CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP021504	Lactiplantibacillus plantarum strain SRCM102022 plasmid pPL2022-3	0 crisprs	NA	0
NZ_CP021502	Lactiplantibacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	0 crisprs	csa3	1
NZ_CP021503	Lactiplantibacillus plantarum strain SRCM102022 plasmid pPL2022-2	0 crisprs	NA	0
NZ_CP021501	Lactiplantibacillus plantarum strain SRCM102022 chromosome, complete genome	1 crisprs	csa3,DinG,cas3,DEDDh,WYL	7

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8527 : 58059

Staphylococcus_phage(25.0%)

transposase,integrase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087613288.1\|8527_8890_-\|transposase	transposase	NA	NA	NA	NA
WP_027822617.1\|8916_9357_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010495033.1\|9493_9931_+	OsmC family protein	NA	NA	NA	NA
WP_111443464.1\|9948_10365_+	OsmC family protein	NA	NA	NA	NA
WP_027822898.1\|12134_12458_+	hypothetical protein	NA	NA	NA	NA
WP_087613289.1\|12530_12929_-	hypothetical protein	NA	NA	NA	NA
WP_027822896.1\|12921_13242_-	hypothetical protein	NA	NA	NA	NA
WP_027822895.1\|13234_14536_-	Y-family DNA polymerase	M1Q231	Streptococcus_phage	6.4e-82	40.0
WP_027822894.1\|14649_14961_+	hypothetical protein	NA	NA	NA	NA
WP_016526748.1\|15198_15468_-	hypothetical protein	NA	NA	NA	NA
WP_027822893.1\|15454_16357_-	AAA family ATPase	F0PIG8	Enterococcus_phage	4.1e-27	32.1
WP_027822892.1\|17216_18749_+	primase C-terminal domain-containing protein	NA	NA	NA	NA
WP_027822890.1\|19531_19810_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_087613290.1\|19909_20684_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_087613291.1\|20720_20957_+	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	NA	NA	NA	NA
WP_027822859.1\|21301_21601_-	hypothetical protein	NA	NA	NA	NA
WP_015063546.1\|21593_21872_-	DUF2089 family protein	NA	NA	NA	NA
WP_027822860.1\|22116_22881_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085844568.1\|23175_24105_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW47	unidentified_phage	2.3e-25	34.4
WP_157668939.1\|24969_25757_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_053339277.1\|26376_29181_+	cation-transporting P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	2.0e-72	27.6
WP_027822858.1\|29240_29513_+	hypothetical protein	NA	NA	NA	NA
WP_027822857.1\|29548_30016_+	hypothetical protein	NA	NA	NA	NA
WP_162838578.1\|30242_30395_-	hypothetical protein	NA	NA	NA	NA
WP_053339275.1\|30378_31548_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_001748276.1\|33200_33470_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001748275.1\|33456_33828_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_003586674.1\|34542_34821_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_157668939.1\|35705_36493_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_053339277.1\|37112_39917_+	cation-transporting P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	2.0e-72	27.6
WP_027822858.1\|39976_40249_+	hypothetical protein	NA	NA	NA	NA
WP_027822857.1\|40284_40752_+	hypothetical protein	NA	NA	NA	NA
WP_162838578.1\|40978_41131_-	hypothetical protein	NA	NA	NA	NA
WP_053339275.1\|41114_42284_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_001748276.1\|43936_44206_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001748275.1\|44192_44564_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_039098794.1\|44615_45203_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	4.9e-21	34.3
WP_003586674.1\|45279_45558_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_053339273.1\|46154_47330_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.1e-27	29.2
WP_053339272.1\|47789_48131_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_087613293.1\|48451_50776_+	DUF1906 domain-containing protein	NA	NA	NA	NA
WP_003587210.1\|51918_52386_+	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_027822873.1\|52632_53376_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-27	33.5
WP_027822874.1\|53353_54601_+	ABC transporter permease	NA	NA	NA	NA
WP_027822875.1\|54605_55277_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_027823042.1\|56033_56717_-\|transposase	IS6 family transposase	A0A0N9RU54	Staphylococcus_phage	1.6e-60	53.3
WP_015474708.1\|56856_57105_+	hypothetical protein	C1KFC0	Lactobacillus_virus	1.3e-36	95.1
WP_087613294.1\|57129_58059_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.8e-23	28.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP021501

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021501_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021501_1

1822363-1822664

Orphan

Consensus_repeat	Method
GCTTGGCTAAACGCATTGTCAGCTGTACTTTGAGCCTTAGCAGTAGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP021501_1

>merge|NZ_CP021501|1|1822363-1822664|CRISPRCasFinder
GCTTGGCTAAACGCATTGTCAGCTGTACTTTGAGCCTTAGCAGTAGCTGTAGAGTTGTTGCTTATCCCAGCACTAGCTTGGCTACCAACTGCCTGAGCTTGGCTAAACGCATTGTCAGCTGTACTTTGAGCCTTAGCAGTAGCATTAGACTGGACGGCTATTTCTGAATTGGCGTAGTTGTAATTGCTATCTGCGGCTGATTTAGCGGCATTCGCTGTAGACTGTGCAATTAAAGCAGCGCTATCAGCATTTCCTGCTTGGCTAGCCGCATTATCAGCCGTATTTTGAGCATTGATAATCTT

>NZ_CP021501|1|1|1822363-1822664|CRISPRCasFinder
GCTTGGCTAAACGCATTGTCAGCTGTACTTTGAGCCTTAGCAGTAGC	TGTAGAGTTGTTGCTTATCCCAGCACTAGCTTGGCTACCAACTGCCTGA
GCTTGGCTAAACGCATTGTCAGCTGTACTTTGAGCCTTAGCAGTAGC	ATTAGACTGGACGGCTATTTCTGAATTGGCGTAGTTGTAATTGCTATCTGCGGCTGATTTAGCGGCATTCGCTGTAGACTGTGCAATTAAAGCAGCGCTATCAGCATTTCCT
GCTTGGCTAGCCGCATTATCAGCCGTATTTTGAGCATTGATAATCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021501.1\|WP_016058330.1\|1834381_1834744_-\|phage-head-closure-protein	unknown	unknown	gnl\|CDD\|273692
NZ_CP021501.1\|WP_003645638.1\|1811273_1812065_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
NZ_CP021501.1\|WP_016058329.1\|1834727_1835066_-\|phage-gp6-like-head-tail-connector-protein	unknown	unknown	gnl\|CDD\|153446
NZ_CP021501.1\|WP_063722567.1\|1833951_1834392_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021501.1\|WP_087613191.1\|1810108_1811293_-\|LCP-family-protein	unknown	unknown	gnl\|CDD\|224235
NZ_CP021501.1\|WP_087613192.1\|1812083_1813754_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|227319
NZ_CP021501.1\|WP_063722569.1\|1832932_1833571_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|309671
NZ_CP021501.1\|WP_003644513.1\|1819534_1819696_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021501.1\|WP_064972060.1\|1816677_1817214_-\|holin	unknown	unknown	gnl\|CDD\|227833
NZ_CP021501.1\|WP_087613194.1\|1818676_1818955_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021501.1\|WP_072557579.1\|1835138_1836371_-\|phage-major-capsid-protein	unknown	unknown	gnl\|CDD\|273690
NZ_CP021501.1\|WP_087613193.1\|1817488_1818661_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|119377
NZ_CP021501.1\|WP_087613196.1\|1822728_1825098_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|273743
NZ_CP021501.1\|WP_016058335.1\|1832159_1832351_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021501.1\|WP_063722568.1\|1833571_1833955_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021501.1\|WP_003644510.1\|1817225_1817489_-\|hemolysin-XhlA-family-protein	unknown	unknown	gnl\|CDD\|371241
NZ_CP021501.1\|WP_063722577.1\|1814232_1815444_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	unknown	unknown	gnl\|CDD\|223843
NZ_CP021501.1\|WP_016058334.1\|1832347_1832731_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021501.1\|WP_079111803.1\|1825161_1826934_-\|phage-tail-family-protein	unknown	unknown	gnl\|CDD\|368574
NZ_CP021501.1\|WP_016058340.1\|1819699_1819954_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP021501.1\|WP_003645638.1\|1811273_1812065_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	1.25723e-96
NZ_CP021501.1\|WP_072557579.1\|1835138_1836371_-\|phage-major-capsid-protein	gnl\|CDD\|273690	TIGR01554, prophage_Lp3_protein_18, phage major capsid protein, HK97 family. This model family represents the major capsid protein component of the heads (capsids) of bacteriophage HK97, phi-105, P27, and related phage. This model represents one of several analogous families lacking detectable sequence similarity. The gene encoding this component is typically located in an operon encoding the small and large terminase subunits, the portal protein and the prohead or maturation protease. [Mobile and extrachromosomal element functions, Prophage functions].	1.30692e-62
NZ_CP021501.1\|WP_087613191.1\|1810108_1811293_-\|LCP-family-protein	gnl\|CDD\|224235	COG1316, LytR, Transcriptional regulator [Transcription].	9.92786e-43
NZ_CP021501.1\|WP_087613192.1\|1812083_1813754_-\|ABC-transporter-permease-subunit	gnl\|CDD\|227319	COG4986, COG4986, ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism].	1.06598e-83
NZ_CP021501.1\|WP_063722569.1\|1832932_1833571_-\|phage-tail-protein	gnl\|CDD\|309671	pfam04630, Phage_TTP_1, Phage tail tube protein. This is a family of phage tail tube proteins from Myoviridae.	2.75406e-69
NZ_CP021501.1\|WP_016058330.1\|1834381_1834744_-\|phage-head-closure-protein	gnl\|CDD\|273692	TIGR01563, hypothetical_protein_AGR_C_1752, phage head-tail adaptor, putative, SPP1 family. This family describes a small protein of about 100 amino acids found in bacteriophage and in bacterial prophage regions. Examples include gp9 of phage HK022 and gp16 of phage SPP1. This minor structural protein is suggested to be a head-tail adaptor protein (although the source of this annotation was not traced during construction of this model). [Mobile and extrachromosomal element functions, Prophage functions].	8.05503e-09
NZ_CP021501.1\|WP_064972060.1\|1816677_1817214_-\|holin	gnl\|CDD\|227833	COG5546, COG5546, Small integral membrane protein [Function unknown].	0.000923758
NZ_CP021501.1\|WP_087613193.1\|1817488_1818661_-\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|119377	cd06415, GH25_Cpl1-like, Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections. Cpl-1 belongs to the CP family of lysozymes (CPL lysozymes) which includes the Cpl-7 lysin. Cpl-1 has a glycosyl hydrolase family 25 (GH25) catalytic domain with an irregular (beta/alpha)5-beta3 barrel and a C-terminal cell wall-anchoring module formed by six similar choline-binding repeats (ChBr's). The ChBr's facilitate the anchoring of Cpl-1 to the choline-containing teichoic acid of the pneumococcal cell wall. Other members of this domain family have an N-terminal CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain similar to that of the firmicute CHAP lysins and associated with endopeptidase activity. The Cpl-7 lysin is also included here as is LysB of Lactococcus phage, and the Mur lysin of Lactobacillus phage.	1.51344e-63
NZ_CP021501.1\|WP_016058329.1\|1834727_1835066_-\|phage-gp6-like-head-tail-connector-protein	gnl\|CDD\|153446	cd08054, gp6, Head-Tail Connector Protein gp6 of Bacteriophage HK97 and similar proteins. The bacteriophage HK97 gp6 protein is critical in the assembly of the connector, a specialized structure that serves as an interface for head and tail attachment, as well as a point at which DNA exits the head during infection by the bacteriophage. It forms a dodecameric ring structure that comprises the middle ring of the connector, located between the portal protein (attached to the head) and the gp7 ring (attached to the tail). It is a component of the mature phage and the absence of HK97 gp6 results in defective head-tail joining and the absence of mature phage particles. Although the crystal structure of HK97 gp6 shows an unexpected 13-mer ring, the biological form present in the mature phage is believed to be a dodecamer.	1.24587e-20
NZ_CP021501.1\|WP_003644510.1\|1817225_1817489_-\|hemolysin-XhlA-family-protein	gnl\|CDD\|371241	pfam10779, XhlA, Haemolysin XhlA. XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes. This family has had DUF1267, pfam06895, merged into it.	4.53032e-09
NZ_CP021501.1\|WP_063722577.1\|1814232_1815444_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	gnl\|CDD\|223843	COG0772, FtsW, Bacterial cell division membrane protein [Cell division and chromosome partitioning].	1.43637e-74
NZ_CP021501.1\|WP_079111803.1\|1825161_1826934_-\|phage-tail-family-protein	gnl\|CDD\|368574	pfam05709, Sipho_tail, Phage tail protein. This family consists of several Siphovirus and other phage tail component proteins as well as some bacterial proteins of unknown function.	7.59108e-08
NZ_CP021501.1\|WP_087613196.1\|1822728_1825098_-\|phage-tail-protein	gnl\|CDD\|273743	TIGR01665, structural_protein, phage minor structural protein, N-terminal region. This model represents the conserved N-terminal region, typically from about residue 25 to about residue 350, of a family of uncharacterized phage proteins 500 to 1700 residues in length. [Mobile and extrachromosomal element functions, Prophage functions].	2.66219e-13

>NZ_CP021501.1|WP_016058340.1|1819699_1819954_-|hypothetical-protein
MDSILITNYKPDYTNNIMTISVQINTLGISSQVSITMDEFNTAIAGGAGGIDSVKLKVLNTLIDSLTALKPVTTTTTTTTTQEA
>NZ_CP021501.1|WP_003644513.1|1819534_1819696_-|hypothetical-protein
MNIDAQALINKMTSNYAQAIAVKDQQLAMAQVQIDQLNAKLAEKEAPKDGENA
>NZ_CP021501.1|WP_087613194.1|1818676_1818955_-|hypothetical-protein
MRTGNKLHVSGVVSPSADLAIGSATTLFNLPSSIGIIAENVAVVQQSSGWNLYCLSWNPNGAVSVLKHNIAGTATAITTTTQLQVCADILIK
>NZ_CP021501.1|WP_087613193.1|1817488_1818661_-|LysM-peptidoglycan-binding-domain-containing-protein
MNKHKLKALILTVGAIFMAFLMVNVTSQASTSRDQGPDWSKYNGNSGTFGYSSDKFVFSQAGGFYGGTNIPQTTYNSQVKSAQQAGKRVHTYLWDGVGGNMTNAKAMMAYYLPRVRTPKGSIVALDYEDGASNSVTANTNVILAQMKLIKDAGYTPMLYSGKAYLNYHVNVSLILKAYGSCLWVPEYPDYLVRTSPDYNYFPSMDGVAIFQFTSMYKAGGLDGNVDLTGITKLGYTTASKKQAQTNVKQAQAAKKANFKVVKYNQRGVFYPNRTLAVRYTDSDKVRQVATYYKGESVTYNAVIIEHDYVWARYTRSNGLYGFIKLGITNGQAYGKRVTGQPVSHTYYTVKSGDSWWTIAQRNGLSMTTLASQNAKSIYTTIYPGQRLVVR
>NZ_CP021501.1|WP_003644510.1|1817225_1817489_-|hemolysin-XhlA-family-protein
MAQYDDTTKLLMDIQKDVAATKTKVENIEEKLNQVDDIGDKADKALAKSIEASHQIDRVTTIQNWLIGVLVSGVLVTLVIYIAEKFL
>NZ_CP021501.1|WP_064972060.1|1816677_1817214_-|holin
MTKFLNVIQATLKANYKKPAYWAQIIGSVLIIGLAVATVFFGVKIDANAVVLVITAVGAILAFVGAITDNSILEDTGNTIKTKSNALASTEQTVVEALAEAQAKIEAANSAAASQAEAQASQAVVAAYSQAASAAAVGDTATASSAATLASSLAANLDSNAQPDAETASESTSQAGEK
>NZ_CP021501.1|WP_063722577.1|1814232_1815444_-|FtsW/RodA/SpoVE-family-cell-cycle-protein
MNNRELGRWQEHKHIGDYGWGIILCVIILCCIGMWAVYYACLHDLKVIDPVRTTMMQCLWYLVGALIATTMLHLSEKQLMQWAPIGYSIGMLLLILLLVFYSREYYVQTGAKSWFAIGTLTFQPVEVMKPLYILMMGRLIVQDQQWGPHNNFNADWRLTRRLVIYTFPIIVALKIINDFGTTLVFLTIFIGMLIVSPCRFSFLWRVLLVAGSIGVVLILLATSSTGQSLLSHIGFKLYQFDRINTWLNPSNGVSDQSYQLWQSMRAVGVGGLTGNGVTHNAVYVPVRESDMIFSVVGETTGFIGCSVLLIVYMYLFYLIFRSAFASRRRFYVYVFTGVAVMLAFHMFENIGMTIGLLPLTGIPLPFVSQGGSAIIGDFMGVGLVLATQYPNVRSIFSVPRIFH
>NZ_CP021501.1|WP_087613192.1|1812083_1813754_-|ABC-transporter-permease-subunit
MTSLKRGIKVRSVVGTMMWLGLSIGILLMIGWCIAKMNLPLSRLPTQGYLDTTGGKDYILFSLIFGILAARYRSARYVILPIVNLLESVPLLGFLTFTTAWFMGLFPNNVLGVEAVAIFGVFTAQAWNIMLALYQSLRVTPEDLMTVAKQFGCNSWQRFWRLEFLYATPSILWNIVISQSAAWFALVACEQATIVVPKNETLVLPGIGSYIQIALDTANFGAVINAVIALVICVLLVNVFIFQPLIKGTAHYKYGTSTDSQLPQQSQVYDLMVMAKVPLLVKRLHRHIRYWWLYGAPKQWQKLGFSRIIRILKKYTVYWRIAWWLVIAVGLYRLGVLLIKYLDWINLSVLFKWTFLTTSRVLIAVLLSALIFIPLAVWVASNARRLKLIQPVGQVLGSIPADIYIPIVALMITLTGTTQHWWVIPLIMTGTQWYFFFNIIAGYLAIPSDIKDVVNIFHLSGWRWWTHFLIPSLFPSFITAIINAAGAAWNADIAAELISWGTHQYAVTGLGAYIAQNINNKPAEATGVLIICVIVGLCVVLIWQPLYRFAERRFHY
>NZ_CP021501.1|WP_003645638.1|1811273_1812065_-|ABC-transporter-ATP-binding-protein
MKKAVLLDVDHVSKSFILSKQRQSELILEAVSLQVQTHQFISIIGSSGVGKSTLLRMIAGIIRPSYGAITFDGNLVTAPNRRMSMVFQNFALFPWLTVRQNIMFGLESQLNSDCQYVDNQIDNLINLIGLKGLKNAYPYELSGGMKQRVGFARALAVEPELLLLDEPFSALDVLTGQRLGQDLITLWERRKFKMQAIVLITHNISEAVRLSDVIYVLGGKPAQIMNTYQIKTPRNQRTEQQIWAKTMAITDQFKRDMNEMRGD
>NZ_CP021501.1|WP_087613191.1|1810108_1811293_-|LCP-family-protein
MKCGGTEFMRRRQLPKWQRKRLIVLVTSCITFMLVAFTIQGIRLFDMLHSFHESRVIKSHHNLTQQPVSTFLLMGLDNSGKRKLSTTRTDGMMVVIVNHKTKTMTLCSLLRDTFVKIHSQQYHGYQRIESAYTYGGDAAAIATVEHYLNLPIDYYLTVNWDGFIRAIDDIGPVEVNVDRDFIGQDYWGKPKKFKAGLQSMSGARALAYARERHIDNDQHRGFRQQAVFYAMVKRLNQEGLSSKGAKVVGDLKDQMRTNLTNHDMLTLFKSRKTFKRYRVKRLTFQWRTFDVAGRSMVEVYPDSRVQVSRQLQAAAGLRPDLPSQTFTTNGHYRYASDESVESKADEAKADTHYGQSHVYVGHAGNTTIGKLPAAVPLKNGFRVSDRTETMYTVH
>NZ_CP021501.1|WP_087613196.1|1822728_1825098_-|phage-tail-protein
MALNNQYLILDSNLKRIGTLTVDGATKFSNDSVKIQLADADTTSTSYDDDVNIGTQDNFNGTINLNAQSKKFDHQGSLDVLQGQPDSDKVVAGNNLAYYDALSGHWYVMRIYSVEESNTAATKHVTTANFTNLCLYTLAHHYPVAITASDSSIQTAFNQCFNATGWTLDYQTTNVMTPTITIDGKTKASTLVQTLIQAYNVEIDPYVEIDSQGNITKKVCVITDKLNTDVVYNEAVFGKNMTSIKRTTVSTPVTKLIAYGDNGNTMSEVNDGKPYIVDDAANQKYNPDWQSGLYYEAVITANSIEDPSGIKAWAEEMLQLYSHPRTYYEVSVTSKFNPPLGATIRFKDELIKPALDASGRVIQRTISFSNPYGNTVGFGEYVTVPVATPAWMQGYQSAINSAIEKAREDASSVKPVALTPDGNNFTDTAQTKRLILQAWEGNTNISAYIDNKGFIWHRYNTDGTLDTSFNQTGYLVQAAYNSVGTLHGTIETRYIQDEPEIKLQTSAIRSLGSFSPDDSTLGITDAAQYMCLLSNGQYITSRAINQSTTSDVMFVLHDTNFKPISKMIVSHGGHGSSFSIEEVDGAIYIWSATKPNLDVNEYAVSRIPYLANVTLGNDDDRIMRFCTVDRYIRVSVDFKHGYVLCGYVNGKHDVLRLDEVKQGNYDVLYSFDVANYGFDESKQTYQSQGIDFPYVYFHSGDYNMKDPRMVYAVNVVHGGQEFASNYLLDMNLGLTDDVIEPETCNIIYSQTNQPELLVTFNCKYQGDSLERVFVIPIKERLPMNTISND
>NZ_CP021501.1|WP_079111803.1|1825161_1826934_-|phage-tail-family-protein
MSVLNKNDFEYAGLNSRDDLQAIMGAVTLPSAPAMAEQATDIPGMYGNQFNGMDYTSRTISIPITIIARGSQDKYKQIMHNLSGLLLSDDPSDNGKEYPLVFGFEPKVTYWGHITAISDPQFINQGAWDATLTITFVQSDPRATLPQVETPLKNGLNTITVDGTARTEPVIQVIPKRDLKYIGFSLNGGQFGLGPESPGDQATAVQPYTKVVDDPLGTMAMWTNDANAISNMKTGETYTYQGHSEIKTATNVMRPAVTSAGYDFGTIPTTGEDRWYGPAYRYTGMTNSLTDWRVRTGIHQFKYSGTHNGRAMGRVEVLLLDPNGNTIGRFGMRDMAYGAKPMARLQICEPGSTLEYGDHYTDLYYGSGPAGSFTNKPDQKIQIKTGTTTKTVTKYGRSKSGKVTKKTVNETVDTYTTVVNKEEDSALAGAWLMLDITKRGQVFTWSITQYSTKTGQPFLDPNIHMLVHGTYVDTQNKYQTALGGIGSVFLKHPITEDNYKIAYRNPFMSMTDLQIWQVNKVDTTKPTYIAGAGEEIVMDCESDTVTVNGKLVSPVWSTDFPKLKPGVNGLSMIGDLDDAQMALKYLPRIL
>NZ_CP021501.1|WP_016058335.1|1832159_1832351_-|hypothetical-protein
MIWQLDNFIQDIDYIANQLISQGILPSDFYQSSFSEMQTALNAKSRKDRVQDPLELARQIGAL
>NZ_CP021501.1|WP_016058334.1|1832347_1832731_-|hypothetical-protein
MAKSVKFDGKKIGTGTQYTLIDSGQNVEKMAEAYKKFIKTTEETEDSITGVVELTPKLAKVVAETTCDLLELNASQKKRVMSMEFSVSDEYDFFNDCLKQFLGVELPSVGNSSDQEEEEDPKLPKPE
>NZ_CP021501.1|WP_063722569.1|1832932_1833571_-|phage-tail-protein
MATLGLNMLYTGIKADDGSTIIDADKGLSAAGVYPIDTSKANGNLGTKTANITGLSGTVSKITGNNEVVDVSNPPSAPSVAIDSNEINFIVKQKLLGRVSDGKGGYSDTDKPVEAGLIIESRSPIFRTAIYYCFGRGIFNEAGQNIQTNTDTAETRDDDNLTFTALNYDGFGGQPYKVYAESDPKFDKQAMFDAVFPGQTFYKNASNGTSGQ
>NZ_CP021501.1|WP_063722568.1|1833571_1833955_-|hypothetical-protein
MTPVAFIKSIIVTNINEIPELAVEHIHSFFIPINDTSTDEPIAVISGLPERSQDYGNGIPFQSTKQVQIQLYYPKDYLGDMDAIESGLKQVLLTNDIRCYSDAGQTLTPDSESITNTLKFNYIKEAI
>NZ_CP021501.1|WP_063722567.1|1833951_1834392_-|hypothetical-protein
MANEIKHADSFEHILDTMAEGFGREEKLKANAAGADQFIKIMKPKIPVGKLRKVHGHAEKAHLRDSLIAVDHPNGSVNVGFTAKGEKGYIARFQNDGWDVVDRNGSKHSHVSGKHFWETTQREAKGQVGKAVVEQLKTAMDKKVGK
>NZ_CP021501.1|WP_016058330.1|1834381_1834744_-|phage-head-closure-protein
MTKAINPTRMNFRLEFGTQAATGKVNPNTGNPITDFVPQFSLYAGEWSLSFQQRLALNGDTSQQNAVYFVRHNLKITTGMQLRRNHQDVYQIDDVAYDDGLPPDGFDLITCHKVVIGRGE
>NZ_CP021501.1|WP_016058329.1|1834727_1835066_-|phage-gp6-like-head-tail-connector-protein
MAADLKTLKSSLRIDGNDDDELLTGYLSAATSYIKQAIGDENGVTGFYEMEGVNDLFETAVYALAGSYWTYRTSITAIAVNPVDLVVDSIIGQLRGLYSQKQYEAGTNDESN
>NZ_CP021501.1|WP_072557579.1|1835138_1836371_-|phage-major-capsid-protein
MANINTMNDAWIAQGQKVSDLNDKLNAAVLDDSFDQEKFKAMKQDRDNAVARRDALHEQLEEERKAQEIANMDDKDKTRLDDDEEDIKAKFIKNFQGMIKGDPKVMNLVTSSTDEAGNAIGLTLPQDIQTAINTLVRQYDSLQQYVNREAVTTQTGSRVWEKWTDVTPLADLDDETATIGDNDDPRLSIIKYTIHRYSGITTATNSLLKDTADNILAWLSQWIAKKVVVTRNAKIIEAMNNAPKKPTLAKFDDIIDMINTAVDPAIKSTSFLLTNTSGCNELCKVKDAIGNYLLQPDPTQPDRMIVRGKRVVMIADKWLPNAGTAAAPVYPLYYGDLSQAVTLFDRENASLLTTNIGAGAFEKDQTKIRVIDRFDVEATDTEAFVAGSFSKIADQTANFAASAATTTDGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

332114 : 386352

Bacillus_virus(25.0%)

bacteriocin,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063722890.1\|332114_332678_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_011100974.1\|332871_333540_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_063722889.1\|333689_335195_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_013355173.1\|335459_335828_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|335940_336450_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003643764.1\|336480_337677_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003646440.1\|337786_338257_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|338275_338731_+	hypothetical protein	NA	NA	NA	NA
WP_063722888.1\|338834_339407_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003646441.1\|339572_340493_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_087613088.1\|340629_341529_+	oxidoreductase	NA	NA	NA	NA
WP_087613089.1\|341968_343849_+	hypothetical protein	NA	NA	NA	NA
WP_063722886.1\|344020_344467_-	hypothetical protein	NA	NA	NA	NA
WP_003641940.1\|344704_346231_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_015825109.1\|346231_347203_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_063722885.1\|347280_348612_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|349077_350595_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003643774.1\|350609_352439_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_087613090.1\|352453_353176_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	4.9e-31	31.9
WP_087613091.1\|353762_357458_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_003646448.1\|359358_359592_+	hypothetical protein	NA	NA	NA	NA
WP_108725669.1\|359972_360089_+	hypothetical protein	NA	NA	NA	NA
WP_087613092.1\|360212_361130_+	hypothetical protein	NA	NA	NA	NA
WP_016526893.1\|361136_361310_+	hypothetical protein	NA	NA	NA	NA
WP_063722881.1\|361854_362397_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_063722880.1\|362411_362675_+	hypothetical protein	NA	NA	NA	NA
WP_003643788.1\|362791_362995_+	hypothetical protein	NA	NA	NA	NA
WP_085844568.1\|363081_364011_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
WP_003643790.1\|364422_364809_+	hypothetical protein	NA	NA	NA	NA
WP_172821800.1\|365258_365426_+	hypothetical protein	NA	NA	NA	NA
WP_080469139.1\|365839_366085_+	hypothetical protein	NA	NA	NA	NA
WP_063722879.1\|366297_366531_+	hypothetical protein	NA	NA	NA	NA
WP_003643792.1\|366659_367079_+	hypothetical protein	NA	NA	NA	NA
WP_015379760.1\|368166_368784_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003641963.1\|368787_369942_-	MFS transporter	NA	NA	NA	NA
WP_011100993.1\|369945_370737_-	HAD family hydrolase	NA	NA	NA	NA
WP_003641965.1\|370807_371680_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_053566435.1\|371839_372655_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_087613093.1\|373180_374557_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_016511581.1\|374601_375786_+	cation:proton antiporter	NA	NA	NA	NA
WP_015825120.1\|376748_377417_-	hypothetical protein	NA	NA	NA	NA
WP_154766382.1\|377974_378148_+	hypothetical protein	NA	NA	NA	NA
WP_063722877.1\|378160_379501_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_015825122.1\|379501_380245_+	response regulator transcription factor	NA	NA	NA	NA
WP_063722876.1\|380538_381312_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|381410_381569_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|381593_381764_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_027821502.1\|382029_384180_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	3.6e-45	27.9
WP_027821501.1\|384196_385573_+	HlyD family secretion protein	NA	NA	NA	NA
WP_027821500.1\|385662_386352_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_2

544642 : 603106

Lactobacillus_phage(51.43%)

integrase,plate,portal,tail,tRNA,protease,capsid,terminase,head

attL 534824:534839|attR 598426:598441

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
534824:534839	attL	NA	NA	NA	NA
WP_003640924.1\|544642_545335_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003643927.1\|545524_546856_-	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	5.4e-68	33.3
WP_003640926.1\|546931_547615_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_063722744.1\|547623_547920_-	N-acetyltransferase	NA	NA	NA	NA
WP_063722745.1\|548058_548595_+	dUTP diphosphatase	J9PV85	Bacillus_phage	2.4e-35	45.3
WP_003643928.1\|549642_551022_+	DNA repair protein RadA	NA	NA	NA	NA
WP_003640931.1\|551037_552213_+	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_003640932.1\|552538_554029_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_063722273.1\|554306_555719_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	2.3e-45	30.0
WP_003640934.1\|555720_556131_+	Mini-ribonuclease 3	NA	NA	NA	NA
WP_003640935.1\|556102_556888_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_003640936.1\|556889_557435_+	NYN domain-containing protein	NA	NA	NA	NA
WP_003640938.1\|557941_558544_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_003637768.1\|558605_558755_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_003640939.1\|558766_558952_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003643932.1\|559056_559605_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_003640941.1\|559632_560520_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003640942.1\|560621_561047_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_003640943.1\|561147_561837_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_003643933.1\|562035_562539_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_003637775.1\|562600_562969_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_087613104.1\|563120_564323_-\|integrase	tyrosine-type recombinase/integrase	A0A126GGK4	Streptococcus_phage	1.2e-37	29.2
WP_022638129.1\|564605_564887_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_087613105.1\|564917_565277_-	hypothetical protein	NA	NA	NA	NA
WP_087613106.1\|565303_565681_-	large-conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_063489618.1\|566326_567046_-	hypothetical protein	NA	NA	NA	NA
WP_021356375.1\|567167_567503_-	hypothetical protein	A0A1B0Y4P2	Lactobacillus_phage	9.2e-25	52.2
WP_033608844.1\|567557_568118_-	DUF5067 domain-containing protein	Q6SEF8	Lactobacillus_prophage	4.6e-45	65.9
WP_087613107.1\|568167_569514_-	DUF4041 domain-containing protein	A0A1B0Y697	Lactobacillus_phage	4.6e-83	53.9
WP_033608843.1\|569539_569953_-	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	1.5e-05	32.1
WP_011101082.1\|569964_570327_-	helix-turn-helix domain-containing protein	A0A0U4KKM4	Exiguobacterium_phage	2.6e-09	32.0
WP_011101083.1\|570500_570731_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101084.1\|570803_571118_-	hypothetical protein	NA	NA	NA	NA
WP_011101085.1\|571155_571392_-	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-09	30.7
WP_011101086.1\|571538_571739_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101087.1\|571897_572080_+	hypothetical protein	NA	NA	NA	NA
WP_011101088.1\|572140_572695_+	hypothetical protein	O03909	Lactobacillus_phage	3.6e-98	100.0
WP_011101089.1\|572700_572985_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_063733331.1\|573305_573743_+	hypothetical protein	NA	NA	NA	NA
WP_061876077.1\|573739_574627_+	recombinase RecT	E9LUM3	Lactobacillus_phage	2.5e-61	47.0
WP_061876303.1\|574658_575411_+	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	6.3e-74	52.6
WP_087613108.1\|575492_576329_+	DUF4373 domain-containing protein	A0A1B1IM03	Lactococcus_phage	2.6e-07	33.3
WP_076640326.1\|576309_577152_+	ATP-binding protein	O03914	Lactobacillus_phage	5.9e-153	96.8
WP_061876080.1\|577308_577827_+	hypothetical protein	O03915	Lactobacillus_phage	1.2e-55	69.1
WP_061876081.1\|577823_578204_+	endodeoxyribonuclease	NA	NA	NA	NA
WP_022638754.1\|578196_578355_+	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	3.9e-18	92.3
WP_162838579.1\|578529_578706_+	hypothetical protein	E9LUP2	Lactobacillus_phage	1.3e-25	98.3
WP_087613109.1\|578698_579085_+	hypothetical protein	A0A2P0ZKS9	Lactobacillus_phage	3.9e-11	35.2
WP_061876083.1\|579081_579549_+	DUF1642 domain-containing protein	A0A2P0ZLB8	Lactobacillus_phage	3.3e-36	51.6
WP_087613110.1\|579545_579713_+	hypothetical protein	E9LUP4	Lactobacillus_phage	8.9e-13	87.0
WP_087613111.1\|579849_580299_+	hypothetical protein	B8R690	Lactobacillus_phage	1.8e-12	37.7
WP_087613112.1\|580579_581197_-	hypothetical protein	NA	NA	NA	NA
WP_087613113.1\|581532_582051_+	hypothetical protein	NA	NA	NA	NA
WP_087613114.1\|582135_582480_+	hypothetical protein	NA	NA	NA	NA
WP_087613115.1\|582541_582718_+	hypothetical protein	E9LUP6	Lactobacillus_phage	7.7e-07	59.6
WP_011101110.1\|582834_583431_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	5.8e-14	33.3
WP_061876085.1\|583414_584701_+\|terminase	PBSX family phage terminase large subunit	A0A2H4IYR5	uncultured_Caudovirales_phage	8.8e-116	50.6
WP_076633766.1\|584690_586349_+\|portal	phage portal protein	D2IZF6	Enterococcus_phage	1.3e-66	32.8
WP_011101113.1\|586348_587293_+\|capsid	minor capsid protein	NA	NA	NA	NA
WP_063722765.1\|587400_588048_+	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_063722766.1\|588061_589132_+	hypothetical protein	A0A0S0N2Q7	Pseudomonas_phage	2.0e-33	30.6
WP_063722767.1\|589146_589512_+\|head,tail	phage head-tail connector protein	H9A0V3	Staphylococcus_phage	1.0e-05	37.8
WP_063722768.1\|589516_589840_+	hypothetical protein	NA	NA	NA	NA
WP_063722769.1\|589829_590384_+	hypothetical protein	NA	NA	NA	NA
WP_011101119.1\|590384_590771_+	hypothetical protein	NA	NA	NA	NA
WP_011101120.1\|590782_591370_+\|tail	tail protein	NA	NA	NA	NA
WP_063722770.1\|591387_591900_+	hypothetical protein	NA	NA	NA	NA
WP_011101122.1\|591968_592205_+	hypothetical protein	NA	NA	NA	NA
WP_063722771.1\|592204_596209_+	tape measure protein	E9LUR1	Lactobacillus_phage	5.2e-82	44.3
WP_011101124.1\|596202_596940_+	hypothetical protein	A0A1S5SA63	Streptococcus_phage	4.1e-41	36.6
WP_062689890.1\|596939_598814_+\|tail	phage tail protein	A0A1X9IGI5	Lactococcus_phage	7.9e-49	33.2
598426:598441	attR	NA	NA	NA	NA
WP_011101126.1\|598818_599811_+	SGNH/GDSL hydrolase family protein	A0A1J0MFI8	Staphylococcus_phage	4.1e-36	41.0
WP_011101127.1\|599825_600440_+\|plate	phage baseplate upper protein	A0A1J0MFQ3	Staphylococcus_phage	7.3e-44	47.8
WP_011101128.1\|600445_601186_+	hypothetical protein	NA	NA	NA	NA
WP_011101129.1\|601186_601507_+	DUF2977 domain-containing protein	NA	NA	NA	NA
WP_071540930.1\|601506_601683_+	XkdX family protein	NA	NA	NA	NA
WP_187337727.1\|601708_602809_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	1.4e-45	60.4
WP_011101132.1\|602809_603106_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	4.4e-39	76.5

DBSCAN-SWA_3

617348 : 625972

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643940.1\|617348_619046_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640956.1\|619067_619376_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|619391_619991_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|620005_620257_+	YaaL family protein	NA	NA	NA	NA
WP_011101140.1\|620654_621320_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640965.1\|621316_621646_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_087613116.1\|621662_622682_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	4.3e-33	33.9
WP_003640967.1\|622706_623054_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003643942.1\|623152_624049_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	9.9e-82	55.7
WP_003640969.1\|624052_624838_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_063722777.1\|624976_625972_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.2e-50	37.9

DBSCAN-SWA_4

1269280 : 1279126

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087613155.1\|1269280_1270519_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	1.2e-215	96.9
WP_015825455.1\|1270609_1271581_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.8e-182	99.4
WP_003643099.1\|1271766_1272714_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_063723106.1\|1273056_1273671_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.4e-111	99.5
WP_063723107.1\|1273673_1276112_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.5
WP_003643095.1\|1276199_1276760_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_011101401.1\|1276830_1277271_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	3.0e-76	98.6
WP_015380221.1\|1277366_1277504_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003645220.1\|1278130_1279126_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8

DBSCAN-SWA_5

1771708 : 1858119

Lactobacillus_phage(80.39%)

integrase,portal,holin,tail,tRNA,protease,capsid,terminase,head

attL 1797292:1797309|attR 1865053:1865070

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072533795.1\|1771708_1772632_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003645967.1\|1773116_1773638_-	shikimate kinase	NA	NA	NA	NA
WP_015825650.1\|1773640_1774738_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_063722587.1\|1774740_1776039_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_003645964.1\|1776052_1776580_-	amino acid biosynthesis protein	NA	NA	NA	NA
WP_063722586.1\|1776588_1777758_-	chorismate synthase	NA	NA	NA	NA
WP_003640723.1\|1779855_1780209_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_003645962.1\|1780231_1782808_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640725.1\|1782822_1783128_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003640726.1\|1783117_1783417_-	YlxR family protein	NA	NA	NA	NA
WP_003640727.1\|1783461_1784679_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640728.1\|1784699_1785176_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640729.1\|1785471_1789785_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_063722585.1\|1790278_1791988_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640733.1\|1792027_1793305_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_087613189.1\|1793342_1794128_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_063722583.1\|1794143_1794923_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	9.0e-23	46.3
WP_003640736.1\|1795042_1795606_-	ribosome recycling factor	NA	NA	NA	NA
WP_003640737.1\|1795607_1796330_-	UMP kinase	NA	NA	NA	NA
WP_003644498.1\|1796529_1797408_-	elongation factor Ts	NA	NA	NA	NA
1797292:1797309	attL	NA	NA	NA	NA
WP_003640739.1\|1797510_1798314_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|1798538_1799261_+	HAD family hydrolase	NA	NA	NA	NA
WP_003640741.1\|1799549_1800548_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_053267827.1\|1800632_1800938_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_063722581.1\|1800921_1801680_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003645630.1\|1801791_1802427_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640745.1\|1802483_1802720_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|1802817_1803057_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640747.1\|1803208_1803841_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_089178220.1\|1803930_1804161_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_087613190.1\|1804464_1805094_+	hypothetical protein	NA	NA	NA	NA
WP_063722580.1\|1805143_1806313_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003645633.1\|1806348_1806741_-	hypothetical protein	NA	NA	NA	NA
WP_015640487.1\|1806904_1807297_+	hypothetical protein	NA	NA	NA	NA
WP_063722579.1\|1807743_1808685_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	4.1e-78	48.7
WP_063722578.1\|1809384_1809957_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_087613191.1\|1810108_1811293_-	LCP family protein	NA	NA	NA	NA
WP_003645638.1\|1811273_1812065_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
WP_087613192.1\|1812083_1813754_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_063722577.1\|1814232_1815444_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_064972060.1\|1816677_1817214_-\|holin	holin	E9LUS0	Lactobacillus_phage	8.0e-39	95.7
WP_003644510.1\|1817225_1817489_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_087613193.1\|1817488_1818661_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	3.5e-212	94.6
WP_087613194.1\|1818676_1818955_-	hypothetical protein	E9LUR7	Lactobacillus_phage	2.8e-43	97.8
WP_003644513.1\|1819534_1819696_-	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	9.5e-20	100.0
WP_016058340.1\|1819699_1819954_-	hypothetical protein	E9LUR5	Lactobacillus_phage	1.4e-30	100.0
WP_087613195.1\|1819946_1822712_-	hypothetical protein	A0A2P0ZL34	Lactobacillus_phage	1.8e-195	50.4
WP_087613196.1\|1822728_1825098_-\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	94.7
WP_079111803.1\|1825161_1826934_-\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	97.3
WP_016058335.1\|1832159_1832351_-	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
WP_016058334.1\|1832347_1832731_-	hypothetical protein	E9LUQ9	Lactobacillus_phage	3.9e-64	100.0
WP_063722569.1\|1832932_1833571_-\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	1.1e-116	99.5
WP_063722568.1\|1833571_1833955_-	hypothetical protein	E9LUQ7	Lactobacillus_phage	9.4e-66	98.4
WP_063722567.1\|1833951_1834392_-	hypothetical protein	E9LUQ6	Lactobacillus_phage	5.0e-79	99.3
WP_016058330.1\|1834381_1834744_-\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	5.2e-66	100.0
WP_016058329.1\|1834727_1835066_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	7.0e-57	100.0
WP_072557579.1\|1835138_1836371_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	4.2e-200	87.7
WP_063487073.1\|1836370_1837129_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	5.5e-126	94.0
WP_063487072.1\|1837106_1838303_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	2.2e-206	90.2
WP_063487071.1\|1838305_1838500_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	3.8e-23	89.1
WP_072557583.1\|1838489_1840397_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	2.0e-180	49.8
WP_087613197.1\|1840383_1840845_-\|terminase	phage terminase small subunit P27 family	A0A286QRF4	Streptococcus_phage	2.5e-44	57.5
WP_063487069.1\|1841035_1841287_-	hypothetical protein	NA	NA	NA	NA
WP_064972047.1\|1841304_1841568_-	hypothetical protein	NA	NA	NA	NA
WP_080475182.1\|1841573_1842044_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	1.6e-83	93.6
WP_157668937.1\|1842054_1842234_-	hypothetical protein	E9LUP6	Lactobacillus_phage	1.1e-13	71.2
WP_015380624.1\|1842211_1842409_-	hypothetical protein	NA	NA	NA	NA
WP_003644538.1\|1843384_1843810_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	3.3e-59	77.3
WP_063487065.1\|1844094_1844424_-	hypothetical protein	NA	NA	NA	NA
WP_127064439.1\|1844599_1844758_-	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	3.3e-17	88.5
WP_063487884.1\|1844750_1844945_-	hypothetical protein	A0A2P0ZLB7	Lactobacillus_phage	9.1e-17	72.4
WP_063487063.1\|1844948_1845260_-	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	5.0e-49	91.3
WP_064972043.1\|1845262_1845565_-	hypothetical protein	E9LUN7	Lactobacillus_phage	6.1e-44	91.0
WP_064972042.1\|1845700_1846486_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	1.1e-132	91.6
WP_069302493.1\|1846485_1847229_-	replisome organizer	E9LUM6	Lactobacillus_phage	2.7e-40	57.3
WP_064972039.1\|1847490_1848183_-	hypothetical protein	E9LUU3	Lactobacillus_phage	4.9e-129	97.8
WP_064972038.1\|1848229_1848889_-	DUF669 domain-containing protein	O03912	Lactobacillus_phage	5.7e-95	80.4
WP_016058363.1\|1848890_1849553_-	AAA family ATPase	E9LUU1	Lactobacillus_phage	4.2e-122	100.0
WP_127064441.1\|1849561_1850092_-	host-nuclease inhibitor Gam family protein	E9LUU0	Lactobacillus_phage	3.6e-92	99.4
WP_016058361.1\|1850094_1850241_-	hypothetical protein	E9LUT9	Lactobacillus_phage	4.3e-19	100.0
WP_064972037.1\|1850289_1850514_-	hypothetical protein	E9LUT8	Lactobacillus_phage	8.3e-30	86.5
WP_015380498.1\|1850525_1850726_-	hypothetical protein	E9LUT7	Lactobacillus_phage	1.7e-26	89.4
WP_015380499.1\|1850728_1850977_-	hypothetical protein	E9LUT6	Lactobacillus_phage	1.9e-35	84.1
WP_064972036.1\|1851118_1851379_-	hypothetical protein	NA	NA	NA	NA
WP_015380501.1\|1851436_1851763_+	hypothetical protein	E9LUT2	Lactobacillus_phage	2.7e-53	98.1
WP_064972035.1\|1851878_1852088_-	hypothetical protein	NA	NA	NA	NA
WP_063487054.1\|1852099_1852807_-	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	2.8e-63	58.6
WP_063485655.1\|1852822_1853071_-	helix-turn-helix transcriptional regulator	A0A0P0IX93	Lactobacillus_phage	4.0e-17	61.4
WP_064972034.1\|1853238_1853913_+	LexA family transcriptional regulator	D7RWL5	Brochothrix_phage	2.7e-52	45.1
WP_064972033.1\|1854042_1854918_+	hypothetical protein	NA	NA	NA	NA
WP_064972032.1\|1856100_1856739_-	hypothetical protein	NA	NA	NA	NA
WP_053338955.1\|1856955_1858119_+\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	1.2e-55	36.5
1865053:1865070	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2145102 : 2195636

Lactobacillus_phage(63.64%)

integrase,portal,holin,tail,capsid,terminase,transposase

attL 2153387:2153407|attR 2195857:2195877

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087613215.1\|2145102_2146791_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.1e-92	41.3
WP_053267751.1\|2146903_2147875_-	hypothetical protein	NA	NA	NA	NA
WP_003641422.1\|2147889_2149779_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.4e-58	32.1
WP_063723213.1\|2149778_2151509_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-46	27.6
WP_003641420.1\|2151736_2152129_-	YxeA family protein	NA	NA	NA	NA
WP_063723214.1\|2152351_2153203_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
2153387:2153407	attL	NA	NA	NA	NA
WP_064972021.1\|2154303_2154681_-\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	1.1e-18	70.0
WP_060418016.1\|2154667_2154964_-	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	2.0e-39	77.6
WP_064972148.1\|2154964_2156080_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	3.0e-43	57.8
WP_064972020.1\|2156142_2156640_-	hypothetical protein	A0A2P0ZL78	Lactobacillus_phage	5.8e-15	35.4
WP_064972018.1\|2157767_2157995_-	hypothetical protein	NA	NA	NA	NA
WP_087613216.1\|2158041_2160687_-	hypothetical protein	A0A2K9VCP8	Lactobacillus_phage	2.1e-135	45.9
WP_064972017.1\|2160687_2160978_-	hypothetical protein	NA	NA	NA	NA
WP_064972016.1\|2160974_2161196_-	hypothetical protein	NA	NA	NA	NA
WP_064972015.1\|2161188_2162316_-\|tail	phage tail protein	O03938	Lactobacillus_phage	1.2e-71	41.9
WP_064972014.1\|2162327_2163146_-\|tail	phage tail family protein	NA	NA	NA	NA
WP_087613217.1\|2163146_2168777_-\|tail	phage tail tape measure protein	U5U708	Lactobacillus_phage	8.0e-113	59.0
WP_064972012.1\|2168792_2169434_-	hypothetical protein	U3PFU8	Lactobacillus_phage	1.1e-07	28.1
WP_064972011.1\|2169430_2169949_-	hypothetical protein	NA	NA	NA	NA
WP_064972010.1\|2170067_2170676_-	hypothetical protein	NA	NA	NA	NA
WP_063722337.1\|2170693_2171119_-	hypothetical protein	NA	NA	NA	NA
WP_046947889.1\|2171118_2171520_-	hypothetical protein	NA	NA	NA	NA
WP_064972009.1\|2171516_2171906_-	hypothetical protein	NA	NA	NA	NA
WP_064972008.1\|2171906_2172311_-	hypothetical protein	A5GYM1	Lactococcus_phage	5.7e-05	27.5
WP_064972007.1\|2172321_2172582_-	hypothetical protein	NA	NA	NA	NA
WP_064972006.1\|2172670_2173618_-\|capsid	N4-gp56 family major capsid protein	A8ASJ6	Listeria_phage	3.9e-89	59.5
WP_064972005.1\|2173631_2174234_-	hypothetical protein	NA	NA	NA	NA
WP_064972004.1\|2174297_2175383_-	hypothetical protein	A0A059T7W2	Listeria_phage	6.2e-38	31.4
WP_155123380.1\|2175375_2176971_-\|portal	phage portal protein	B5LPR1	Bacillus_virus	7.6e-85	37.5
WP_064522746.1\|2176973_2178299_-\|terminase	PBSX family phage terminase large subunit	A0A1S5SA45	Streptococcus_phage	4.5e-139	55.7
WP_063486483.1\|2178279_2178789_-	helix-turn-helix domain-containing protein	A0A2H4IYT3	uncultured_Caudovirales_phage	4.5e-07	36.8
WP_063723236.1\|2178828_2179092_-	hypothetical protein	A0A1S5RCN3	Lactobacillus_phage	1.1e-28	68.6
WP_080469165.1\|2179078_2179246_-	hypothetical protein	E9LUP6	Lactobacillus_phage	7.3e-07	57.4
WP_063964074.1\|2179292_2180138_-	hypothetical protein	NA	NA	NA	NA
WP_003642805.1\|2180859_2181321_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_076640085.1\|2181448_2181661_-	hypothetical protein	E9LUP4	Lactobacillus_phage	2.1e-11	86.0
WP_052048925.1\|2181653_2181878_-	helix-turn-helix transcriptional regulator	D2IZX1	Enterococcus_phage	1.4e-05	37.5
WP_064505709.1\|2182002_2182167_+	YjzC family protein	A0A0A7RTS6	Clostridium_phage	3.0e-13	66.0
WP_033611989.1\|2182433_2182817_-	endodeoxyribonuclease	NA	NA	NA	NA
WP_087613218.1\|2182813_2183332_-	hypothetical protein	O03915	Lactobacillus_phage	2.8e-44	59.9
WP_064972000.1\|2183328_2183616_-	hypothetical protein	NA	NA	NA	NA
WP_064971999.1\|2183612_2184521_-	DnaD domain protein	NA	NA	NA	NA
WP_172821809.1\|2184601_2185354_-	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	4.7e-69	49.8
WP_064971998.1\|2185385_2186285_-	recombinase RecT	E9LUM3	Lactobacillus_phage	9.3e-64	53.3
WP_080475178.1\|2186281_2186668_-	hypothetical protein	NA	NA	NA	NA
WP_064971996.1\|2187038_2187551_-	transcriptional regulator	D6PST4	Lactobacillus_phage	1.2e-28	44.7
WP_064971995.1\|2187617_2187923_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_003642792.1\|2187934_2188105_-	hypothetical protein	NA	NA	NA	NA
WP_064971994.1\|2188183_2188465_+	hypothetical protein	NA	NA	NA	NA
WP_060417532.1\|2188621_2188876_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_064971993.1\|2189022_2189526_+	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	3.8e-22	41.4
WP_064971992.1\|2189540_2189963_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_157668938.1\|2190063_2190987_+	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_087613285.1\|2191171_2191870_+	hypothetical protein	NA	NA	NA	NA
WP_063486624.1\|2192348_2192684_+	hypothetical protein	A0A1B0Y4P2	Lactobacillus_phage	4.1e-25	52.2
WP_003642778.1\|2192960_2193137_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.6e-10	51.7
WP_063722926.1\|2193321_2193543_-	hypothetical protein	U5U783	Lactobacillus_phage	1.1e-05	41.5
WP_063722927.1\|2193559_2194354_+	hypothetical protein	U5U717	Lactobacillus_phage	1.6e-11	27.5
WP_063722928.1\|2194514_2195636_+\|integrase	tyrosine-type recombinase/integrase	D6PSS4	Lactobacillus_phage	2.9e-46	32.1
2195857:2195877	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2388869 : 2397380

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087613228.1\|2388869_2389448_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_003645866.1\|2389440_2390466_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-59	41.0
WP_087613229.1\|2390462_2391917_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.5e-50	34.0
WP_087613230.1\|2391901_2394121_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	7.7e-144	39.1
WP_011101895.1\|2394113_2394794_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2394793_2395048_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_021356104.1\|2395049_2395781_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	2.1e-37	37.3
WP_024521791.1\|2395783_2396914_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2396897_2397380_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021502

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP021501

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection