CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP021360	Acidovorax carolinensis strain NA2 plasmid pACNA2.1, complete sequence	0 crisprs	NA	0	0	1	0
NZ_CP021359	Acidovorax carolinensis strain NA2 chromosome, complete genome	1 crisprs	DEDDh,DinG,csa3,Cas9_archaeal	0	2	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

166 : 28083

Burkholderia_phage(33.33%)

integrase,transposase

attL 14438:14452|attR 29123:29137

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086914301.1\|166_823_+\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA
WP_086914268.1\|800_2750_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_086914269.1\|2749_3646_+	AAA family ATPase	NA	NA	NA	NA
WP_157896629.1\|3632_4586_+	hypothetical protein	NA	NA	NA	NA
WP_086928897.1\|5197_6181_+	hypothetical protein	NA	NA	NA	NA
WP_157896630.1\|6184_7831_-	hypothetical protein	NA	NA	NA	NA
WP_157896774.1\|8551_9286_-	hypothetical protein	NA	NA	NA	NA
WP_063462293.1\|9401_10487_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_086914275.1\|11536_11905_+	hypothetical protein	NA	NA	NA	NA
WP_086914276.1\|12555_12792_+	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_086914277.1\|12834_13296_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_056057356.1\|13444_13756_-	HU family DNA-binding protein	Q6QIE5	Burkholderia_phage	4.4e-13	44.9
WP_086914278.1\|13826_14642_-	DNA/RNA non-specific endonuclease	H6X497	Enterobacteria_phage	3.7e-19	33.7
14438:14452	attL	NA	NA	NA	NA
WP_008903080.1\|15469_15913_+\|transposase	transposase	NA	NA	NA	NA
WP_008903079.1\|15888_16239_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_082759088.1\|16340_17936_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	4.5e-77	36.9
WP_034692674.1\|17969_18683_-	UPF0149 family protein	NA	NA	NA	NA
WP_086914279.1\|19529_19799_-	flagellar biosynthesis protein FliQ	NA	NA	NA	NA
WP_086914280.1\|19879_21127_-	TolC family protein	NA	NA	NA	NA
WP_086914281.1\|21123_21426_-	DUF3240 family protein	NA	NA	NA	NA
WP_086914282.1\|21418_24523_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.5e-79	24.3
WP_086914283.1\|24524_25658_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_157896632.1\|25813_26032_+	hypothetical protein	NA	NA	NA	NA
WP_086914285.1\|26370_27345_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.6e-80	49.4
WP_024814084.1\|27459_28083_-\|integrase	tyrosine-type recombinase/integrase	A0A1S5SFD7	Streptococcus_phage	1.3e-11	31.0
29123:29137	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP021359

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021359_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021359_1

3588907-3589055

Orphan

I-F

Consensus_repeat	Method
GTCCACTGCCGCATAGGCAGCTCAGAAAT	PILER-CR
GTCCACTGCCGCATAGGCAGCTCAGAAA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP021359_1

>merge|NZ_CP021359|1|3588907-3589055|PILER-CR,CRISPRCasFinder
GTCCACTGCCGCATAGGCAGCTCAGAAATACGACTCGGGGTGTGGGCGATCCGAGAGGAGGTCCACTGCCGCATAGGCAGCTCAGAAATTGATGGGCTCCAGCTCCTGGCGCAAGGCGGTGTCCACTGCCGCATAGGCAGCTCTGAAAG

>NZ_CP021359|1|1|3588907-3589055|PILER-CR
GTCCACTGCCGCATAGGCAGCTCAGAAAT	ACGACTCGGGGTGTGGGCGATCCGAGAGGAG
GTCCACTGCCGCATAGGCAGCTCAGAAAT	TGATGGGCTCCAGCTCCTGGCGCAAGGCGGT
GTCCACTGCCGCATAGGCAGCTCTGAAAG

>NZ_CP021359|1|1|3588907-3589054|CRISPRCasFinder
GTCCACTGCCGCATAGGCAGCTCAGAAA	TACGACTCGGGGTGTGGGCGATCCGAGAGGAG
GTCCACTGCCGCATAGGCAGCTCAGAAA	TTGATGGGCTCCAGCTCCTGGCGCAAGGCGGT
GTCCACTGCCGCATAGGCAGCTCTGAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021359.1\|WP_086914224.1\|3578921_3579203_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223439
NZ_CP021359.1\|WP_086913540.1\|3585488_3586394_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176168
NZ_CP021359.1\|WP_005793651.1\|3592432_3592546_-\|50S-ribosomal-protein-L36	unknown	unknown	gnl\|CDD\|179039
NZ_CP021359.1\|WP_005793666.1\|3589803_3590796_-\|DNA-directed-RNA-polymerase-subunit-alpha	unknown	unknown	gnl\|CDD\|235359
NZ_CP021359.1\|WP_086913536.1\|3581333_3582011_-\|3-isopropylmalate-dehydratase-small-subunit	unknown	unknown	gnl\|CDD\|179314
NZ_CP021359.1\|WP_007861725.1\|3594478_3594661_-\|50S-ribosomal-protein-L30	unknown	unknown	gnl\|CDD\|180163
NZ_CP021359.1\|WP_086913539.1\|3584378_3585365_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP021359.1\|WP_086913538.1\|3583437_3584343_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP021359.1\|WP_086913545.1\|3594036_3594468_-\|50S-ribosomal-protein-L15	unknown	unknown	gnl\|CDD\|235523
NZ_CP021359.1\|WP_086913544.1\|3592692_3594012_-\|preprotein-translocase-subunit-SecY	unknown	unknown	gnl\|CDD\|236412
NZ_CP021359.1\|WP_086913541.1\|3586678_3587002_-\|HigA-family-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|274228
NZ_CP021359.1\|WP_005793662.1\|3591620_3592025_-\|30S-ribosomal-protein-S11	unknown	unknown	gnl\|CDD\|180007
NZ_CP021359.1\|WP_005793659.1\|3592043_3592409_-\|30S-ribosomal-protein-S13	unknown	unknown	gnl\|CDD\|235358
NZ_CP021359.1\|WP_086913542.1\|3587010_3587298_-\|peptidase	unknown	unknown	gnl\|CDD\|282822
NZ_CP021359.1\|WP_086913543.1\|3589321_3589714_-\|50S-ribosomal-protein-L17	unknown	unknown	gnl\|CDD\|235522
NZ_CP021359.1\|WP_086913535.1\|3580249_3580849_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379128
NZ_CP021359.1\|WP_024813863.1\|3590906_3591530_-\|30S-ribosomal-protein-S4	unknown	unknown	gnl\|CDD\|235411
NZ_CP021359.1\|WP_086913534.1\|3579350_3580253_-\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	unknown	unknown	gnl\|CDD\|378065
NZ_CP021359.1\|WP_086913537.1\|3582007_3583441_-\|3-isopropylmalate-dehydratase-large-subunit	unknown	unknown	gnl\|CDD\|183543
NZ_CP021359.1\|WP_086913546.1\|3594675_3595194_-\|30S-ribosomal-protein-S5	unknown	unknown	gnl\|CDD\|234790

Protein	Function_ID	Function_description	E-value
NZ_CP021359.1\|WP_086914224.1\|3578921_3579203_+\|hypothetical-protein	gnl\|CDD\|223439	COG0362, Gnd, 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism].	0.00319484
NZ_CP021359.1\|WP_086913540.1\|3585488_3586394_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176168	cd08479, PBP2_CrgA_like_9, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 9. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.72296e-105
NZ_CP021359.1\|WP_005793651.1\|3592432_3592546_-\|50S-ribosomal-protein-L36	gnl\|CDD\|179039	PRK00465, rpmJ, 50S ribosomal protein L36; Reviewed.	3.03948e-11
NZ_CP021359.1\|WP_005793666.1\|3589803_3590796_-\|DNA-directed-RNA-polymerase-subunit-alpha	gnl\|CDD\|235359	PRK05182, PRK05182, DNA-directed RNA polymerase subunit alpha; Provisional.	0
NZ_CP021359.1\|WP_086913536.1\|3581333_3582011_-\|3-isopropylmalate-dehydratase-small-subunit	gnl\|CDD\|179314	PRK01641, leuD, 3-isopropylmalate dehydratase small subunit.	2.86808e-82
NZ_CP021359.1\|WP_007861725.1\|3594478_3594661_-\|50S-ribosomal-protein-L30	gnl\|CDD\|180163	PRK05611, rpmD, 50S ribosomal protein L30; Reviewed.	1.59254e-26
NZ_CP021359.1\|WP_086913539.1\|3584378_3585365_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	4.28698e-147
NZ_CP021359.1\|WP_086913538.1\|3583437_3584343_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.01366e-25
NZ_CP021359.1\|WP_086913545.1\|3594036_3594468_-\|50S-ribosomal-protein-L15	gnl\|CDD\|235523	PRK05592, rplO, 50S ribosomal protein L15; Reviewed.	2.84349e-66
NZ_CP021359.1\|WP_086913544.1\|3592692_3594012_-\|preprotein-translocase-subunit-SecY	gnl\|CDD\|236412	PRK09204, secY, preprotein translocase subunit SecY; Reviewed.	0
NZ_CP021359.1\|WP_086913541.1\|3586678_3587002_-\|HigA-family-addiction-module-antidote-protein	gnl\|CDD\|274228	TIGR02607, Virulence-associated_protein_I, addiction module antidote protein, HigA family. Members of this family form a distinct clade within the larger family HTH_3 of helix-turn-helix proteins, described by pfam01381. Members of this clade are strictly bacterial and nearly always shorter than 110 amino acids. This family includes the characterized member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is uncoded by the upstream member of the gene pair. [Regulatory functions, DNA interactions, Regulatory functions, Protein interactions, Mobile and extrachromosomal element functions, Other].	1.22154e-30
NZ_CP021359.1\|WP_005793662.1\|3591620_3592025_-\|30S-ribosomal-protein-S11	gnl\|CDD\|180007	PRK05309, PRK05309, 30S ribosomal protein S11; Validated.	5.99024e-81
NZ_CP021359.1\|WP_005793659.1\|3592043_3592409_-\|30S-ribosomal-protein-S13	gnl\|CDD\|235358	PRK05179, rpsM, 30S ribosomal protein S13; Validated.	6.83572e-76
NZ_CP021359.1\|WP_086913542.1\|3587010_3587298_-\|peptidase	gnl\|CDD\|282822	pfam05015, HigB-like_toxin, RelE-like toxin of type II toxin-antitoxin system HigB. This family carries several different examples of type II bacterial toxins of toxin-antitoxin systems including many HigB-like ones. The fold is referred to as the RelE/YoeB/Txe/Yeeu fold suggesting all examples of these are present in this family. Several plasmids with proteic killer gene-systems have been reported. All of them encode a stable toxin and an unstable antidote. Upon loss of the plasmid, the less stable inhibitor is inactivated more rapidly than the toxin, allowing the toxin to be activated. The activation of these systems results in cell filamentation and cessation of viable cell production. It has been verified that both the stable killer and the unstable inhibitor of the systems are short polypeptides. This family corresponds to the toxin.	5.40537e-25
NZ_CP021359.1\|WP_086913543.1\|3589321_3589714_-\|50S-ribosomal-protein-L17	gnl\|CDD\|235522	PRK05591, rplQ, 50S ribosomal protein L17; Validated.	1.22786e-67
NZ_CP021359.1\|WP_086913535.1\|3580249_3580849_-\|hypothetical-protein	gnl\|CDD\|379128	pfam13338, AbiEi_4, Transcriptional regulator, AbiEi antitoxin. AbiEi_4 is the cognate antitoxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	5.67154e-08
NZ_CP021359.1\|WP_024813863.1\|3590906_3591530_-\|30S-ribosomal-protein-S4	gnl\|CDD\|235411	PRK05327, rpsD, 30S ribosomal protein S4; Validated.	4.71848e-120
NZ_CP021359.1\|WP_086913534.1\|3579350_3580253_-\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	gnl\|CDD\|378065	pfam08843, AbiEii, Nucleotidyl transferase AbiEii toxin, Type IV TA system. This family was recently identified as belonging to the nucleotidyltransferase superfamily. AbiEii is the cognate toxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	1.02791e-40
NZ_CP021359.1\|WP_086913537.1\|3582007_3583441_-\|3-isopropylmalate-dehydratase-large-subunit	gnl\|CDD\|183543	PRK12466, PRK12466, 3-isopropylmalate dehydratase large subunit.	0
NZ_CP021359.1\|WP_086913546.1\|3594675_3595194_-\|30S-ribosomal-protein-S5	gnl\|CDD\|234790	PRK00550, rpsE, 30S ribosomal protein S5; Validated.	1.02905e-94

>NZ_CP021359.1|WP_086913542.1|3587010_3587298_-|peptidase
MIKTFAHKGIEAFFRKGTKAGIQAVHAPRLSRLSRQLAQLNQAQAPRDMNLPGWKLHPLSGGLEGHWAVTVSGNWRLTFRFDDGDAILVDYQDYH
>NZ_CP021359.1|WP_086913541.1|3586678_3587002_-|HigA-family-addiction-module-antidote-protein
MSRMHNPPHPGLTLRDDILPALGLNVTDAAEALGVTRPTLSRVLNGAAAVSPEMALRLERWLGVEHGGRADVWLGLQAAYDLWAAEQKAKALIRKVKPLSAAALAGA
>NZ_CP021359.1|WP_086913540.1|3585488_3586394_+|LysR-family-transcriptional-regulator
MDSFKDLRFFALLMKEGSLAAAAQQMGITPPAASRRLAQLEHRLGVRLLHRTTRRISLTPEGETYLLDGARILSDLEALERTVSGARSSPRGLIKLAATLGFGRVHIAPALSAFARAYPEVEVQLHLTDRPVNLVEQGFDAAVRFGDLPDSRLTARRLLANQRVLCASPAYLAEAGEPAQPADLLAHQCIVIRESDETYGTWHLHQGERQETVKVRGMLSTNDGGAATTWALEGHGVLLRSEWDVAPYLASGQLQRVLSGWALPAADVTLVYPTKSDLSAKTRALADFLREWFAQGIPMRT
>NZ_CP021359.1|WP_086913539.1|3584378_3585365_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MNRIPVWSSLTRRMAATAALALLSTAALAQAYPTKAIKLVVPYAPGGSADIAARLVSDEWAKALGGSIFIENKGGAGGNIGVDMVAKAAPDGYTIGLQTVSLAINPALTAKMPYDTLKDLAPIGLVASSQHVLVVNNSLPAKSIKELVALLKAQPGKYSYGSAGAGSTFHMSAELFKAVAGVPIVHIPYRGGGPAMIDTMSGQVALSFPVLSAAQPHVQSGKLRALGVTGPKRSGLMPDVPTIAEAGLPNYSFETWFIVFAPAGTPKPVIDKLNTALNQALGTVALKERMTKDGFDPMPSTPEQARARLEKEMPQWAKLIKERGITTE
>NZ_CP021359.1|WP_086913538.1|3583437_3584343_-|alpha/beta-hydrolase
MTDSTLFPGFAPQRIRTPDGQHIQTLVGGNGPPLLLLHGHPQTSAIWHKVAPALAQQFTLVLADLRGYGDSAKPVGDAEHANYSKRTMAADMLSVMHHLGHSRFVVLAHDRGTRVAHRLAADHPGSVRRMVLLDIAPTLAMYEQTSDAFARAYWHWFFLIQPAPLPERLIEADPGAYIRDVMGRRSAGLAPFDARALAEYTRCLSLPGTAHGICEDYRAAAGIDLVHDRADRDAGHRLGMPLLALWGEQGVVHRCFKPLTEWQRVAANVRGHALPCGHYIAEEAPDALLAAALPFLLETDA
>NZ_CP021359.1|WP_086913537.1|3582007_3583441_-|3-isopropylmalate-dehydratase-large-subunit
MTHPSLPGQTLYQKLVASHTVAALDEQNVLLFCDLHLMNEYTSPQAFAGLHEAGRGVPVPGQNVAVVSHIIPTHPVRHRIIQDPPSALQASNLKANCDRHHIPMFDTNDPLQGIEHVVAPEHGMVRPGMVIICGDSHTTTYGALGALGFGIGTSEVEHVLATQTLVYRMAKDMRIRVDGRLPLGTTAKDLILMVISRIGAQGARGYAVEFCGSAISALSVEARFTLCNMAVEAGARGALIAPDDKAVDYVLARAPDITGDLRDRALAHWATLHSDANAVFEVEHRFEASEVVPFVTWGTSPDQAMAINATVPQPATMLDAVQRSSAEQALRYTALSAGQALQGVPVQHVFIGSCTNARIEDLREVVKVVGTRHVAPGVRAMVVPGSGAVKSQAEAEGIAGILQAAGFEWRQPGCSMCLAMNDDVLAPGQRCASTTNRNFEGRQGRGAITHLMSPAMAAAAAVTGCITDVRTLEILHA
>NZ_CP021359.1|WP_086913536.1|3581333_3582011_-|3-isopropylmalate-dehydratase-small-subunit
MTTRTANPIDNTVLCGHAAVLATPNLDTDQIMPKQFLRGIDKSGLAPGLLYDLRFDNAGQPRPDFVLNQPAFAGVDVLIAGSNYGCGSSREHAVWGMQQYGFKAVVASSFGEIFYSNALNNRLLLAMVPEVDVQAFMHEAAQLSGPLALEIDVQQRLVRSAQHQASFTLSDRHQRMFLQGLDVIGASLSYSEQINAFAAKHWAAQPWAKDVARTTRERLSALAQR
>NZ_CP021359.1|WP_086913535.1|3580249_3580849_-|hypothetical-protein
MNQSDQILELARHRRVLRAADVRAHGWSPQLLIRLHQAGKLQRFTRGLYGLPDTEITEHQTLIEVCQRVPKAVLCLLSALQFHEIGTQLPHEVWIALPEATQTPALSYPTLRITRLRGAAYSDGIQTVTDHGASIRVYSAAKTVTDCFKFRNKIGLDVALEALKDAWHSRKVTMVELSHFAKINRVERVMQPYLEAVTQ
>NZ_CP021359.1|WP_086913534.1|3579350_3580253_-|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein
MTGNLSASILARLLTLAKQRGDDYNLLLNRFGMERLLARVSLSPHADRFLLKGALLFALWYDTPHRPTRDADLLGFGPDDEANLISTFREVAAMELGDGIAFDPDSVKADAIREDNTYGGTRITLVARIGSARCALQIDVGFGDAVTPGPQIVTYPTLLGDFQVPTLRVYPVYTVIAEKYQAMVMLGQANSRMKDFFDLAVIARRTELDGATLAAAIAATFARRQTALPTERPLALTKKFSEDAAKLRQWQAFLNKNRIEAASLGDTVDLLDDLLWPPTQVAAAKSEATATWRPDSLRWV
>NZ_CP021359.1|WP_086914224.1|3578921_3579203_+|hypothetical-protein
MGLVEEHGKFYAPGTSPSKVIATFHMCADLVSQMVPYCQRKLATFEGNQEATVKAALKGLLAKRWCSDAQCVWIMRRVAQELQWPLHECALDG
>NZ_CP021359.1|WP_086913543.1|3589321_3589714_-|50S-ribosomal-protein-L17
MRHGHGLRKLNRTSSHRLAMLQNMMNSLIEHEAIKTTVPKAKELRRVIEPMITLAKEDSVANRRLAFNRLRDRDSVTKLFNDLGPRFKVRPGGYTRILKMGFRVGDNAPMALVELVDRAVESENNSAAAE
>NZ_CP021359.1|WP_005793666.1|3589803_3590796_-|DNA-directed-RNA-polymerase-subunit-alpha
MQTNLLKPKAINVEQLGHNRAKVALEPFERGYGHTLGNAIRRVLLSSMVGYAATEVTIAGVLHEYSSIDGVQEDVVNILLNLKGVVFKLHNRDEVTLSLRKDGEGVVTARDIQTPHDVEIVNPDHVIANLSAGGKLDMQIKVEKGRGYVPGNLRRYADESTKSIGRIVLDASFSPVKRVSYTVESARVEQRTDLDKLVVEIETNGAITAEDAVRASAKILVEQLAVFAQLEGGELAAFDAPAGPRGNATFDPILLRPVDELELTVRSANCLKAENIYYIGDLIQRTENELLKTPNLGRKSLNEIKEVLASRGLTLGMKLENWPPAGLDKR
>NZ_CP021359.1|WP_024813863.1|3590906_3591530_-|30S-ribosomal-protein-S4
MARYLGPKAKLSRREGTDLFLKSARRSIADKSKFDSKPGQHGRTSGARTSDYGLQLREKQKVKRMYGVLEKQFRRYFEAAEGRKGNTGANLLFLLESRLDNVVYRMGFGSTRAEARQLVSHKAITVNGKSVNIASYLVKTGDVVAVREKSKKQNRIVEALQLAAQVGMPAWVDVNAEKAEGIFKKVPDRDEFGADINESLIVELYSR
>NZ_CP021359.1|WP_005793662.1|3591620_3592025_-|30S-ribosomal-protein-S11
MAKSPANNAAQRVRKKVRKNVSDGIAHVHASFNNTIITITDRQGNALSWASSGGQGFKGSRKSTPFAAQVASEVAGRAAIDQGIKNLDVEIKGPGPGRESSVRALGALGIRITSISDVTPVPHNGCRPQKRRRI
>NZ_CP021359.1|WP_005793659.1|3592043_3592409_-|30S-ribosomal-protein-S13
MARIAGINIPPHKHAEIGLTAIFGIGRTRARKICEATGIAYSKKIKDLSDSDLEKIREQIEQFTIEGDLRRETTMNIKRLMDIGCYRGFRHRRGLPMRGQRTRTNARTRKGPRKGAAALKK
>NZ_CP021359.1|WP_005793651.1|3592432_3592546_-|50S-ribosomal-protein-L36
MRVSASVKKICRNCKIIRRKGVVRVICTDLRHKQRQG
>NZ_CP021359.1|WP_086913544.1|3592692_3594012_-|preprotein-translocase-subunit-SecY
MATSAAQIAKTGKFGDLRRRLVFLLLALVVYRVGAHIPVPGIDPAQLQQLFSGQQGGILNLFNMFSGGALSRFTVFALGIMPYISASIIMQLMTYVVPTFEQLKKEGEAGRRKITQYTRYGTLGLALFQSLGIAVALESSAGLVLNPGFGFRMTAVVSLTAGTMFLMWLGEQITERGLGNGISILIFAGIAAGLPSSIGGLLELVRTGAMGPLAAIFIVIVVGLVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVIPPIFASSIILLPATVVNWFSAGESMRWLKDISGALTPGQPIYVMFYATAIIFFCFFYTALVFNSRETADNLKKSGAFIPGIRPGEQTARYIDKILVRLTLAGAVYITFVCLLPEFLILKYNVPFYFGGTSLLIIVVVTMDFMAQVQNYMMSQQYESLLKKANFKGNTGG
>NZ_CP021359.1|WP_086913545.1|3594036_3594468_-|50S-ribosomal-protein-L15
MELNSIKPADGAKHAKRRVGRGIGSGLGKTAGRGHKGQKSRSGGYHKVGFEGGQMPLQRRLPKRGFKSHLLKFNAEVTLTALDQLGLAEVDVLALKQAGLVGELAKVVKVIKSGSLTKAVKLNGVGATAGAKAAIEAAGGSIA
>NZ_CP021359.1|WP_007861725.1|3594478_3594661_-|50S-ribosomal-protein-L30
MTTQQTVKIQLVRSPIGTKESHRATVRGLGLRKLNSVSELQDSPEVRGMINKISYLVKVL
>NZ_CP021359.1|WP_086913546.1|3594675_3595194_-|30S-ribosomal-protein-S5
MAKFQPKVQSEGQDDGLREKMIAVNRVTKVVKGGRILGFAALTVVGDGDGRVGMGKGKSKEVPAAVQKAMEEARRNMVKVSLKNGTIFHNVTGHHGAAVVMMAPAPKGTGIIAGGPMRAVFEVLGVTDIVAKSHGSSNPYNMVRATFDALVNSTTPSNVAAKRGKTVEDIFV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP021359_1	1.2\|3588996\|31\|NZ_CP021359\|PILER-CR	3588996-3589026	31	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	960456-960486	6	0.806
NZ_CP021359_1	1.4\|3588995\|32\|NZ_CP021359\|CRISPRCasFinder	3588995-3589026	32	NZ_CP016084	Streptomyces sp. SAT1 plasmid unnamed4, complete sequence	49505-49536	7	0.781
NZ_CP021359_1	1.4\|3588995\|32\|NZ_CP021359\|CRISPRCasFinder	3588995-3589026	32	NC_020894	Streptomyces hygroscopicus subsp. jinggangensis TL01 plasmid pSHJGH1, complete sequence	78179-78210	7	0.781
NZ_CP021359_1	1.4\|3588995\|32\|NZ_CP021359\|CRISPRCasFinder	3588995-3589026	32	NZ_CP041652	Streptomyces sp. RLB1-9 plasmid pRLB1-9.2, complete sequence	57515-57546	7	0.781
NZ_CP021359_1	1.4\|3588995\|32\|NZ_CP021359\|CRISPRCasFinder	3588995-3589026	32	NZ_CP018075	Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence	121887-121918	7	0.781
NZ_CP021359_1	1.4\|3588995\|32\|NZ_CP021359\|CRISPRCasFinder	3588995-3589026	32	NZ_CP026653	Streptomyces dengpaensis strain XZHG99 plasmid unnamed1, complete sequence	55708-55739	7	0.781
NZ_CP021359_1	1.4\|3588995\|32\|NZ_CP021359\|CRISPRCasFinder	3588995-3589026	32	NC_017766	Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG1, complete sequence	78180-78211	7	0.781
NZ_CP021359_1	1.2\|3588996\|31\|NZ_CP021359\|PILER-CR	3588996-3589026	31	NZ_CP005190	Sphingobium sp. MI1205 plasmid pMI1, complete sequence	226762-226792	8	0.742
NZ_CP021359_1	1.2\|3588996\|31\|NZ_CP021359\|PILER-CR	3588996-3589026	31	NC_009959	Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI05, complete sequence	29087-29117	8	0.742
NZ_CP021359_1	1.2\|3588996\|31\|NZ_CP021359\|PILER-CR	3588996-3589026	31	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1896725-1896755	8	0.742
NZ_CP021359_1	1.2\|3588996\|31\|NZ_CP021359\|PILER-CR	3588996-3589026	31	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1730579-1730609	8	0.742
NZ_CP021359_1	1.4\|3588995\|32\|NZ_CP021359\|CRISPRCasFinder	3588995-3589026	32	NC_004719	Streptomyces avermitilis MA-4680 = NBRC 14893 plasmid SAP1, complete sequence	54729-54760	8	0.75
NZ_CP021359_1	1.2\|3588996\|31\|NZ_CP021359\|PILER-CR	3588996-3589026	31	NZ_CP031226	Pseudomonas amygdali pv. lachrymans str. M301315 plasmid pMPPla107, complete sequence	276624-276654	9	0.71
NZ_CP021359_1	1.4\|3588995\|32\|NZ_CP021359\|CRISPRCasFinder	3588995-3589026	32	NZ_CP005190	Sphingobium sp. MI1205 plasmid pMI1, complete sequence	226761-226792	9	0.719
NZ_CP021359_1	1.4\|3588995\|32\|NZ_CP021359\|CRISPRCasFinder	3588995-3589026	32	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1730578-1730609	9	0.719
NZ_CP021359_1	1.4\|3588995\|32\|NZ_CP021359\|CRISPRCasFinder	3588995-3589026	32	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1896725-1896756	9	0.719
NZ_CP021359_1	1.4\|3588995\|32\|NZ_CP021359\|CRISPRCasFinder	3588995-3589026	32	NZ_CP031226	Pseudomonas amygdali pv. lachrymans str. M301315 plasmid pMPPla107, complete sequence	276624-276655	10	0.688

1. spacer 1.2|3588996|31|NZ_CP021359|PILER-CR matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 6, identity: 0.806

tgatgg-gctccagctcctggcgcaaggcggt	CRISPR spacer
-gctggctctccagctcctggcggaaggcgag	Protospacer
 * ***  *************** ******.

2. spacer 1.4|3588995|32|NZ_CP021359|CRISPRCasFinder matches to NZ_CP016084 (Streptomyces sp. SAT1 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

ttgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
ttgatggcctccagcgcctggcggggagaggt	Protospacer
******* ******* ******* ...* ***

3. spacer 1.4|3588995|32|NZ_CP021359|CRISPRCasFinder matches to NC_020894 (Streptomyces hygroscopicus subsp. jinggangensis TL01 plasmid pSHJGH1, complete sequence) position: , mismatch: 7, identity: 0.781

ttgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
ttgatggcctccagcgcctggcggggcgaggt	Protospacer
******* ******* ******* .. * ***

4. spacer 1.4|3588995|32|NZ_CP021359|CRISPRCasFinder matches to NZ_CP041652 (Streptomyces sp. RLB1-9 plasmid pRLB1-9.2, complete sequence) position: , mismatch: 7, identity: 0.781

ttgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
ttgatggcctccagcgcctggcggggtgaggt	Protospacer
******* ******* ******* .. * ***

5. spacer 1.4|3588995|32|NZ_CP021359|CRISPRCasFinder matches to NZ_CP018075 (Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

ttgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
ttgatggcctccagcgcctggcggggcgaggt	Protospacer
******* ******* ******* .. * ***

6. spacer 1.4|3588995|32|NZ_CP021359|CRISPRCasFinder matches to NZ_CP026653 (Streptomyces dengpaensis strain XZHG99 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ttgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
ttgatggcctccagcgcctggcgggctgaggt	Protospacer
******* ******* ******* .  * ***

7. spacer 1.4|3588995|32|NZ_CP021359|CRISPRCasFinder matches to NC_017766 (Streptomyces hygroscopicus subsp. jinggangensis 5008 plasmid pSHJG1, complete sequence) position: , mismatch: 7, identity: 0.781

ttgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
ttgatggcctccagcgcctggcggggcgaggt	Protospacer
******* ******* ******* .. * ***

8. spacer 1.2|3588996|31|NZ_CP021359|PILER-CR matches to NZ_CP005190 (Sphingobium sp. MI1205 plasmid pMI1, complete sequence) position: , mismatch: 8, identity: 0.742

tgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
ccagcttctccagctcatggcgcaaggcggc	Protospacer
. *    ********* *************.

9. spacer 1.2|3588996|31|NZ_CP021359|PILER-CR matches to NC_009959 (Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI05, complete sequence) position: , mismatch: 8, identity: 0.742

tgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
cggcgctgtccagctcctggcgcagggcgga	Protospacer
.*..*   ****************.*****

10. spacer 1.2|3588996|31|NZ_CP021359|PILER-CR matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 8, identity: 0.742

tgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
cgatgcgctccagctccttgcgcagcggcgc	Protospacer
.**** ************ *****. *  *.

11. spacer 1.2|3588996|31|NZ_CP021359|PILER-CR matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.742

tgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
cgatgcgctccagctccttgcgcagcggcgc	Protospacer
.**** ************ *****. *  *.

12. spacer 1.4|3588995|32|NZ_CP021359|CRISPRCasFinder matches to NC_004719 (Streptomyces avermitilis MA-4680 = NBRC 14893 plasmid SAP1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
ttgatggcctccagcgcctggcggggagaggc	Protospacer
******* ******* ******* ...* **.

13. spacer 1.2|3588996|31|NZ_CP021359|PILER-CR matches to NZ_CP031226 (Pseudomonas amygdali pv. lachrymans str. M301315 plasmid pMPPla107, complete sequence) position: , mismatch: 9, identity: 0.71

tgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
ccctggcctccagctgctggcgcaaggtctg	Protospacer
.  *** ******** ***********.

14. spacer 1.4|3588995|32|NZ_CP021359|CRISPRCasFinder matches to NZ_CP005190 (Sphingobium sp. MI1205 plasmid pMI1, complete sequence) position: , mismatch: 9, identity: 0.719

ttgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
cccagcttctccagctcatggcgcaaggcggc	Protospacer
.. *    ********* *************.

15. spacer 1.4|3588995|32|NZ_CP021359|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

ttgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
acgatgcgctccagctccttgcgcagcggcgc	Protospacer
 .**** ************ *****. *  *.

16. spacer 1.4|3588995|32|NZ_CP021359|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 9, identity: 0.719

ttgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
acgatgcgctccagctccttgcgcagcggcgc	Protospacer
 .**** ************ *****. *  *.

17. spacer 1.4|3588995|32|NZ_CP021359|CRISPRCasFinder matches to NZ_CP031226 (Pseudomonas amygdali pv. lachrymans str. M301315 plasmid pMPPla107, complete sequence) position: , mismatch: 10, identity: 0.688

ttgatgggctccagctcctggcgcaaggcggt	CRISPR spacer
cccctggcctccagctgctggcgcaaggtctg	Protospacer
..  *** ******** ***********.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1767075 : 1810265

uncultured_Caudovirales_phage(41.18%)

terminase,capsid,plate,portal,transposase,tail,protease,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086914041.1\|1767075_1767309_+\|terminase	terminase	NA	NA	NA	NA
WP_086912144.1\|1767305_1767776_+	hypothetical protein	K4HZ96	Acidithiobacillus_phage	1.7e-29	43.7
WP_086912145.1\|1767781_1768096_+	hypothetical protein	NA	NA	NA	NA
WP_086912146.1\|1768092_1768968_+	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	2.8e-105	68.4
WP_086912147.1\|1768970_1769576_+	hypothetical protein	K4ICM8	Acidithiobacillus_phage	1.2e-62	60.1
WP_086912148.1\|1769589_1771266_+	DEAD/DEAH box helicase	A0A1B1IW48	uncultured_Mediterranean_phage	1.3e-37	29.4
WP_086912149.1\|1771262_1771685_+	hypothetical protein	K4I3X7	Acidithiobacillus_phage	1.2e-24	48.8
WP_086912150.1\|1771684_1772440_+	hypothetical protein	K4HZA0	Acidithiobacillus_phage	5.4e-81	59.0
WP_086914042.1\|1772439_1774629_+	AAA family ATPase	A0A1B2LRQ1	Wolbachia_phage	6.1e-101	33.2
WP_086912151.1\|1774940_1775396_+	hypothetical protein	K4ICN3	Acidithiobacillus_phage	1.7e-53	71.0
WP_086912152.1\|1775398_1775602_+	hypothetical protein	NA	NA	NA	NA
WP_086912153.1\|1775594_1775981_+	RNA polymerase subunit sigma	NA	NA	NA	NA
WP_086912154.1\|1776175_1777474_+	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	3.2e-158	68.2
WP_086912155.1\|1777583_1778705_+	Fic family protein	NA	NA	NA	NA
WP_086912156.1\|1778727_1779180_-	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	2.0e-22	67.9
WP_086912157.1\|1779220_1779442_-	hypothetical protein	NA	NA	NA	NA
WP_086912158.1\|1779488_1779695_-	hypothetical protein	NA	NA	NA	NA
WP_086912159.1\|1780050_1780578_+	hypothetical protein	A0A2K9V2Q9	Faecalibacterium_phage	4.7e-07	29.4
WP_157896561.1\|1780555_1782403_+\|terminase	phage terminase large subunit family protein	A0A2K9V3X4	Faecalibacterium_phage	4.8e-131	45.8
WP_086912161.1\|1782421_1782628_+	hypothetical protein	A0A2H4JA19	uncultured_Caudovirales_phage	5.5e-12	52.2
WP_086912162.1\|1782630_1784148_+\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	4.9e-190	67.2
WP_086912163.1\|1784144_1785281_+\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	1.9e-82	45.3
WP_086912164.1\|1785301_1785646_+\|head	head decoration protein	NA	NA	NA	NA
WP_086912165.1\|1785677_1786682_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	1.2e-83	49.4
WP_086912166.1\|1786692_1786992_+	hypothetical protein	NA	NA	NA	NA
WP_086912167.1\|1786988_1787522_+\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	2.7e-10	30.6
WP_086912168.1\|1787535_1788051_+	hypothetical protein	Q9JML9	Wolbachia_phage	6.8e-27	44.4
WP_086912169.1\|1788047_1788698_+\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	6.8e-24	43.9
WP_086912170.1\|1788770_1789019_+	hypothetical protein	NA	NA	NA	NA
WP_086914043.1\|1789028_1789355_+\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	2.3e-28	56.6
WP_086912171.1\|1789351_1790236_+\|plate	baseplate assembly protein	A0A1S6KZY6	Salmonella_phage	2.7e-92	61.7
WP_086912172.1\|1790228_1790852_+\|tail	phage tail protein I	F1BUP2	Erwinia_phage	2.5e-60	57.4
WP_086912173.1\|1790848_1792084_+	hypothetical protein	A0A2I8TVA9	Erwinia_phage	1.5e-64	41.4
WP_086912174.1\|1792092_1792842_+\|tail	phage tail protein	A0A077K9S5	Ralstonia_phage	4.2e-62	53.4
WP_086912175.1\|1792913_1794074_+\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	1.9e-162	74.7
WP_086912176.1\|1794086_1794590_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	3.6e-49	55.2
WP_086912177.1\|1794642_1794966_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_086912178.1\|1795015_1797445_+\|tail	phage tail protein	A0A2H4JG00	uncultured_Caudovirales_phage	3.3e-07	54.4
WP_086912179.1\|1797453_1798371_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	5.1e-25	32.1
WP_086914044.1\|1798357_1798552_+\|tail	phage tail protein	A0A2H4IYW8	uncultured_Caudovirales_phage	4.2e-14	56.5
WP_086912180.1\|1798555_1799608_+	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	7.7e-86	50.3
WP_086914045.1\|1799673_1799961_+	hypothetical protein	K4I011	Acidithiobacillus_phage	4.8e-14	46.4
WP_086914046.1\|1800080_1800425_+	hypothetical protein	NA	NA	NA	NA
WP_086912181.1\|1800424_1800922_+	lysozyme	A0A142EZW8	Stenotrophomonas_phage	8.0e-25	44.4
WP_086914047.1\|1801036_1802008_+	glycosyltransferase family 2 protein	A0A075B8F6	Enterobacteria_phage	1.6e-93	55.1
WP_086912182.1\|1802011_1802728_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_157896562.1\|1802744_1803245_+	GtrA family protein	NA	NA	NA	NA
WP_157896563.1\|1803241_1805290_+	hypothetical protein	NA	NA	NA	NA
WP_086914048.1\|1805394_1805616_-	hypothetical protein	NA	NA	NA	NA
WP_086912185.1\|1806270_1806537_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_086912186.1\|1806533_1807841_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_086912187.1\|1807887_1808106_-	hypothetical protein	A0A291LAT3	Bordetella_phage	7.3e-07	35.8
WP_157896621.1\|1809006_1809090_-	hypothetical protein	NA	NA	NA	NA
WP_063462293.1\|1809179_1810265_+\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

2406479 : 2472083

uncultured_Caudovirales_phage(12.5%)

terminase,capsid,tRNA,portal,integrase,protease,head

attL 2411725:2411741|attR 2469692:2469708

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086914100.1\|2406479_2407472_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_086912635.1\|2407557_2407929_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_086912636.1\|2407932_2410794_-	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	3.7e-21	24.8
WP_086912637.1\|2410817_2412302_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
2411725:2411741	attL	NA	NA	NA	NA
WP_086912638.1\|2412379_2412973_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_086912639.1\|2413284_2416635_-	DEAD/DEAH box helicase	A0A0N7D8L3	Dasychira_pudibunda_nucleopolyhedrovirus	2.0e-50	30.5
WP_086912640.1\|2416826_2417228_-	thioredoxin family protein	NA	NA	NA	NA
WP_086912641.1\|2417287_2418580_-	c-type cytochrome	NA	NA	NA	NA
WP_157896623.1\|2418593_2419232_-	c-type cytochrome	NA	NA	NA	NA
WP_086912643.1\|2419638_2421378_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.0e-18	32.0
WP_086914101.1\|2421603_2422113_-	hypothetical protein	NA	NA	NA	NA
WP_086912644.1\|2422302_2423775_-	RNB domain-containing ribonuclease	NA	NA	NA	NA
WP_086912645.1\|2423801_2425094_-	MFS transporter	NA	NA	NA	NA
WP_086912646.1\|2425291_2425918_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_086914102.1\|2425976_2428607_+	cation-translocating P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	3.8e-57	28.8
WP_086912647.1\|2428620_2429586_-	cation transporter	NA	NA	NA	NA
WP_086912648.1\|2429723_2430773_-	DMT family transporter	NA	NA	NA	NA
WP_086912649.1\|2431171_2432341_-	DUF4382 domain-containing protein	NA	NA	NA	NA
WP_086912650.1\|2432670_2433294_+	PEP-CTERM sorting domain-containing protein	NA	NA	NA	NA
WP_086912651.1\|2433546_2434746_-	hypothetical protein	NA	NA	NA	NA
WP_086912652.1\|2434817_2435636_-	hypothetical protein	NA	NA	NA	NA
WP_086912653.1\|2435875_2436283_+	type IV pilin protein	NA	NA	NA	NA
WP_086914103.1\|2436295_2436787_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_086912654.1\|2436774_2437347_+	type IV pilus modification protein PilV	NA	NA	NA	NA
WP_086912655.1\|2437364_2438384_+	PilW family protein	NA	NA	NA	NA
WP_086912656.1\|2438380_2438944_+	hypothetical protein	NA	NA	NA	NA
WP_086912657.1\|2438967_2441970_+	hypothetical protein	NA	NA	NA	NA
WP_086912658.1\|2442366_2443998_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-17	34.8
WP_086914104.1\|2443994_2445062_-	ABC transporter permease	NA	NA	NA	NA
WP_086912659.1\|2445072_2445489_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_086912660.1\|2445478_2445889_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_086912661.1\|2445898_2446930_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_086912662.1\|2446946_2448773_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_086912663.1\|2449053_2449854_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_086912664.1\|2449937_2450789_+	DNA ligase	F2Y2Y2	Organic_Lake_phycodnavirus	5.4e-29	30.6
WP_086912665.1\|2450953_2453320_-	arginine/lysine/ornithine decarboxylase	NA	NA	NA	NA
WP_086912666.1\|2453463_2453889_+	hypothetical protein	NA	NA	NA	NA
WP_086912667.1\|2453925_2454840_+	paraslipin	NA	NA	NA	NA
WP_086912668.1\|2455212_2456412_+\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	2.3e-94	47.8
WP_157896581.1\|2456398_2457130_+	hypothetical protein	NA	NA	NA	NA
WP_086912670.1\|2457237_2457486_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_086912671.1\|2457485_2458196_+	hypothetical protein	NA	NA	NA	NA
WP_086912672.1\|2458199_2458517_+	hypothetical protein	NA	NA	NA	NA
WP_086912673.1\|2458506_2458812_+	hypothetical protein	NA	NA	NA	NA
WP_086912674.1\|2458801_2459260_+	hypothetical protein	NA	NA	NA	NA
WP_086912675.1\|2459256_2460477_+	AAA family ATPase	NA	NA	NA	NA
WP_086912676.1\|2460619_2461843_+\|capsid	phage major capsid protein	R9TPU0	Vibrio_phage	5.0e-28	28.6
WP_086912677.1\|2461857_2462382_+\|head,protease	HK97 family phage prohead protease	A0A2H4J6Z9	uncultured_Caudovirales_phage	4.8e-28	45.7
WP_086912678.1\|2462390_2463560_+\|portal	phage portal protein	A0A2K5B287	Erysipelothrix_phage	6.4e-73	43.6
WP_157896582.1\|2463537_2463993_+	HNH endonuclease	A0A2D1GNP5	Pseudomonas_phage	2.8e-08	47.0
WP_086912679.1\|2463989_2464472_+	TerS protein	A0A0F7L441	uncultured_marine_virus	8.3e-27	47.0
WP_086912680.1\|2464475_2465996_+\|terminase	terminase large subunit	F1C585	Cronobacter_phage	3.9e-179	63.1
WP_086912681.1\|2466422_2466755_+	hypothetical protein	NA	NA	NA	NA
WP_086912682.1\|2466858_2467842_+	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	2.5e-54	40.1
WP_086914105.1\|2467985_2468996_+	YqaJ viral recombinase family protein	A6XMH8	Bacillus_virus	1.3e-50	36.9
WP_086914106.1\|2469076_2470009_+\|capsid	phage capsid protein	NA	NA	NA	NA
2469692:2469708	attR	NA	NA	NA	NA
WP_086912683.1\|2470466_2472083_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-17	31.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021360

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP021359

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection