_-	hypothetical protein	NA	NA	NA	NA
WP_156122885.1\|2435299_2435473_-	hypothetical protein	NA	NA	NA	NA
WP_021480132.1\|2435469_2435727_-	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	8.4e-10	42.2
WP_015714341.1\|2435723_2436293_-	helix-turn-helix transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	1.5e-64	61.0
WP_032725213.1\|2436366_2436507_-	hypothetical protein	NA	NA	NA	NA
WP_032722187.1\|2436509_2436749_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_021480133.1\|2436904_2437258_+	helix-turn-helix domain-containing protein	A0A0A7RTK4	Clostridium_phage	8.0e-11	48.6

DBSCAN-SWA_7

3223736 : 3231469

Organic_Lake_phycodnavirus(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040081801.1\|3223736_3224417_-\|holin	choline ABC transporter permease OpuBD	NA	NA	NA	NA
WP_040081800.1\|3224433_3225354_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_040081798.1\|3225365_3226019_-\|holin	choline ABC transporter permease OpuBB	NA	NA	NA	NA
WP_040081797.1\|3226033_3227179_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	2.7e-15	32.7
WP_040081796.1\|3227462_3227996_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_040081795.1\|3228027_3228702_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCD	NA	NA	NA	NA
WP_040081794.1\|3228719_3229637_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003228349.1\|3229650_3230304_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCB	NA	NA	NA	NA
WP_003243370.1\|3230326_3231469_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.2e-12	29.3

DBSCAN-SWA_8

3604337 : 3713669

111

Bacillus_phage(25.0%)

holin,protease,coat,lysis,tRNA,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014665762.1\|3604337_3606008_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_040081525.1\|3606004_3606433_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003222002.1\|3606744_3606876_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
WP_081483650.1\|3606832_3606985_+\|bacteriocin	bacteriocin biosynthesis protein	NA	NA	NA	NA
WP_014665764.1\|3607009_3608356_+	subtilosin maturase AlbA	NA	NA	NA	NA
WP_003222006.1\|3608368_3608530_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
WP_040081524.1\|3608526_3609246_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.6e-19	27.6
WP_040081523.1\|3609238_3610549_+	antibiotic biosynthesis protein AlbD	NA	NA	NA	NA
WP_082032965.1\|3610538_3611699_+	insulinase family protein	NA	NA	NA	NA
WP_040081521.1\|3611703_3612984_+	insulinase family protein	NA	NA	NA	NA
WP_040081520.1\|3612980_3613682_+	hypothetical protein	NA	NA	NA	NA
WP_040081519.1\|3613687_3615064_-	YncE family protein	NA	NA	NA	NA
WP_040081518.1\|3615103_3616453_-	YncE family protein	NA	NA	NA	NA
WP_040081517.1\|3616682_3617828_+	response regulator aspartate phosphatase RapF	A0A1P8CWN8	Bacillus_phage	2.8e-73	42.7
WP_003222023.1\|3617811_3617931_+	phosphatase RapF inhibitor PhrF	NA	NA	NA	NA
WP_040081516.1\|3618028_3618502_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_003227545.1\|3618533_3619406_-	agmatinase	NA	NA	NA	NA
WP_003227543.1\|3619466_3620297_-	spermidine synthase	NA	NA	NA	NA
WP_040081515.1\|3620498_3622574_+	penicillin-binding protein	NA	NA	NA	NA
WP_040081514.1\|3622601_3623024_-	hypothetical protein	NA	NA	NA	NA
WP_015714898.1\|3623162_3623681_-	hypothetical protein	NA	NA	NA	NA
WP_040081513.1\|3623694_3624354_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_040081512.1\|3624462_3624651_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_003242889.1\|3624693_3625113_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_040081511.1\|3625232_3627149_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.1e-141	42.5
WP_014665783.1\|3627998_3629399_-	MFS transporter	NA	NA	NA	NA
WP_040081510.1\|3629395_3629866_-	RrF2 family transcriptional regulator	NA	NA	NA	NA
WP_040081509.1\|3629977_3630478_-	YwgA family protein	NA	NA	NA	NA
WP_014665786.1\|3630513_3631815_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	5.5e-25	28.9
WP_003222050.1\|3631976_3632201_-	DUF1450 domain-containing protein	NA	NA	NA	NA
WP_040081508.1\|3632415_3633195_+	prespore-specific transcription regulator RsfA	NA	NA	NA	NA
WP_040081507.1\|3633339_3634230_-	DMT family transporter	NA	NA	NA	NA
WP_014665791.1\|3634397_3635243_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
WP_014665792.1\|3635290_3636190_-	cysJI operon transcriptional regulator CysL	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
WP_014665793.1\|3636335_3637307_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_003227507.1\|3637576_3638341_+	heme-dependent peroxidase	NA	NA	NA	NA
WP_014665795.1\|3638473_3639253_+	NADPH-dependent reductase BacG	NA	NA	NA	NA
WP_040081506.1\|3639268_3640468_-	transaminase BacF	NA	NA	NA	NA
WP_040081505.1\|3640468_3641653_-	bacilysin exporter BacE	NA	NA	NA	NA
WP_040081504.1\|3641649_3643068_-	alanine--anticapsin ligase	NA	NA	NA	NA
WP_040081503.1\|3643086_3643848_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	5.7e-22	30.9
WP_014665800.1\|3643850_3644558_-	3-((4R)-4-hydroxycyclohexa-1, 5-dien-1-yl)-2-oxopropanoate isomerase	NA	NA	NA	NA
WP_040081502.1\|3644547_3645162_-	prephenate decarboxylase	NA	NA	NA	NA
WP_040081501.1\|3645313_3646552_-	MFS transporter	NA	NA	NA	NA
WP_040081499.1\|3646759_3648172_-	amino acid permease	NA	NA	NA	NA
WP_040081498.1\|3648171_3649872_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_040081496.1\|3649945_3651493_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_014665807.1\|3651725_3653000_-	glutamate dehydrogenase	NA	NA	NA	NA
WP_040081494.1\|3653176_3653641_-	biofilm-surface layer protein BslB	NA	NA	NA	NA
WP_014665810.1\|3653964_3654420_-\|coat	spore coat protein	NA	NA	NA	NA
WP_040081492.1\|3654412_3655264_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.2e-38	38.8
WP_040081490.1\|3655277_3656225_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.7e-71	43.5
WP_014665812.1\|3656224_3656965_-	NTP transferase domain-containing protein	I7I009	Enterobacteria_phage	5.3e-49	42.3
WP_040081489.1\|3656989_3658009_-\|coat	spore coat protein	NA	NA	NA	NA
WP_040081487.1\|3658011_3658734_-\|coat	spore coat protein	NA	NA	NA	NA
WP_040081486.1\|3658726_3659848_-\|coat	spore coat protein	NA	NA	NA	NA
WP_040081484.1\|3659847_3660717_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014665817.1\|3660717_3661887_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	E5ES46	Bathycoccus_sp._RCC1105_virus	4.2e-16	28.9
WP_040081483.1\|3661907_3663332_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_040081481.1\|3663336_3664107_-\|coat	spore coat dTDP-glycosyltransferase SpsA	A0A0F7L2F7	uncultured_marine_virus	3.4e-06	28.6
WP_040081480.1\|3664426_3664963_+\|coat	spore coat protein GerQ	NA	NA	NA	NA
WP_040081478.1\|3665006_3665378_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_040081477.1\|3665439_3666762_-	purine permease	NA	NA	NA	NA
WP_040081475.1\|3666781_3667099_-	YwdI family protein	NA	NA	NA	NA
WP_040081473.1\|3667265_3668636_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_040081472.1\|3668660_3669338_-	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	2.4e-48	45.7
WP_040081471.1\|3669351_3670158_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_040082493.1\|3670240_3670774_-	hypothetical protein	NA	NA	NA	NA
WP_040081469.1\|3670821_3671457_-	hypothetical protein	NA	NA	NA	NA
WP_040081468.1\|3671449_3671788_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_014665830.1\|3671931_3672747_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_014665831.1\|3672836_3673085_-	hypothetical protein	NA	NA	NA	NA
WP_040081466.1\|3673178_3674618_-	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	6.3e-22	27.3
WP_040081465.1\|3674614_3676000_-	PTS system sucrose transporter subunit IIBC	NA	NA	NA	NA
WP_040081463.1\|3676300_3677071_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_040081462.1\|3677110_3677941_-	sac operon transcriptional antiterminator SacT	NA	NA	NA	NA
WP_003222155.1\|3677980_3678283_-	hypothetical protein	NA	NA	NA	NA
WP_040081460.1\|3678813_3681234_+\|protease	serine protease Vpr	A0A217EQY2	Bacillus_phage	6.9e-21	38.2
WP_040081459.1\|3681270_3682272_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_014665840.1\|3682446_3683196_-	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
WP_040081457.1\|3683302_3684487_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_040081455.1\|3684695_3685841_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003227411.1\|3686068_3686332_+	spore morphogenesis/germination protein YwcE	NA	NA	NA	NA
WP_014665842.1\|3686373_3686748_-	cytochrome aa3 quinol oxidase subunit IV	NA	NA	NA	NA
WP_003227409.1\|3686749_3687364_-	Quinol oxidase subunit 3	NA	NA	NA	NA
WP_014665843.1\|3687377_3689327_-	cytochrome aa3 quinol oxidase subunit I	NA	NA	NA	NA
WP_010886637.1\|3689354_3690320_-	cytochrome aa3 quinol oxidase subunit II	NA	NA	NA	NA
WP_040082491.1\|3690834_3691080_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_040081451.1\|3691150_3692692_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_040081450.1\|3692695_3693868_-	galactokinase	NA	NA	NA	NA
WP_014665847.1\|3693950_3694334_-	GtrA family protein	NA	NA	NA	NA
WP_014665848.1\|3694351_3695023_-	transcriptional regulator SlrC	NA	NA	NA	NA
WP_014665849.1\|3695377_3695536_+	transcriptional regulator SlrA	NA	NA	NA	NA
WP_040081448.1\|3695979_3696288_+	DUF485 domain-containing protein	NA	NA	NA	NA
WP_014665850.1\|3696284_3697826_+	cation acetate symporter	NA	NA	NA	NA
WP_040081446.1\|3697855_3698458_-	DsbA family protein	NA	NA	NA	NA
WP_014665852.1\|3698547_3699798_-	deferrochelatase/peroxidase EfeB	NA	NA	NA	NA
WP_040081444.1\|3699816_3700974_-	iron uptake system lipoprotein EfeM	NA	NA	NA	NA
WP_040081443.1\|3700970_3702416_-	ferrous ion permease EfeU	NA	NA	NA	NA
WP_040081441.1\|3702572_3703241_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_040081439.1\|3703237_3704056_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_040081438.1\|3704063_3704969_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003227375.1\|3705074_3705461_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_014665858.1\|3705442_3706120_+\|lysis	CidB/LrgB family autolysis modulator	NA	NA	NA	NA
WP_014665866.1\|3706220_3707423_+	MFS transporter	NA	NA	NA	NA
WP_040081435.1\|3707456_3707654_+	YwbE family protein	NA	NA	NA	NA
WP_040081433.1\|3707686_3708874_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	2.0e-74	42.7
WP_014665869.1\|3708994_3709375_+	glyoxalase GlxA	NA	NA	NA	NA
WP_040081431.1\|3709413_3710091_-	DUF2711 domain-containing protein	NA	NA	NA	NA
WP_040081429.1\|3710169_3711504_-	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
WP_040081428.1\|3711731_3713669_+\|protease	minor protease Epr	A0A1B0T6A2	Bacillus_phage	1.1e-45	35.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage