CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	0 crisprs	RT,WYL	0	0	5	0
NZ_CP016612	Ralstonia solanacearum FJAT-91 chromosome, complete genome	1 crisprs	DEDDh,csa3,RT,DinG,WYL,cas3	0	1	13	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016612_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016612_1

1623108-1623218

Orphan

Consensus_repeat	Method
TCCCTATGTTCGTCCCGAGCCGTCCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016612_1

>merge|NZ_CP016612|1|1623108-1623218|CRISPRCasFinder
TCCCTATGTTCGTCCCGAGCCGTCCGCGCCTCCGCTGCCGGAGCAGGGCGCCCCGTCCGGGCGCGCCGCCAACAGCGCTTCCCATCCCTATATTCGTCCCGAGCCGTCCGC

>NZ_CP016612|1|1|1623108-1623218|CRISPRCasFinder
TCCCTATGTTCGTCCCGAGCCGTCCGC	GCCTCCGCTGCCGGAGCAGGGCGCCCCGTCCGGGCGCGCCGCCAACAGCGCTTCCCA
TCCCTATATTCGTCCCGAGCCGTCCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016612.1\|WP_038937772.1\|1629636_1631217_+\|malate-synthase-A	unknown	unknown	gnl\|CDD\|236432
NZ_CP016612.1\|WP_016725893.1\|1613255_1615313_+\|type-III-effector-protein	unknown	unknown	gnl\|CDD\|339245
NZ_CP016612.1\|WP_016722040.1\|1620219_1620633_+\|gamma-glutamylcyclotransferase	unknown	unknown	gnl\|CDD\|225016
NZ_CP016612.1\|WP_011001309.1\|1627465_1628395_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP016612.1\|WP_011001311.1\|1628851_1629553_+\|haloacid-dehalogenase-type-II	unknown	unknown	gnl\|CDD\|130495
NZ_CP016612.1\|WP_016722033.1\|1633405_1633675_-\|acyl-CoA-binding-protein	unknown	unknown	gnl\|CDD\|226731
NZ_CP016612.1\|WP_016722048.1\|1609993_1610974_+\|sulfate-ABC-transporter-permease-subunit-CysW	unknown	unknown	gnl\|CDD\|226665
NZ_CP016612.1\|WP_086706267.1\|1635159_1636122_+\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|381680
NZ_CP016612.1\|WP_011001296.1\|1610970_1612089_+\|sulfate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213263
NZ_CP016612.1\|WP_016722037.1\|1625518_1626823_+\|isocitrate-lyase	unknown	unknown	gnl\|CDD\|237893
NZ_CP016612.1\|WP_016722039.1\|1620810_1622673_+\|GALA-protein	unknown	unknown	gnl\|CDD\|275380
NZ_CP016612.1\|WP_016722045.1\|1615510_1615804_+\|2TM-domain-containing-protein	unknown	unknown	gnl\|CDD\|379083
NZ_CP016612.1\|WP_086706265.1\|1633827_1634559_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	unknown	unknown	gnl\|CDD\|274750
NZ_CP016612.1\|WP_021154828.1\|1615803_1617048_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225519
NZ_CP016612.1\|WP_011001303.1\|1619720_1620227_+\|RraA-family-protein	unknown	unknown	gnl\|CDD\|236487
NZ_CP016612.1\|WP_020371745.1\|1626954_1627389_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP016612.1\|WP_021154825.1\|1617947_1619693_+\|thiamine-pyrophosphate-binding-protein	unknown	unknown	gnl\|CDD\|181285
NZ_CP016612.1\|WP_011001297.1\|1612123_1613107_+\|CysB-family-HTH-type-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237172
NZ_CP016612.1\|WP_021154817.1\|1634555_1635089_+\|ribosomal-protein-S18-alanine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|273701
NZ_CP016612.1\|WP_011001313.1\|1631323_1631794_+\|DUF1857-family-protein	unknown	unknown	gnl\|CDD\|176872

Protein	Function_ID	Function_description	E-value
NZ_CP016612.1\|WP_038937772.1\|1629636_1631217_+\|malate-synthase-A	gnl\|CDD\|236432	PRK09255, PRK09255, malate synthase; Validated.	0
NZ_CP016612.1\|WP_016725893.1\|1613255_1615313_+\|type-III-effector-protein	gnl\|CDD\|339245	pfam14496, NEL, C-terminal novel E3 ligase, LRR-interacting. This NEL or novel E3 ligase domain is found at the C-terminus of bacterial virulence factors. Its sequence is different from those of the eukaryotic HECT and RING-finger E3 ligases, and it subverts the host ubiquitination process. At the N-terminus of the family-members there is a series of LRR repeats, and the NEL domain interacts with the most N-terminal repeat. The key residue for the ligation step is the cysteine, eg found at position 386 in UniProtKB:E7K2H2. The LRR section sequesters this active site until invasion has occurred.	1.97042e-51
NZ_CP016612.1\|WP_016722040.1\|1620219_1620633_+\|gamma-glutamylcyclotransferase	gnl\|CDD\|225016	COG2105, COG2105, Uncharacterized conserved protein [Function unknown].	8.89773e-29
NZ_CP016612.1\|WP_011001309.1\|1627465_1628395_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.22847e-92
NZ_CP016612.1\|WP_011001311.1\|1628851_1629553_+\|haloacid-dehalogenase-type-II	gnl\|CDD\|130495	TIGR01428, Haloacetate_dehalogenase, 2-haloalkanoic acid dehalogenase, type II. Catalyzes the hydrolytic dehalogenation of small L-2-haloalkanoic acids to yield the corresponding D-2-hydroxyalkanoic acids. Belongs to the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases (pfam00702), class (subfamily) I. Note that the Type I HAD enzymes have not yet been fully characterized, but clearly utilize a substantially different catalytic mechanism and are thus unlikely to be related.	1.61219e-91
NZ_CP016612.1\|WP_016722033.1\|1633405_1633675_-\|acyl-CoA-binding-protein	gnl\|CDD\|226731	COG4281, ACB, Acyl-CoA-binding protein [Lipid metabolism].	2.01415e-46
NZ_CP016612.1\|WP_016722048.1\|1609993_1610974_+\|sulfate-ABC-transporter-permease-subunit-CysW	gnl\|CDD\|226665	COG4208, CysW, ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism].	4.60094e-163
NZ_CP016612.1\|WP_086706267.1\|1635159_1636122_+\|uracil-DNA-glycosylase	gnl\|CDD\|381680	cd10030, UDG-F4_TTUDGA_SPO1dp_like, Uracil DNA glycosylase family 4, includes Thermotoga maritima TTUDGA, Bacillus phage SPO1 DNA polymerase, and similar proteins. Uracil DNA glycosylase family 4 includes Thermotoga maritima TTUDGA, a robust uracil DNA glycosylase that shares narrow substrate specificity and high catalytic efficiency with family 1, acting on double-stranded and single-stranded uracil-containing DNA. Members of this family possess four conserved cysteine residues required to coordinate the [4Fe-4S] iron-sulfur cluster. This family also includes the N-terminal domain of Bacillus phage SPO1 DNA polymerase. Bacteriophage SPO1 is one of a group of large, lytic, tailed bacteriophages of Bacillus subtilis, and contains hydroxymethyluracil (hmUra) in place of thymine in their DNA. It has been speculated that this UDG domain may help discriminate between hmUra containing SPO1 DNA and thymine-containing host DNA. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Uracil in DNA can arise as a result of mis-incorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other.	2.37699e-97
NZ_CP016612.1\|WP_011001296.1\|1610970_1612089_+\|sulfate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	1.25082e-167
NZ_CP016612.1\|WP_016722037.1\|1625518_1626823_+\|isocitrate-lyase	gnl\|CDD\|237893	PRK15063, PRK15063, isocitrate lyase; Provisional.	0
NZ_CP016612.1\|WP_016722039.1\|1620810_1622673_+\|GALA-protein	gnl\|CDD\|275380	sd00033, LRR_RI, leucine-rich repeats, ribonuclease inhibitor (RI)-like subfamily. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.	2.43388e-33
NZ_CP016612.1\|WP_016722045.1\|1615510_1615804_+\|2TM-domain-containing-protein	gnl\|CDD\|379083	pfam13239, 2TM, 2TM domain. This short region contains two transmembrane alpha helices that are found associated with a wide range of other domains. This domain may be involved in cell lysis or peptidoglycan turnover.	3.19434e-14
NZ_CP016612.1\|WP_086706265.1\|1633827_1634559_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	gnl\|CDD\|274750	TIGR03725, T6A_YeaZ, tRNA threonylcarbamoyl adenosine modification protein YeaZ. This family describes a protein family, YeaZ, now associated with the threonylcarbamoyl adenosine (t6A) tRNA modification. Members of this family may occur as fusions with ygjD (previously gcp) or the ribosomal protein N-acetyltransferase rimI, and is frequently encoded next to rimI. [Protein synthesis, tRNA and rRNA base modification].	3.98601e-56
NZ_CP016612.1\|WP_021154828.1\|1615803_1617048_+\|sensor-histidine-kinase	gnl\|CDD\|225519	COG2972, COG2972, Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms].	8.93532e-90
NZ_CP016612.1\|WP_011001303.1\|1619720_1620227_+\|RraA-family-protein	gnl\|CDD\|236487	PRK09372, PRK09372, ribonuclease E inhibitor RraA.	1.43722e-96
NZ_CP016612.1\|WP_020371745.1\|1626954_1627389_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	5.66819e-31
NZ_CP016612.1\|WP_021154825.1\|1617947_1619693_+\|thiamine-pyrophosphate-binding-protein	gnl\|CDD\|181285	PRK08199, PRK08199, thiamine pyrophosphate protein; Validated.	0
NZ_CP016612.1\|WP_011001297.1\|1612123_1613107_+\|CysB-family-HTH-type-transcriptional-regulator	gnl\|CDD\|237172	PRK12683, PRK12683, transcriptional regulator CysB-like protein; Reviewed.	0
NZ_CP016612.1\|WP_021154817.1\|1634555_1635089_+\|ribosomal-protein-S18-alanine-N-acetyltransferase	gnl\|CDD\|273701	TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase. Members of this model belong to the GCN5-related N-acetyltransferase (GNAT) superfamily. This model covers prokarotes and the archaea. The seed contains a characterized accession for Gram negative E. coli. An untraceable characterized accession (PIR\|S66013) for Gram positive B. subtilis scores well (205.0) in the full alignment. Characterized members are lacking in the archaea. Noise cutoff (72.4) was set to exclude M. loti paralog of rimI. Trusted cutoff (80.0) was set at next highest scoring member in the mini-database. [Protein synthesis, Ribosomal proteins: synthesis and modification].	1.1062e-41
NZ_CP016612.1\|WP_011001313.1\|1631323_1631794_+\|DUF1857-family-protein	gnl\|CDD\|176872	cd08863, SRPBCC_DUF1857, DUF1857, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily. Uncharacterized family of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	2.21381e-54

>NZ_CP016612.1|WP_016722039.1|1620810_1622673_+|GALA-protein
MVSRIPTGNRGQGNGIEQSASSHATEATPWLGVNLPYGHWLPSSARSVVSRASSLLGGLANFRWGGPSASARPAPNIRSAAIAPAQQTLPPELWQQIATLAGARPRRAMREVSLELRNASRAVVTHLTISDPAMFRQLSLYPALKSVRFKGALTLEALKALPPTLEHLEIGRCTGSAISAEGLAHLAAMPLKSLNLNGIEIGVEGARLLATSTSLASLSLMGCDIGDRAATALAASSSIQCLYLSVNRIGRDGAQALAGAPLVSLNLHNNEIGNEGARALATSRTLTSLDVSNNGVGNAGAEAFAGNTVLKQLSLAGGMISGDGAQALADNKSLTDLDLSNNRLGDAGAQALADSESFVSLKLGGNEIGADGAEALARNVVLQSLNLSYNPIGFWGVNALGRAKLRKLDLCACAIDSDGASALARNTSLASLYLGSNRIGDDGARALAKNSTLTLLNLSGNNIHAVGAQALASNDSLITLDLSRNGIGDDGTAALACHPRLTSLNLSRNQIGSTGAQQLAKSATLAELDLSENRIGPEGAEALARSTVLTTLNVSYNAIGEAGARALAESVSLTSLDARRNGIGEGGAKVLEANTRITGTPQNPNFLAEDVPRPDVRWRD
>NZ_CP016612.1|WP_016722040.1|1620219_1620633_+|gamma-glutamylcyclotransferase
MTEAIHVFAYGTLRAGEANDLRVAASRRGIAEPKLIGHATLHGRLYDFGAYPGLVPDPTGTAVRGDVYRIDPGLVPVLDTIEAVYPGGEALFLRETHTVMLGSEPLDCIVYPVSAGQVAGRHVITGGDWVAYRLARG
>NZ_CP016612.1|WP_011001303.1|1619720_1620227_+|RraA-family-protein
MTTMMIPVTDLCDAHEDQLASGAVRVLAPVFRSFGARAAFAGPAATLKVFEDNGLVRAMLEQPGEGRVLVVDGGGSLRCALVGGNLAKLAEDNGWEGVLVNGCVRDTRELAACNVGVHALAAHPRKSFKKNQGERDIGVQMPGAYIHPGEWIYGDEDGVLVSRERLHD
>NZ_CP016612.1|WP_021154825.1|1617947_1619693_+|thiamine-pyrophosphate-binding-protein
METAVARPVSTGPTDSTGSGSRPVPRHGGQILVDALIAHGTDLAFGVPGESYLAVLEGFYQRRDRARFIVCRQEGGAATMADAHGKLTGRPGIVFCTRGPGATNASIGVHTAFQDSTPLILFIGQVGRDCVDREAFQEIDYRRMFGQMAKWVAQIDSVERIPEYIARAFQTATAGRPGPVVLALPEDMLTEVATVADVPPMPRAMAWPAPHDLARLKALLGRAERPLVLLGGAGWTPQAAARLQAFAERWRLPVGCVFRRQDLFDNRHPNYAGDVGIAINPKLAARVREADVVLAIGTRLGEMATSGYTLFDVPRPRQTLIHVHAGAEELGRVYQADLMIHAAMPAIAEALDSVAPDAPPRWQAWTEAAHADYLANIAPPPFAGRGIDLARAMQWLRERLPRNAILTNGAGNYATWLHRFYQYGPLAAGSRTQLAPTSGAMGYGAPAAVAAKIACPQTPVICLAGDGCFLMNGQELATAMQYDAPVIFIVVNNGMYGTIRMHQERAYPEHVSGTELRNPDFAALARAYGAEGHTVRSLEGFQAAVEAALAAPVATVIEVQTDPEIISPRATLQSLRAQARG
>NZ_CP016612.1|WP_021154828.1|1615803_1617048_+|sensor-histidine-kinase
MRDRPRFDPATPSSKIGRMLANVSLPPLAECLRIAMRWLRAFAWIVAINTGIAAVLAFGIKPDDTFWHDLVYSQAIGLSMWLLIDIPRHLLWGNGPPSRRVLPWIVVAAVLIGVPFGQWVARRILCTGDQPWRADSLRMSFIIAMLAALGAMYFYWSRGKLATLQRQAALDALEREEAEKQVVRAQLMALQAQIEPHFLFNALAHVDVLIARDPAGARRLLQHLIGFLRTSLAHARAEQCTLAQEFALLRAYLDIQALRFGARLRFSLALDDAIAGLVVPPMLIQPLVENAVVHGIEPSREGGTIALSARREGDRLRLEVRDTGIGFGRDAAPGKGSGMGLTHVRERLARLFDADARLTIAETMPHGVTVTVELPLAHDAAGADASGAAVPQWRCRFSRPAVAPALAPRAPAGT
>NZ_CP016612.1|WP_016722045.1|1615510_1615804_+|2TM-domain-containing-protein
MSATTFPASDDAALLHRARRRAGARMGLRIHLLAFLAVNLMLAAMALSRGQSWFIWPLLGWGVGLAAHGLGLAWALGSGYRRLVDRELARLRNQAGR
>NZ_CP016612.1|WP_016725893.1|1613255_1615313_+|type-III-effector-protein
MPTRVPPPTLGRSHPVTGAASTATSTATTATRSGPATAPAPGRSREGLLAELPTGRTARTPSVSAAGAHAGRPAWNVQGAIEAMAALSPEREKRLFKKSASPQYRYAKGLTAEQRGQLESALEQRFRNPAAPAEARDSALAMWLSVQQARLRTHTAGHRNHHNLEQFQLAALSVPIPLLALGYRRQRRRYYSSPLRPEYRTAFNNFMRVIGDPSLSEAVRQTVAQRLEYHRRSEETIARHERQLLGEHGVMGLAESGYQIGTNYDHVNLTALEREAVVESRGSGVPPALHIQALQTERSRVESGALRHQWLTRELRDAQARAGQGGAVAGSAGPSSVRQVDAAESSAAAARLRRDTANDIRRLRRPLAAEIKQWLKLADMKPLPNPKAFDNELYANAFARLLERRRPLSLISYFARWDPVVVDGAKVIQAIAKDANLRKEVFAAAETALGTCGDNVADGFANIVTMVDTHQLVDDVRSGKLDQPALEAWGRQRYRLDSLITEVNQWMASRRGHEGLPVTMTERRVAREPLETMLHAKVALKTVLDLPKNLPSSMRHRLASALKPDDLKRLAETVQAKEADPVELARYLLSNDAWRGAMKALHPAAFAALGKRFAPEKDALAKEIPPQPTDPEGLEFLDERMAYAERTDAFTQKCRAAEDTLLLSLAGRYALVPAVVGAGPSQGSR
>NZ_CP016612.1|WP_011001297.1|1612123_1613107_+|CysB-family-HTH-type-transcriptional-regulator
MNFQQLRSIREAVRRQFNLTEVANALYTSQPGVSRQIRELEDELGVEIFERYGKRLTGLTEPGREIVRIVERLLLEAENLRQAGEEFSGRQSGRLTVATTHTQARYALPKVVQAFRKAYPHVTLALQEASPSHIVELLLTGQADIGVATEAVASEPGLTSFEAYRWRHVLVVSPDHPLTKNPLPALEDVAQYPLITYDAGFTGRRNIDAAFAGAGLQPEIVLTAMDADVIKTYVALDVGVGIIASMAYDGRKDDNLVCIGADHLFEPNTTRVAVRRGAYLRGYAHDFIGMFAPHLSREAVAEAVASTVVAQPARPALVASPRQTLAA
>NZ_CP016612.1|WP_011001296.1|1610970_1612089_+|sulfate-ABC-transporter-ATP-binding-protein
MSIQVQHVTKRFGNFVALDDVSLAFRQGELTALLGPSGCGKTTLLRIIAGLEHADAGTILLNGEDASDRHVRERQVGFVFQHYALFKHMTVFENVAFGLRVKPRAQRPSEAQIRAKVKALLELVQLDWLAERYPPQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRRLHDDLHVTSLFVTHDQEEALEVADSVVLMNRGQVEQVGSPDAVYNTPATPFVYGFLGNVNLFHGRLEAGEGGSVLHVGETALSVPPGGVDASRADQAVAFVRPHEIDLERYAPGAEGIPVTLRRALTLGAVAQLELERTDSDDIIEVSLPIERFRAQGLREGETLVVRPRAIRVFAQGQGSEHAAAAQAAA
>NZ_CP016612.1|WP_016722048.1|1609993_1610974_+|sulfate-ABC-transporter-permease-subunit-CysW
MAATVSRQPGQAPAAARRGATAEAAWVRAALILVSFAFLALFLFVPLASVFYEALRKGLDVYWAALAEPDALSAITLTLSVAAIAVPLNVVFGVAAAWAIAKFEFRGKNLLLTLIDLPFSVSPVIAGLVYVLLFGAQGWFGSALSAHDFKVIFAVPGIVLATVFVTFPFVARELIPLMQAQGSEEEEAAIVLGASGWQTFFRVTLPKIKWGLLYGVILCNARAMGEFGAVSVVSGHIRGLTNTMPLHVEILYNEYDFAAAFAVASLLTLLALVTLALKTLVEWRSRRELADADAGVGEGPGRHAAPQPLSSHPHVRVQSPLEGSAA
>NZ_CP016612.1|WP_016722037.1|1625518_1626823_+|isocitrate-lyase
MSRELEVKALQQEWDTNPRWKGIKRGYSAQDVVRLRGSLQIEHTLARRGAEKLWTLMNSEPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANSNGEMYPDQSLYSVDSVPKVVKRINNTFQRADQIQWSEGKDDVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTREAVSKLVAARLAADVMGVPTVLIARTDAEAADLLTADVDDNDRPFCTGERTVEGFYRTKPGLQQAIARGLAYADYADLVWCETGKPDLEYAKKFAEAIHAKFPGKMLAYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMFNLAHGYARNQMSAFVELQEAEFAAAEKGFTAVKHQREVGTGYFDAVTQTIERDASTTALKGSTEDAQFFEEKAHAKKVA
>NZ_CP016612.1|WP_020371745.1|1626954_1627389_-|universal-stress-protein
MFQHILIPTDGSELSRKAVAGALDFAKTLGARLTAYTCLEEYPYTPFSEIVVETPQAFKERVEAQARVVLKDVEDTARAAGIDCDTDMSCFAVPYMGIIDAAERHGCDVIFMASHGRRGLAGLLLGSETQKVLTHTAIPVIVYR
>NZ_CP016612.1|WP_011001309.1|1627465_1628395_-|LysR-family-transcriptional-regulator
MAHFKQLETFVAVATRGSLSAAAAAEGVAPAIIGRRIDALEERLGVKLLVRTTRRITLTFEGSAFLEDCQRILNDLHNAEASVSAGGVKASGHLRVTAPAGFGRRHVAPMVPDFLAAHPDVSITLDLGDRIVDLVNEGFDCAIRLGDLPDSSLVSIRLWENRRVVVAAPAYLERRGRPEQLEQLAGHNCLAFGASANVQRGWVFQQGGKTVTVKVGGTMECTDGAVLREWCLQGHGLAWRSWWEVGHDIATGRLVTVLDAFEAPPIGIHAVFPQRKHLPLRVRLLIDFLKNTYGNPAYWRRADPTLLTD
>NZ_CP016612.1|WP_011001311.1|1628851_1629553_+|haloacid-dehalogenase-type-II
MTSIRAVVFDAYGTLFDVYSVAARAEQLFPGKGEALSVLWRDRQIDYTRIRSLAGPSGEHYKPFWDVTVDALRYACARLNLPLGNHAEATLMREYACLSAFPENVPVLRQLREMGLPLGILSNGNPQMLEIAVKSAGMSGLFDHVLSVDAVRLYKTAPAAYALAPRAFGVPAAQILFVSSNGWDACGATWHGFTTFWINRLGHPPEALDVAPAAAGHDMRDLLQFVQARQSMR
>NZ_CP016612.1|WP_038937772.1|1629636_1631217_+|malate-synthase-A
MELTLPQGMEIKAEILPAYEDILTPEALALVARLHRAFEPRRQQLLAERAERAKRLDAGERPDFLPETRHIREGDWTIAPIPPALECRRVEITGPVEAKMVINAFNSGADSYMTDFEDSNAPSWHNQIQGQVNLKAAIRRTLTLESGGKSYKLNDKIATLQVRPRGWHLDEKHVTVDGQRVSGGIFDFALFLFHNAREQLARGAGPFFYLPKMESHLEARLWNDVFIAAQDALGLPRGTIKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKVDQNFCLADRAKVTMTSPFMRAYALLLLKTCHKRNAPAMGGMSALIPIKNDPEKNAIAMQGIINDKKRDATDGYDGGWVAHPGLVEAAMKEFVDVLGDAPNQIGKQRPDVNVAAADLLNFQPEQPITEAGLRMNINVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLEDGTKVTAELVRKLIPEELAKVKADGAVGHFDRAAQIFEQMSTSESFSEFLTLPLYEEL
>NZ_CP016612.1|WP_011001313.1|1631323_1631794_+|DUF1857-family-protein
MRFEHLVEVNDPLNPLMDALTLNQIWQGLVLRVLEPTEFVEGLDEGIITARGEGWVERELRFGKARIQDRVTLEPHQRVTYTTAATGEHAGGSLTMTIETNEANAAFIRFVYDTTLPSADETGDTRYAEIVKSAYREADIDTVRRIREFAAIGRLG
>NZ_CP016612.1|WP_016722033.1|1633405_1633675_-|acyl-CoA-binding-protein
MSDLQTRFEQAQTDVKSLSERPSNMTLLRLYALFKQGSEGDAHGDKPGFTDIVGRYKYEAWAGLKGLSQDDARQKYIDLVEELKSGATT
>NZ_CP016612.1|WP_086706265.1|1633827_1634559_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB
MPWILAFDTSTEFCSVALGDGTRTLFRHEHTGARSSSRVLPAAGELLAEAGIALGDCAAIAFGAGPGSFTGLRTACGVAQGLAFGAGLPVVPVNSLMACAEQTRAALPVGTAVTVALDARMGECYWASFVPVAEDASGWHALSAVQVSAPQAVAPPQQPYWLAGNAAAVFGDRLAAATGAAAVLPDVAPHAREIVTLGLRLLAAGHTVRPEDAAPLYVRDKVALTIEERQAVQQAKAAAGARA
>NZ_CP016612.1|WP_021154817.1|1634555_1635089_+|ribosomal-protein-S18-alanine-N-acetyltransferase
MSQVQVDRALAGLIVRAPLPAGWRAERMSALDVAAVAAVEQAAFAFPWSRGNFEDSLKSGHLGIVLRDGGNQVAGYLILMPVVDEMHLLNVTVAPAWQRQGLGRWLLRAAQALTLAHGFASLLLEVRPSNTGAIALYRRVGFAEIGRRKRYYPAENNTREDALVMRIACEAGGVEAA
>NZ_CP016612.1|WP_086706267.1|1635159_1636122_+|uracil-DNA-glycosylase
MNRRARMLEALGVSNEWRLRGVEPAAVAVAEAEAADMVPIAGAVEAAVADAPAPRIEASPVVVAEVVPVAAPAAAAAAATVADVPTDSTVPTDSTVPTVPTDSTDSTDSTDSTDSTDSTDSTDPVAPRAQRIAAFDWAQLEAAVSGCTACKLCERRTQTVFGVGDRQADWMLIGEAPGEQEDRQGEPFVGQAGKLLDSMLRAIGLSRETGVFIANVLKCRPPGNRDPEPDEVAMCDPYLKRQIALIKPRVIVVLGRFAAQSLLQTQTPVGKLRGKVHEVDGVPVVVTYHPAYLLRTLTDKARAWEDLCLARKVYAERGGV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP016612_1	1.1\|1623135\|57\|NZ_CP016612\|CRISPRCasFinder	1623135-1623191	57	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1200220-1200276	0	1.0

1. spacer 1.1|1623135|57|NZ_CP016612|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 0, identity: 1.0

gcctccgctgccggagcagggcgccccgtccgggcgcgccgccaacagcgcttccca	CRISPR spacer
gcctccgctgccggagcagggcgccccgtccgggcgcgccgccaacagcgcttccca	Protospacer
*********************************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

32828 : 109634

Microbacterium_phage(14.29%)

holin,protease,tRNA,transposase,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011000025.1\|32828_33128_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_011000026.1\|33605_34649_+	rod shape-determining protein	NA	NA	NA	NA
WP_011000027.1\|34826_35867_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_011000028.1\|35878_36391_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_021155367.1\|36413_38819_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_011000030.1\|38842_39985_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_016726767.1\|40015_41710_-	AMP-binding protein	A0A1V0SBX8	Catovirus	4.0e-15	26.6
WP_011000032.1\|42165_43104_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_016726768.1\|43204_45838_-	DNA topoisomerase III	A0A0G2YA05	Acanthamoeba_polyphaga_mimivirus	2.8e-15	24.8
WP_011000034.1\|46068_46458_-	thioredoxin family protein	NA	NA	NA	NA
WP_016722608.1\|46498_47704_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	4.2e-27	41.5
WP_011000036.1\|47721_48894_-	LysM peptidoglycan-binding domain-containing protein	G3MBQ1	Bacillus_virus	2.9e-09	50.0
WP_011000037.1\|49147_49657_+	peptide deformylase	NA	NA	NA	NA
WP_043885530.1\|49704_51678_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_016726770.1\|51723_52707_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	7.2e-09	33.6
WP_020830855.1\|52741_53389_+	LysE family translocator	NA	NA	NA	NA
WP_011000041.1\|53507_54368_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_016726772.1\|54458_55784_+	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_020830856.1\|55797_56598_+	DUF4390 domain-containing protein	NA	NA	NA	NA
WP_019717341.1\|56594_59030_+	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_011000045.1\|59066_59786_+	response regulator	NA	NA	NA	NA
WP_023469999.1\|60162_62550_+	hypothetical protein	NA	NA	NA	NA
WP_011000047.1\|62787_63093_+	hypothetical protein	NA	NA	NA	NA
WP_016722598.1\|63296_64199_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_020830859.1\|64229_65582_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	2.6e-17	23.0
WP_021155371.1\|65578_66424_+	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_011000051.1\|66499_67405_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_020830861.1\|67408_68698_-	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	1.6e-80	47.0
WP_011000053.1\|68694_69384_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_016722594.1\|69575_70580_-	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
WP_038938142.1\|70741_72694_-	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	6.2e-12	32.9
WP_011000056.1\|72732_73338_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_016722592.1\|73429_73888_-	TfoX/Sxy family protein	NA	NA	NA	NA
WP_011000058.1\|73896_74727_-	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_011000059.1\|74740_75082_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_011000060.1\|75148_76573_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	3.2e-42	30.0
WP_011000061.1\|76821_77373_-	hypothetical protein	NA	NA	NA	NA
WP_038938143.1\|77369_77801_-	L,D-transpeptidase	NA	NA	NA	NA
WP_069079282.1\|78167_79619_+	alkaline phosphatase	NA	NA	NA	NA
WP_016722588.1\|79638_81042_+	alkaline phosphatase	NA	NA	NA	NA
WP_016722587.1\|81123_81822_+	hypothetical protein	NA	NA	NA	NA
WP_043885532.1\|81892_82798_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_011000068.1\|82832_83195_+	hypothetical protein	NA	NA	NA	NA
WP_157698864.1\|83396_84572_-	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|89918_90905_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_157698846.1\|91028_91322_-	hypothetical protein	NA	NA	NA	NA
WP_016726786.1\|91327_92146_-	hypothetical protein	NA	NA	NA	NA
WP_043897616.1\|92469_93294_-	hypothetical protein	NA	NA	NA	NA
WP_043885665.1\|93616_94441_-	hypothetical protein	NA	NA	NA	NA
WP_016726789.1\|94893_95373_-	VOC family protein	A0A2K9L4N3	Tupanvirus	2.0e-28	46.7
WP_021154765.1\|95501_96653_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_016726790.1\|96649_97477_-	thiazole synthase	NA	NA	NA	NA
WP_013213874.1\|97486_97714_-	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_043885666.1\|97710_98850_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_016726792.1\|98863_100759_-	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_086706197.1\|101176_102445_+	nitronate monooxygenase	NA	NA	NA	NA
WP_086706352.1\|102484_107503_-	autotransporter domain-containing protein	G9FH37	Rhodococcus_phage	4.3e-09	49.4
WP_016722569.1\|108006_108555_+\|tail	phage tail protein	NA	NA	NA	NA
WP_016722568.1\|108564_109098_+\|tail	phage tail protein	A0A2R3ZZT3	Microbacterium_phage	2.6e-13	32.7
WP_011000085.1\|109112_109634_+\|tail	phage tail protein	A0A2R4A082	Microbacterium_phage	1.6e-15	36.0

DBSCAN-SWA_2

242788 : 292560

Burkholderia_phage(30.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016721870.1\|242788_243775_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_016721735.1\|243979_244945_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_155738951.1\|244941_245091_+	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|245225_246212_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_043885583.1\|246532_248002_+	hypothetical protein	NA	NA	NA	NA
WP_023470008.1\|248123_248753_+	hypothetical protein	NA	NA	NA	NA
WP_043885582.1\|248809_249073_+	PAAR motif family protein	NA	NA	NA	NA
WP_021156078.1\|249524_250874_+	hypothetical protein	NA	NA	NA	NA
WP_016722382.1\|251020_251404_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_016722383.1\|251423_252503_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_011000247.1\|252663_253161_+	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_011000246.1\|253329_254511_+	isovaleryl-CoA dehydrogenase	NA	NA	NA	NA
WP_011000245.1\|254618_256445_+	bifunctional isocitrate dehydrogenase kinase/phosphatase	NA	NA	NA	NA
WP_016722384.1\|256471_257152_+	carbonate dehydratase	NA	NA	NA	NA
WP_011000243.1\|257784_258966_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_011000242.1\|258976_259687_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_016726280.1\|259697_260828_+	butyryl-CoA dehydrogenase	NA	NA	NA	NA
WP_011000240.1\|260872_261478_+	2-hydroxychromene-2-carboxylate isomerase	NA	NA	NA	NA
WP_016726279.1\|261502_261928_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_021156076.1\|261924_262614_+	HAD family phosphatase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	2.7e-10	28.9
WP_021156075.1\|262610_263045_+	hypothetical protein	NA	NA	NA	NA
WP_016726276.1\|263064_264672_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	1.5e-19	66.7
WP_011000235.1\|264692_265619_+	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_011000234.1\|265615_266410_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_016726274.1\|266445_267528_+	biotin synthase BioB	NA	NA	NA	NA
WP_021156073.1\|268153_270178_+	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_011000231.1\|270231_270531_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_016722411.1\|270538_270934_+	hypothetical protein	NA	NA	NA	NA
WP_011000229.1\|271007_271949_+	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
WP_011000228.1\|271950_272880_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	6.3e-39	35.7
WP_028852512.1\|272901_273405_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_011000226.1\|273421_273688_+	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_021156072.1\|273684_274644_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_021156071.1\|274761_275199_-	hypothetical protein	NA	NA	NA	NA
WP_021156070.1\|275458_276385_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_016722406.1\|276606_277590_+	nitronate monooxygenase	NA	NA	NA	NA
WP_086706354.1\|277795_279337_+	DUF1254 domain-containing protein	M1HNU9	Paramecium_bursaria_Chlorella_virus	3.1e-19	23.7
WP_011000220.1\|279367_280225_-	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_016721735.1\|281349_282315_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_155738951.1\|282311_282461_+	hypothetical protein	NA	NA	NA	NA
WP_086706356.1\|282982_289711_+	calcium-binding protein	NA	NA	NA	NA
WP_016722402.1\|289892_290072_+	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|290327_291314_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_155738951.1\|291448_291598_-	hypothetical protein	NA	NA	NA	NA
WP_016721735.1\|291594_292560_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1

DBSCAN-SWA_3

896825 : 959998

Acidithiobacillus_phage(48.0%)

capsid,terminase,head,portal,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020831479.1\|896825_897650_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011003086.1\|897707_898244_+	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	1.8e-46	50.3
WP_063612226.1\|898577_898979_+	hypothetical protein	NA	NA	NA	NA
WP_016721735.1\|899233_900199_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_155738951.1\|900195_900345_+	hypothetical protein	NA	NA	NA	NA
WP_011003084.1\|900537_900762_+	hypothetical protein	NA	NA	NA	NA
WP_064047856.1\|900828_901119_+	hypothetical protein	K4I011	Acidithiobacillus_phage	7.0e-13	47.6
WP_011003082.1\|901115_901598_+	hypothetical protein	K4ICR8	Acidithiobacillus_phage	4.8e-59	71.6
WP_038938203.1\|901584_902067_+	HNH endonuclease	A0A076YKQ7	Mycobacterium_phage	2.8e-22	48.3
WP_011003080.1\|902063_902525_+	lysozyme	K4I410	Acidithiobacillus_phage	1.1e-65	80.3
WP_064048075.1\|902592_902892_+	hypothetical protein	NA	NA	NA	NA
WP_069079307.1\|902954_903293_-	DUF1484 domain-containing protein	NA	NA	NA	NA
WP_016725636.1\|903747_904698_-	hypothetical protein	NA	NA	NA	NA
WP_118872359.1\|915767_916586_+	hypothetical protein	NA	NA	NA	NA
WP_069078908.1\|916664_918431_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_069078909.1\|918454_919903_+	DUF746 domain-containing protein	NA	NA	NA	NA
WP_038938302.1\|920487_920985_+	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	9.2e-21	38.8
WP_086706212.1\|920981_922364_+	recombinase family protein	K4ICM1	Acidithiobacillus_phage	4.1e-135	60.1
WP_081263769.1\|922396_922837_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_080624828.1\|923302_923617_-	hypothetical protein	NA	NA	NA	NA
WP_143102318.1\|925471_926101_+	hypothetical protein	NA	NA	NA	NA
WP_143102317.1\|926097_926418_+	hypothetical protein	NA	NA	NA	NA
WP_143102316.1\|928341_928662_+	hypothetical protein	NA	NA	NA	NA
WP_155772881.1\|928781_928997_+	hypothetical protein	NA	NA	NA	NA
WP_016722467.1\|929020_929599_+	hypothetical protein	NA	NA	NA	NA
WP_143102314.1\|929653_930133_+	hypothetical protein	NA	NA	NA	NA
WP_016722469.1\|930739_930991_+	hypothetical protein	NA	NA	NA	NA
WP_016722470.1\|931000_931342_+	hypothetical protein	NA	NA	NA	NA
WP_016722471.1\|931353_931647_+	hypothetical protein	NA	NA	NA	NA
WP_071654078.1\|932392_933616_+	glycine hydroxymethyltransferase	NA	NA	NA	NA
WP_071653944.1\|933612_934587_+	hypothetical protein	NA	NA	NA	NA
WP_139274347.1\|934755_935571_-	hypothetical protein	NA	NA	NA	NA
WP_071615617.1\|935588_937253_-	hypothetical protein	NA	NA	NA	NA
WP_071653945.1\|938000_938291_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_071653946.1\|938287_938785_+	hypothetical protein	NA	NA	NA	NA
WP_016727901.1\|938781_939654_+	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	2.9e-102	66.4
WP_016727900.1\|939672_940305_+	hypothetical protein	K4ICM8	Acidithiobacillus_phage	3.8e-64	61.0
WP_016727899.1\|940377_940782_+	hypothetical protein	K4I3X7	Acidithiobacillus_phage	8.2e-28	50.4
WP_021156153.1\|940787_941177_+	hypothetical protein	NA	NA	NA	NA
WP_064047862.1\|941160_943458_+	hypothetical protein	K4HZY1	Acidithiobacillus_phage	0.0e+00	72.1
WP_016727896.1\|943692_943902_+	hypothetical protein	NA	NA	NA	NA
WP_058908894.1\|943891_944299_+	hypothetical protein	NA	NA	NA	NA
WP_071508043.1\|944696_946100_+	site-specific DNA-methyltransferase	K4I3Y2	Acidithiobacillus_phage	8.3e-160	60.5
WP_071653948.1\|946096_947371_+	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	6.3e-199	81.1
WP_016725010.1\|947353_947734_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_016725011.1\|947730_948027_-	hypothetical protein	NA	NA	NA	NA
WP_038938808.1\|948370_948721_-	hypothetical protein	NA	NA	NA	NA
WP_016727890.1\|948848_949355_-	DUF3489 domain-containing protein	K4HZZ2	Acidithiobacillus_phage	2.9e-14	32.9
WP_071624100.1\|949484_949991_-	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	4.0e-24	72.3
WP_038938655.1\|950097_950436_-	hypothetical protein	NA	NA	NA	NA
WP_038962858.1\|950455_950992_+	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	4.2e-72	79.8
WP_071654079.1\|950994_952974_+\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	86.2
WP_071653949.1\|953017_953527_+	hypothetical protein	A0A0F6WCR7	Sinorhizobium_phage	4.8e-25	44.4
WP_016727772.1\|953537_953930_+	hypothetical protein	NA	NA	NA	NA
WP_016725356.1\|953930_954152_+	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	1.3e-11	57.5
WP_016725355.1\|954151_955678_+\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	3.4e-151	57.7
WP_071653951.1\|955687_956947_+	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	4.6e-61	43.4
WP_071653952.1\|956956_957334_+\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	6.7e-24	48.0
WP_071653953.1\|957340_958345_+\|capsid	major capsid protein	A0A1B2LRS0	Wolbachia_phage	1.9e-110	67.5
WP_020833003.1\|958347_958650_+	hypothetical protein	NA	NA	NA	NA
WP_071508048.1\|958655_959102_+	hypothetical protein	NA	NA	NA	NA
WP_071653954.1\|959224_959998_+	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	3.1e-47	43.6

DBSCAN-SWA_4

967815 : 981921

Ralstonia_phage(55.56%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071653956.1\|967815_971919_+\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	1.4e-26	28.8
WP_016727789.1\|971924_972320_+	hypothetical protein	A0A0M4UTA7	Ralstonia_phage	1.6e-31	53.0
WP_016727790.1\|972306_972879_-	hypothetical protein	NA	NA	NA	NA
WP_071895561.1\|972908_976499_+	hypothetical protein	A0A0M4U447	Ralstonia_phage	0.0e+00	53.5
WP_071653957.1\|976510_977677_+	hypothetical protein	A0A0M5TJJ3	Ralstonia_phage	7.9e-47	33.3
WP_016727799.1\|977680_978163_+	hypothetical protein	A0A0M4TU90	Ralstonia_phage	1.1e-13	44.0
WP_071508022.1\|978159_978558_+	hypothetical protein	NA	NA	NA	NA
WP_071508023.1\|978562_980398_+	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	1.1e-103	45.1
WP_058907695.1\|980407_980632_+	hypothetical protein	NA	NA	NA	NA
WP_016724633.1\|980699_980990_+	membrane protein	K4I011	Acidithiobacillus_phage	2.4e-13	48.8
WP_028860336.1\|980986_981463_+	hypothetical protein	K4ICR8	Acidithiobacillus_phage	1.4e-71	84.2
WP_058907694.1\|981459_981921_+	lysozyme	K4I410	Acidithiobacillus_phage	4.8e-64	80.3

DBSCAN-SWA_5

1095750 : 1103986

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016723343.1\|1095750_1097124_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.9e-76	38.9
WP_016723342.1\|1097150_1098098_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	9.0e-17	27.6
WP_016723341.1\|1098094_1099090_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	4.1e-28	32.3
WP_016723340.1\|1099219_1099537_+	competence protein ComEA	NA	NA	NA	NA
WP_011000869.1\|1099640_1100543_+	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	8.2e-52	40.8
WP_028852812.1\|1100623_1101736_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_016725694.1\|1101853_1102777_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	7.9e-42	35.6
WP_011000872.1\|1102933_1103986_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-33	39.4

DBSCAN-SWA_6

1780844 : 1788160

Ralstonia_phage(100.0%)

coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016727206.1\|1780844_1781234_-	transcriptional regulator	S6B268	Ralstonia_phage	4.0e-40	68.5
WP_043885700.1\|1781347_1781554_+	hypothetical protein	S6B968	Ralstonia_phage	5.6e-33	97.1
WP_038938340.1\|1781651_1782785_+	replication initiation protein	E5F076	Ralstonia_phage	2.8e-214	97.4
WP_016038709.1\|1782788_1783106_+	hypothetical protein	E5F068	Ralstonia_phage	7.5e-53	100.0
WP_016038710.1\|1783105_1783378_+	hypothetical protein	E5F069	Ralstonia_phage	7.7e-46	100.0
WP_016038711.1\|1783377_1783617_+	hypothetical protein	E5F070	Ralstonia_phage	2.0e-37	100.0
WP_016038712.1\|1783613_1783823_+\|coat	major coat protein	E5F071	Ralstonia_phage	1.9e-20	100.0
WP_016038713.1\|1783967_1785365_+	hypothetical protein	E5F072	Ralstonia_phage	2.3e-210	100.0
WP_016038714.1\|1785364_1785682_+	DUF2523 domain-containing protein	E5F073	Ralstonia_phage	2.6e-45	100.0
WP_016723073.1\|1785692_1786838_+	zonular occludens toxin	E5F074	Ralstonia_phage	2.9e-219	99.7
WP_080624830.1\|1786971_1787685_+	hypothetical protein	A0A097ZIG8	Ralstonia_phage	1.8e-62	61.8
WP_021155768.1\|1787728_1788160_+	DUF29 domain-containing protein	A0A0K2QQ08	Ralstonia_phage	1.2e-77	100.0

DBSCAN-SWA_7

2600902 : 2620542

Ralstonia_phage(76.47%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016722743.1\|2600902_2602330_-	MFS transporter	A0A0M3UL24	Mycobacterium_phage	9.4e-10	26.0
WP_020832438.1\|2602494_2602992_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_016727833.1\|2605198_2605525_+	hypothetical protein	A0JC05	Ralstonia_phage	1.1e-51	99.1
WP_100243800.1\|2605596_2605797_+	hypothetical protein	B5UAR3	Ralstonia_phage	7.4e-30	100.0
WP_015994393.1\|2606018_2606315_+	hypothetical protein	B5UAR5	Ralstonia_phage	1.4e-48	100.0
WP_015994394.1\|2606314_2606524_+	hypothetical protein	B5UAR6	Ralstonia_phage	4.4e-25	100.0
WP_015994395.1\|2606523_2606733_+	hypothetical protein	B5UAR7	Ralstonia_phage	5.5e-28	100.0
WP_015994396.1\|2606735_2606984_+	hypothetical protein	B5UAR8	Ralstonia_phage	7.5e-40	100.0
WP_015983977.1\|2606986_2607211_+	hypothetical protein	A0JC12	Ralstonia_phage	9.1e-29	100.0
WP_015994397.1\|2607286_2608822_+	hypothetical protein	B5UAS0	Ralstonia_phage	9.8e-223	100.0
WP_015994398.1\|2608834_2609164_+	DUF2523 domain-containing protein	B5UAS1	Ralstonia_phage	1.3e-52	100.0
WP_016727838.1\|2609168_2610491_+	zonular occludens toxin	A0A097ZIG6	Ralstonia_phage	1.1e-246	95.7
WP_028853467.1\|2611709_2612645_+	hypothetical protein	A0A097ZIH2	Ralstonia_phage	2.2e-172	98.7
WP_016727842.1\|2612652_2613366_-	hypothetical protein	A0JC17	Ralstonia_phage	1.1e-123	94.9
WP_016727843.1\|2613392_2613983_-	recombinase family protein	A0JC18	Ralstonia_phage	1.1e-100	98.5
WP_016722739.1\|2614205_2615522_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	6.1e-96	43.6
WP_016727844.1\|2615588_2616899_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	6.5e-74	37.6
WP_011002262.1\|2617008_2617425_-	hypothetical protein	NA	NA	NA	NA
WP_011002263.1\|2617460_2618108_-	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_016722737.1\|2618196_2620542_-	DNA translocase FtsK	G1FGP1	Mycobacterium_phage	2.5e-84	50.5

DBSCAN-SWA_8

2857955 : 2868094

unidentified_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021155205.1\|2857955_2859503_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	3.6e-23	33.6
WP_016725974.1\|2859502_2860012_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_016724070.1\|2860045_2860690_+	deoxynucleoside kinase	M1IA15	Paramecium_bursaria_Chlorella_virus	8.3e-06	27.3
WP_016724069.1\|2860746_2861571_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	2.4e-34	31.3
WP_016724068.1\|2861582_2862290_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_011002542.1\|2862297_2862984_+	energy-coupling factor ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	1.5e-13	27.2
WP_019718314.1\|2862939_2864820_-	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	A0A0B5J984	Pandoravirus	6.1e-57	37.3
WP_011002544.1\|2864855_2865998_-	molecular chaperone DnaJ	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	2.9e-22	32.7
WP_021155204.1\|2866132_2868094_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.4e-149	50.8

DBSCAN-SWA_9

2883253 : 2931336

Bacillus_phage(16.67%)

protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019718304.1\|2883253_2884885_+\|protease	MprA protease, GlyGly-CTERM protein-sorting domain-containing form	NA	NA	NA	NA
WP_069079115.1\|2885100_2887143_+\|protease	MprA protease, GlyGly-CTERM protein-sorting domain-containing form	A0A1B0T6A2	Bacillus_phage	6.0e-10	34.7
WP_011002565.1\|2887198_2887819_-	rhombosortase	NA	NA	NA	NA
WP_043886040.1\|2887815_2890683_-	bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase	NA	NA	NA	NA
WP_043886041.1\|2890862_2895143_+	TIGR02099 family protein	NA	NA	NA	NA
WP_011002568.1\|2895148_2896018_+	carbon-nitrogen hydrolase family protein	M1H5W0	Paramecium_bursaria_Chlorella_virus	8.3e-09	25.3
WP_020832609.1\|2896045_2897506_+\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_011002570.1\|2897898_2898978_+	3-deoxy-7-phosphoheptulonate synthase AroG	A0A2I6UFP9	Klebsiella_phage	1.1e-76	45.0
WP_016723669.1\|2899101_2899437_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016725993.1\|2899720_2900617_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_020832612.1\|2900689_2901247_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_011002574.1\|2901367_2902786_+	FAD-binding protein	NA	NA	NA	NA
WP_016723672.1\|2902796_2903687_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_016725995.1\|2903857_2905351_+	FAD-binding protein	NA	NA	NA	NA
WP_021155193.1\|2905361_2906483_+	glycolate oxidase subunit GlcE	NA	NA	NA	NA
WP_021155192.1\|2906492_2907740_+	glycolate oxidase subunit GlcF	NA	NA	NA	NA
WP_016725998.1\|2907791_2908169_+	CidA/LrgA family protein	NA	NA	NA	NA
WP_020832616.1\|2908165_2908888_+	LrgB family protein	NA	NA	NA	NA
WP_016725999.1\|2909046_2909442_+	VOC family protein	NA	NA	NA	NA
WP_016726000.1\|2909492_2909972_+	cupin domain-containing protein	NA	NA	NA	NA
WP_016723680.1\|2910014_2910713_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_016723681.1\|2910729_2911227_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	3.3e-26	40.0
WP_016723682.1\|2911322_2914535_-	pilus assembly protein	NA	NA	NA	NA
WP_011002586.1\|2914566_2915103_-	pilus assembly protein	NA	NA	NA	NA
WP_016723683.1\|2915106_2916135_-	PilW family protein	NA	NA	NA	NA
WP_011002588.1\|2916131_2916722_-	type IV pilus modification protein PilV	NA	NA	NA	NA
WP_016723684.1\|2916718_2917207_-	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_016723685.1\|2917210_2917651_-	type IV pilin protein	NA	NA	NA	NA
WP_011002591.1\|2917845_2918985_-	PilT/PilU family type 4a pilus ATPase	NA	NA	NA	NA
WP_011002592.1\|2919037_2920081_-	type IV pilus twitching motility protein PilT	NA	NA	NA	NA
WP_021155191.1\|2920205_2920928_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_011002594.1\|2920962_2921787_+	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
WP_016726006.1\|2921808_2922087_+	hypothetical protein	NA	NA	NA	NA
WP_069079120.1\|2922083_2922959_-	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
WP_003271865.1\|2923032_2923533_-	DNA starvation/stationary phase protection protein	A0A2H4N7L5	Lake_Baikal_phage	2.1e-20	36.2
WP_011002597.1\|2923691_2923934_-	hypothetical protein	NA	NA	NA	NA
WP_016726007.1\|2923992_2924241_-	hypothetical protein	NA	NA	NA	NA
WP_016723690.1\|2924459_2925404_-	hydrogen peroxide-inducible genes activator	A0A2P0ZL89	Lactobacillus_phage	4.0e-09	23.9
WP_016726008.1\|2926009_2926552_-	hypothetical protein	NA	NA	NA	NA
WP_023470464.1\|2926621_2927131_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_016726010.1\|2927127_2929392_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_016723694.1\|2929441_2930161_-	molecular chaperone	NA	NA	NA	NA
WP_011002604.1\|2930279_2930783_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_011002605.1\|2930832_2931336_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA

DBSCAN-SWA_10

3370406 : 3415954

Ralstonia_virus(57.14%)

holin,capsid,terminase,integrase,head,portal,plate,transposase,tail

attL 3370323:3370368|attR 3410512:3410557

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3370323:3370368	attL	NA	NA	NA	NA
WP_015985128.1\|3370406_3371489_-\|integrase	site-specific integrase	A4PE72	Ralstonia_virus	2.7e-211	100.0
WP_020832872.1\|3372419_3372593_-	hypothetical protein	NA	NA	NA	NA
WP_015985125.1\|3372579_3375384_-	DNA primase	A4PE69	Ralstonia_virus	0.0e+00	100.0
WP_016727357.1\|3375383_3375674_-	hypothetical protein	A4PE68	Ralstonia_virus	2.1e-49	94.8
WP_016727356.1\|3375670_3375943_-	hypothetical protein	NA	NA	NA	NA
WP_100243795.1\|3375939_3376416_-	hypothetical protein	A4PE67	Ralstonia_virus	1.7e-56	77.2
WP_015985122.1\|3376490_3376703_-	hypothetical protein	A4PE66	Ralstonia_virus	6.4e-32	100.0
WP_015985121.1\|3376695_3376932_-	hypothetical protein	A4PE65	Ralstonia_virus	2.1e-39	100.0
WP_015985120.1\|3376931_3377138_-	hypothetical protein	A4PE64	Ralstonia_virus	6.4e-29	100.0
WP_015985118.1\|3377295_3377529_-	hypothetical protein	A4PE62	Ralstonia_virus	1.5e-34	100.0
WP_015985117.1\|3377538_3378093_-	Bro-N domain-containing protein	A4PE61	Ralstonia_virus	1.2e-98	100.0
WP_015985116.1\|3378207_3378456_-	ogr/Delta-like zinc finger family protein	A4PE60	Ralstonia_virus	1.0e-41	100.0
WP_015985115.1\|3378452_3378647_-	hypothetical protein	A4PE59	Ralstonia_virus	1.8e-25	100.0
WP_016727352.1\|3378675_3378867_-	hypothetical protein	E5E3U0	Burkholderia_phage	3.4e-08	50.9
WP_071615658.1\|3378886_3379087_-	hypothetical protein	NA	NA	NA	NA
WP_016727351.1\|3379162_3379585_+	helix-turn-helix domain-containing protein	A4PE57	Ralstonia_virus	6.7e-73	100.0
WP_038938419.1\|3379743_3380490_+	hypothetical protein	A4PE55	Ralstonia_virus	1.2e-120	92.3
WP_016727349.1\|3380405_3381188_-	site-specific DNA-methyltransferase	A0A1S5NPU0	Burkholderia_phage	1.5e-89	64.8
WP_071895454.1\|3381138_3381348_-	Com family DNA-binding transcriptional regulator	A0A1S5NPS9	Burkholderia_phage	2.4e-15	70.4
WP_016727347.1\|3381660_3382788_-	phage late control D family protein	A4PE54	Ralstonia_virus	1.4e-202	96.5
WP_016727346.1\|3382784_3383207_-\|tail	phage tail protein	A4PE53	Ralstonia_virus	1.5e-72	97.1
WP_086706303.1\|3383209_3385873_-\|tail	phage tail protein	A4PE52	Ralstonia_virus	0.0e+00	94.7
WP_003267618.1\|3385869_3385971_-\|tail	GpE family phage tail protein	A0A077K821	Ralstonia_phage	2.7e-09	93.9
WP_016727345.1\|3385967_3386294_-\|tail	phage tail assembly protein	A4PE51	Ralstonia_virus	1.8e-49	98.1
WP_016727344.1\|3386369_3386879_-\|tail	phage major tail tube protein	A0A077KER7	Ralstonia_phage	5.4e-93	99.4
WP_016727343.1\|3386910_3388086_-\|tail	phage tail sheath protein	A0A077K9Y4	Ralstonia_phage	9.5e-218	95.4
WP_020371912.1\|3388184_3388649_-	hypothetical protein	A0A077K8R9	Ralstonia_phage	6.9e-79	90.3
WP_016727341.1\|3388645_3389398_-\|tail	tail assembly protein	A0A077K9S5	Ralstonia_phage	4.2e-126	94.0
WP_016727340.1\|3389410_3391075_-\|tail	tail protein	A0A077K818	Ralstonia_phage	1.8e-310	96.8
WP_016727339.1\|3391081_3391699_-\|tail	phage tail protein I	A0A077KER5	Ralstonia_phage	1.6e-99	95.7
WP_016727338.1\|3391691_3392600_-\|plate	baseplate assembly protein	A0A077K9X9	Ralstonia_phage	2.0e-159	98.0
WP_016727337.1\|3392602_3392950_-\|plate	baseplate assembly protein	A4PE42	Ralstonia_virus	2.9e-58	98.3
WP_016727336.1\|3392946_3393564_-\|plate	phage baseplate assembly protein V	A4PE41	Ralstonia_virus	1.2e-107	93.7
WP_080624834.1\|3393809_3394115_+	DUF3892 domain-containing protein	NA	NA	NA	NA
WP_020829521.1\|3394202_3395189_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_016723619.1\|3395393_3396359_+\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_016727335.1\|3396510_3396957_-	phage virion morphogenesis protein	A0A077K9X5	Ralstonia_phage	5.8e-67	90.5
WP_020832903.1\|3396953_3397388_-\|tail	phage tail protein	A0A077K8R3	Ralstonia_phage	4.9e-79	99.3
WP_016727333.1\|3397384_3397885_-	hypothetical protein	A4PE37	Ralstonia_virus	4.2e-82	99.4
WP_016727332.1\|3397881_3398688_-	DUF3380 domain-containing protein	A4PE36	Ralstonia_virus	4.2e-148	99.6
WP_016721970.1\|3398684_3398999_-\|holin	phage holin family protein	A4PE35	Ralstonia_virus	5.0e-49	98.1
WP_015985092.1\|3398995_3399400_-	phage-related protein	A0A077K9X1	Ralstonia_phage	2.8e-28	100.0
WP_011001871.1\|3399415_3399622_-\|tail	tail protein X	A0A077K8R0	Ralstonia_phage	1.8e-31	100.0
WP_011001872.1\|3399621_3400101_-\|head	head completion/stabilization protein	A4PE32	Ralstonia_virus	2.3e-85	100.0
WP_016721968.1\|3400198_3400921_-\|terminase	terminase endonuclease subunit	A0A077K804	Ralstonia_phage	1.3e-124	98.3
WP_016727331.1\|3400917_3401934_-\|capsid	phage major capsid protein, P2 family	A0A077KEQ8	Ralstonia_phage	2.4e-185	98.2
WP_016721963.1\|3401987_3402827_-\|capsid	GPO family capsid scaffolding protein	A0A077K9W8	Ralstonia_phage	5.9e-145	95.0
WP_016727330.1\|3402970_3404752_+\|terminase	terminase ATPase subunit family protein	A0A077K8Q7	Ralstonia_phage	0.0e+00	99.2
WP_086706305.1\|3404748_3405855_+\|portal	phage portal protein	A4PE27	Ralstonia_virus	1.4e-215	98.9
WP_015985086.1\|3405839_3406655_-	hypothetical protein	A4PE26	Ralstonia_virus	3.4e-158	100.0
WP_139274289.1\|3406564_3407497_-	hypothetical protein	A4PE25	Ralstonia_virus	1.9e-160	96.1
WP_015985084.1\|3407506_3408010_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	5.3e-93	100.0
WP_020832917.1\|3408011_3408422_-	PAAR domain-containing protein	A4PE23	Ralstonia_virus	2.0e-66	99.2
WP_080606484.1\|3408951_3409260_-	STAS-like domain-containing protein	NA	NA	NA	NA
WP_016725467.1\|3409240_3410104_-	sensor histidine kinase	NA	NA	NA	NA
WP_011002978.1\|3411198_3411537_-	DUF1484 domain-containing protein	NA	NA	NA	NA
3410512:3410557	attR	NA	NA	NA	NA
WP_016721986.1\|3411929_3412127_-	hypothetical protein	NA	NA	NA	NA
WP_011002979.1\|3412307_3412619_+	high-potential iron-sulfur protein	NA	NA	NA	NA
WP_011002980.1\|3412701_3413406_+	two-component system response regulator KdpE	NA	NA	NA	NA
WP_016721987.1\|3413409_3414435_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_016725726.1\|3414625_3415954_+\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

3475177 : 3525225

Sinorhizobium_phage(14.29%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038938388.1\|3475177_3476137_-\|protease	serine protease	A0A0F6R5W6	Sinorhizobium_phage	1.3e-07	30.0
WP_016724421.1\|3476208_3476763_-	hypothetical protein	NA	NA	NA	NA
WP_016727287.1\|3477021_3477621_-	undecaprenyl-diphosphatase	NA	NA	NA	NA
WP_011003033.1\|3477936_3479316_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.8e-13	32.4
WP_021154951.1\|3479369_3480275_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_011003035.1\|3480605_3480998_-	hypothetical protein	NA	NA	NA	NA
WP_019718977.1\|3481125_3482274_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016727284.1\|3482273_3482552_-	hypothetical protein	NA	NA	NA	NA
WP_016724425.1\|3482863_3483205_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011003039.1\|3484247_3484679_+	hypothetical protein	NA	NA	NA	NA
WP_021154949.1\|3485419_3487543_+	tryptophan 2-monooxygenase oxidoreductase	NA	NA	NA	NA
WP_038938383.1\|3487726_3488569_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_016724428.1\|3488565_3490056_-	hypothetical protein	NA	NA	NA	NA
WP_155738951.1\|3490293_3490443_-	hypothetical protein	NA	NA	NA	NA
WP_016721735.1\|3490439_3491405_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_016724429.1\|3492115_3492952_-	cytochrome c	NA	NA	NA	NA
WP_016724430.1\|3493388_3494567_-	antibiotic hydrolase	NA	NA	NA	NA
WP_016724432.1\|3495154_3495361_-	hypothetical protein	NA	NA	NA	NA
WP_011003045.1\|3495688_3495892_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	2.1e-16	63.6
WP_016725726.1\|3495944_3497273_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_011003046.1\|3497765_3498602_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_016727282.1\|3498887_3500165_+	TIGR03862 family flavoprotein	NA	NA	NA	NA
WP_016724434.1\|3500205_3501336_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_016724436.1\|3503653_3504349_-	response regulator transcription factor	NA	NA	NA	NA
WP_016727280.1\|3504513_3507546_+	autotransporter domain-containing protein	NA	NA	NA	NA
WP_016724439.1\|3507708_3509811_+	sulfotransferase family protein	NA	NA	NA	NA
WP_016724440.1\|3509807_3510971_+	glycosyl transferase family 8	NA	NA	NA	NA
WP_016727279.1\|3510983_3511886_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_011003055.1\|3511882_3512461_+	adenylyl-sulfate kinase	A0A2P1ELS9	Moumouvirus	4.5e-19	38.7
WP_021156161.1\|3512639_3514445_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_020371902.1\|3514955_3515456_-	hypothetical protein	NA	NA	NA	NA
WP_019718995.1\|3515824_3517189_-	amidohydrolase family protein	NA	NA	NA	NA
WP_016727986.1\|3517509_3518844_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	5.2e-10	21.8
WP_016725375.1\|3518985_3519429_+	cyanase	NA	NA	NA	NA
WP_016725374.1\|3519465_3520083_+	glutamine amidotransferase	NA	NA	NA	NA
WP_016725373.1\|3520113_3520449_+	DUF861 domain-containing protein	NA	NA	NA	NA
WP_071654022.1\|3520474_3521299_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_038938199.1\|3521524_3521941_+	AAA family ATPase	NA	NA	NA	NA
WP_016721870.1\|3521985_3522972_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_086706311.1\|3523111_3524254_+	AAA family ATPase	NA	NA	NA	NA
WP_071893105.1\|3524403_3525225_-\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

3543308 : 3600117

Acidithiobacillus_phage(48.84%)

capsid,terminase,integrase,head,portal,tail

attL 3549946:3549961|attR 3601370:3601385

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043897848.1\|3543308_3543770_-	lysozyme	K4I410	Acidithiobacillus_phage	7.8e-67	83.0
WP_020832987.1\|3543766_3544243_-	hypothetical protein	K4ICR8	Acidithiobacillus_phage	1.4e-71	85.9
WP_003270772.1\|3544239_3544530_-	membrane protein	K4I011	Acidithiobacillus_phage	3.1e-13	47.6
WP_016728003.1\|3544601_3544826_-	hypothetical protein	NA	NA	NA	NA
WP_086706321.1\|3544835_3546680_-	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	9.1e-106	45.7
WP_038938692.1\|3546684_3547083_-	hypothetical protein	NA	NA	NA	NA
WP_016727796.1\|3547079_3547562_-	hypothetical protein	A0A0M4TU90	Ralstonia_phage	1.5e-12	42.7
WP_016727795.1\|3547565_3548732_-	hypothetical protein	A0A0M5TJJ3	Ralstonia_phage	5.6e-45	32.3
WP_086706323.1\|3548743_3552334_-	hypothetical protein	A0A0M4U447	Ralstonia_phage	0.0e+00	53.4
3549946:3549961	attL	NA	NA	NA	NA
WP_086706325.1\|3552334_3552730_-	hypothetical protein	A0A0M4UTA7	Ralstonia_phage	2.0e-31	52.3
WP_086706328.1\|3552735_3556839_-\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	1.3e-24	27.5
WP_023470090.1\|3556904_3558032_-	DNA cytosine methyltransferase	Q6J1P4	Burkholderia_virus	1.1e-98	53.5
WP_038938660.1\|3558641_3560108_+	type III secretion system YopJ family effector PopP2	NA	NA	NA	NA
WP_016723655.1\|3560293_3560584_+	H-NS histone family protein	NA	NA	NA	NA
WP_086706330.1\|3560626_3561271_-	hypothetical protein	NA	NA	NA	NA
WP_038938671.1\|3561245_3561467_-	hypothetical protein	NA	NA	NA	NA
WP_016723647.1\|3561463_3561859_-	hypothetical protein	NA	NA	NA	NA
WP_058908386.1\|3561867_3562641_-	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	3.1e-47	43.6
WP_016727774.1\|3562766_3563213_-	hypothetical protein	NA	NA	NA	NA
WP_021154690.1\|3563218_3563521_-	hypothetical protein	NA	NA	NA	NA
WP_075463052.1\|3563523_3564528_-\|capsid	major capsid protein	A0A1B2LRS0	Wolbachia_phage	9.6e-110	66.6
WP_021154688.1\|3564536_3564914_-\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	6.1e-25	49.6
WP_023470378.1\|3564923_3566174_-	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	2.4e-62	45.0
WP_069079297.1\|3566183_3567731_-\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	7.3e-149	57.1
WP_016727771.1\|3567730_3567952_-	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	5.9e-12	58.9
WP_069079221.1\|3567952_3568345_-	hypothetical protein	NA	NA	NA	NA
WP_016727881.1\|3568355_3568865_-	hypothetical protein	A0A0F6WCR7	Sinorhizobium_phage	2.8e-25	44.4
WP_086005439.1\|3568908_3570888_-\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	85.3
WP_020833012.1\|3570890_3571427_-	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	5.5e-72	81.5
WP_107523986.1\|3571446_3571785_+	hypothetical protein	NA	NA	NA	NA
WP_020833014.1\|3571890_3572406_+	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	2.3e-22	68.7
WP_016726852.1\|3572527_3572716_+	hypothetical protein	K4HZY7	Acidithiobacillus_phage	1.2e-13	66.0
WP_020371857.1\|3572940_3573306_+	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	8.5e-32	58.0
WP_086706332.1\|3573348_3574569_-	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	3.2e-192	80.7
WP_069078855.1\|3574565_3575978_-	DNA modification methylase	K4I3Y2	Acidithiobacillus_phage	1.3e-152	59.3
WP_082317314.1\|3575959_3576505_-	hypothetical protein	A0A2H4P763	Pseudomonas_phage	2.0e-24	39.6
WP_071654065.1\|3576869_3577085_-	hypothetical protein	NA	NA	NA	NA
WP_016725630.1\|3577038_3577338_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_016725341.1\|3577337_3577604_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_016725340.1\|3577658_3578042_-	hypothetical protein	NA	NA	NA	NA
WP_016725629.1\|3578034_3578244_-	hypothetical protein	NA	NA	NA	NA
WP_016725339.1\|3578245_3578710_-	hypothetical protein	K4ICN3	Acidithiobacillus_phage	1.0e-53	67.6
WP_064047872.1\|3578840_3581129_-	hypothetical protein	K4HZY1	Acidithiobacillus_phage	7.1e-286	63.4
WP_016725627.1\|3581125_3581386_-	DNA-binding protein	K4I1D6	Acidithiobacillus_phage	8.4e-18	76.8
WP_011003119.1\|3581382_3582141_-	hypothetical protein	K4HZA0	Acidithiobacillus_phage	1.3e-82	62.1
WP_016725626.1\|3582127_3582676_-	HNH endonuclease	A0A1B0TRC1	Escherichia_phage	3.1e-22	39.3
WP_038937632.1\|3582675_3583188_-	hypothetical protein	K4I3X7	Acidithiobacillus_phage	4.6e-52	66.9
WP_016725624.1\|3583195_3583843_-	hypothetical protein	K4ICM8	Acidithiobacillus_phage	7.9e-81	72.6
WP_011003123.1\|3583839_3584745_-	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	2.4e-104	68.2
WP_139233340.1\|3584716_3585268_-	helix-turn-helix domain-containing protein	A0A172JFU7	Citrobacter_phage	2.2e-23	39.2
WP_016725622.1\|3585264_3585747_-	hypothetical protein	K4HZ96	Acidithiobacillus_phage	1.0e-45	58.8
WP_089190378.1\|3585757_3586021_-	DNA-binding protein	K4I3X3	Acidithiobacillus_phage	5.3e-20	69.3
WP_016725621.1\|3586249_3586711_+	helix-turn-helix domain-containing protein	K4ICM4	Acidithiobacillus_phage	6.9e-47	64.1
WP_016725620.1\|3586760_3588992_+	hypothetical protein	K4I1D0	Acidithiobacillus_phage	4.7e-290	66.5
WP_016725619.1\|3589070_3589865_-	hypothetical protein	NA	NA	NA	NA
WP_080624758.1\|3590004_3590223_+	hypothetical protein	NA	NA	NA	NA
WP_016725617.1\|3590222_3590672_+	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	6.7e-55	71.6
WP_016725616.1\|3590668_3592057_+	recombinase family protein	K4ICM1	Acidithiobacillus_phage	5.4e-220	82.9
WP_016725615.1\|3592053_3592428_+	hypothetical protein	K4HZX2	Acidithiobacillus_phage	7.8e-41	64.6
WP_016725614.1\|3592424_3592898_+	hypothetical protein	K4I1C7	Acidithiobacillus_phage	1.4e-39	53.2
WP_016725613.1\|3593031_3593895_-	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_016725612.1\|3594114_3595557_-	nucleotidyltransferase	NA	NA	NA	NA
WP_016725611.1\|3595553_3596267_-	hypothetical protein	NA	NA	NA	NA
WP_157698858.1\|3596889_3598515_+	hypothetical protein	NA	NA	NA	NA
WP_086706386.1\|3599100_3600117_+\|integrase	site-specific integrase	A0A0A0YR56	Pseudomonas_phage	1.5e-30	32.5
3601370:3601385	attR	NA	NA	NA	NA

DBSCAN-SWA_13

3785076 : 3834483

Ralstonia_phage(23.08%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086706343.1\|3785076_3785901_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_043885519.1\|3786000_3787341_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_011003284.1\|3787316_3787982_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-24	33.5
WP_016726713.1\|3788018_3788804_-	membrane protein	NA	NA	NA	NA
WP_086706345.1\|3788951_3789752_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_021155684.1\|3789758_3791066_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_011003288.1\|3791062_3791824_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-30	41.0
WP_016722675.1\|3791820_3792492_-	ectoine/hydroxyectoine ABC transporter permease subunit EhuD	NA	NA	NA	NA
WP_016722674.1\|3792505_3793273_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011003291.1\|3793477_3794266_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_011003292.1\|3794431_3795979_-	cellobiose phosphorylase	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-10	23.8
WP_016726717.1\|3796259_3797375_+	Fic family protein	NA	NA	NA	NA
WP_016726718.1\|3797399_3798320_-	hypothetical protein	NA	NA	NA	NA
WP_011003296.1\|3798802_3799648_+	hypothetical protein	NA	NA	NA	NA
WP_016726719.1\|3799898_3800465_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	NA	NA	NA	NA
WP_016726720.1\|3800478_3800727_-	hypothetical protein	NA	NA	NA	NA
WP_080672954.1\|3800713_3801109_-	hypothetical protein	NA	NA	NA	NA
WP_016726721.1\|3801115_3801760_-	hypothetical protein	NA	NA	NA	NA
WP_071893008.1\|3801930_3802170_-	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|3802282_3803269_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_086706391.1\|3804827_3806390_+	recombinase family protein	E5DV73	Deep-sea_thermophilic_phage	8.4e-12	26.8
WP_016726724.1\|3806386_3807289_+	chromosome partitioning protein ParB	NA	NA	NA	NA
WP_016726725.1\|3807285_3808167_+	chromosome partitioning protein ParB	NA	NA	NA	NA
WP_016726726.1\|3808348_3808996_-	hypothetical protein	NA	NA	NA	NA
WP_016721735.1\|3809426_3810392_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_155738951.1\|3810388_3810538_+	hypothetical protein	NA	NA	NA	NA
WP_086706393.1\|3810576_3812301_+	molecular chaperone HscC	F2Y0P3	Organic_Lake_phycodnavirus	2.9e-82	33.6
WP_157698860.1\|3812318_3813860_+	hypothetical protein	NA	NA	NA	NA
WP_016726729.1\|3813875_3814568_+	prepilin peptidase	NA	NA	NA	NA
WP_016726730.1\|3814663_3814927_-	hypothetical protein	A4PE23	Ralstonia_virus	2.8e-05	42.0
WP_080624806.1\|3815404_3817081_-	DUF2875 domain-containing protein	NA	NA	NA	NA
WP_086706348.1\|3817077_3819153_-	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	3.8e-20	30.4
WP_086706350.1\|3819166_3821914_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	7.2e-91	33.0
WP_016726734.1\|3822723_3823476_+	hypothetical protein	NA	NA	NA	NA
WP_157698861.1\|3823650_3824577_+	hypothetical protein	NA	NA	NA	NA
WP_038938124.1\|3824981_3825500_-	hypothetical protein	NA	NA	NA	NA
WP_157698862.1\|3825566_3826295_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016721870.1\|3826607_3827594_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_157698863.1\|3827717_3828608_-	hypothetical protein	NA	NA	NA	NA
WP_080624808.1\|3828643_3829639_-	hypothetical protein	NA	NA	NA	NA
WP_038938122.1\|3829706_3830639_-	AAA family ATPase	NA	NA	NA	NA
WP_155738951.1\|3831820_3831970_-	hypothetical protein	NA	NA	NA	NA
WP_016721735.1\|3831966_3832932_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_086004744.1\|3833116_3834483_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.6e-75	53.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP016613

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

22632 : 55125

Burkholderia_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011003886.1\|22632_22764_+\|transposase	transposase	NA	NA	NA	NA
WP_016725683.1\|22968_23439_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_080624764.1\|23489_23822_+	hypothetical protein	NA	NA	NA	NA
WP_086004752.1\|24060_24862_+\|transposase	IS5-like element IS1421 family transposase	A0A0M5M147	Mycobacterium_phage	3.6e-27	35.5
WP_081263831.1\|25451_27086_-	1,4-beta-cellobiosidase	NA	NA	NA	NA
WP_016721870.1\|27455_28442_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_080672958.1\|28807_29101_-	hypothetical protein	A0A2H4JIC6	uncultured_Caudovirales_phage	1.2e-20	89.1
WP_016727887.1\|29733_29955_+	hypothetical protein	NA	NA	NA	NA
WP_157698866.1\|31546_32697_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.7e-94	61.1
WP_016721870.1\|32806_33793_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_016727894.1\|35956_36529_+	hypothetical protein	NA	NA	NA	NA
WP_086706400.1\|36876_37317_-	hypothetical protein	NA	NA	NA	NA
WP_019719041.1\|38510_39530_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_038938585.1\|40249_40627_+	DUF2946 domain-containing protein	NA	NA	NA	NA
WP_020371953.1\|40717_41761_+	transporter	NA	NA	NA	NA
WP_011003864.1\|41750_42308_+	redoxin domain-containing protein	NA	NA	NA	NA
WP_155739017.1\|43235_43379_-	hypothetical protein	NA	NA	NA	NA
WP_016725380.1\|43925_44432_-	chromate resistance protein	NA	NA	NA	NA
WP_011003856.1\|44485_45691_-	chromate transporter	NA	NA	NA	NA
WP_011003855.1\|45709_46681_-	hypothetical protein	NA	NA	NA	NA
WP_011003854.1\|46813_47086_-	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_016725378.1\|47187_48315_+	nickel/cobalt efflux protein RcnA	NA	NA	NA	NA
WP_052328822.1\|48607_49975_-	amidohydrolase family protein	NA	NA	NA	NA
WP_021156082.1\|50647_52417_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_016724448.1\|52459_52981_-	hypothetical protein	NA	NA	NA	NA
WP_100243798.1\|52977_53163_-	hypothetical protein	NA	NA	NA	NA
WP_157698867.1\|53382_53553_-	hypothetical protein	NA	NA	NA	NA
WP_155738951.1\|54013_54163_-	hypothetical protein	NA	NA	NA	NA
WP_016721735.1\|54159_55125_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1

DBSCAN-SWA_2

675388 : 746448

Ralstonia_phage(45.45%)

integrase,transposase

attL 666836:666854|attR 721235:721253

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
666836:666854	attL	NA	NA	NA	NA
WP_038938784.1\|675388_676402_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_016722246.1\|677512_677866_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_049832992.1\|677930_678305_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_096761523.1\|678243_678621_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_038938784.1\|678967_679981_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_016722243.1\|680393_681659_-	EAL domain-containing protein	NA	NA	NA	NA
WP_038937995.1\|681907_685204_+	hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	9.1e-32	35.6
WP_023470119.1\|685277_685937_-	response regulator transcription factor	NA	NA	NA	NA
WP_016721735.1\|686312_687278_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_155738951.1\|687274_687424_+	hypothetical protein	NA	NA	NA	NA
WP_086706472.1\|687467_691397_+	hemagglutinin	NA	NA	NA	NA
WP_016722239.1\|691514_692765_+	phosphoadenosine phosphosulfate reductase	L0P6Z6	Lactobacillus_phage	2.2e-55	35.5
WP_016722238.1\|692740_693178_+	transcriptional regulator	NA	NA	NA	NA
WP_016722237.1\|693164_693794_+	ParB-like nuclease domain-containing protein	A0A0F7L444	uncultured_marine_virus	8.0e-54	51.8
WP_021155869.1\|693860_694913_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_016726465.1\|695070_696630_+	altronate dehydratase	NA	NA	NA	NA
WP_020371812.1\|696682_698029_+	MFS transporter	NA	NA	NA	NA
WP_020830578.1\|697997_698792_+	4-hydroxy-2-oxoheptanedioate aldolase	NA	NA	NA	NA
WP_011004858.1\|698825_699911_+	tartrate dehydrogenase	NA	NA	NA	NA
WP_020830577.1\|699942_701424_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_021155868.1\|701664_702951_+	hypothetical protein	NA	NA	NA	NA
WP_038937993.1\|703263_704697_-	membrane protein	NA	NA	NA	NA
WP_011004854.1\|704719_705091_-	hypothetical protein	NA	NA	NA	NA
WP_020830573.1\|705106_706297_-	hypothetical protein	NA	NA	NA	NA
WP_016726460.1\|706334_707234_-	hypothetical protein	NA	NA	NA	NA
WP_023470115.1\|707274_715248_-	hypothetical protein	NA	NA	NA	NA
WP_038937992.1\|715291_716161_-	hypothetical protein	NA	NA	NA	NA
WP_011004849.1\|716174_717287_-	HNH endonuclease	NA	NA	NA	NA
WP_016726457.1\|718201_718948_+	hypothetical protein	NA	NA	NA	NA
WP_016726456.1\|719333_720263_+	hypothetical protein	NA	NA	NA	NA
WP_021155865.1\|720259_721711_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
721235:721253	attR	NA	NA	NA	NA
WP_016722225.1\|721707_722973_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_016722224.1\|722965_726160_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	7.9e-65	22.6
WP_011004842.1\|726743_726920_+	tannase/feruloyl esterase family alpha/beta hydrolase	NA	NA	NA	NA
WP_069079485.1\|726967_728191_+	3-(3-hydroxy-phenyl)propionate transporter MhpT	A0A0M3UL24	Mycobacterium_phage	3.7e-07	29.6
WP_016721956.1\|728312_729437_+	porin	NA	NA	NA	NA
WP_021155862.1\|729927_732582_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	0.0e+00	82.7
WP_016721735.1\|732712_733678_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_155738951.1\|733674_733824_+	hypothetical protein	NA	NA	NA	NA
WP_157698869.1\|733852_734059_+	hypothetical protein	A0A077K8Q4	Ralstonia_phage	6.9e-07	51.5
WP_020830559.1\|734055_734892_+	hypothetical protein	A0A077KEQ4	Ralstonia_phage	1.9e-103	72.8
WP_016725032.1\|737285_738176_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_020830555.1\|738692_739835_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016725034.1\|739910_741425_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_016726445.1\|741443_742640_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_016726444.1\|742843_744079_+	cystathionine gamma-synthase family protein	NA	NA	NA	NA
WP_016721870.1\|745461_746448_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7

DBSCAN-SWA_3

992858 : 1059341

Staphylococcus_phage(27.27%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016725411.1\|992858_993143_-\|transposase	transposase	NA	NA	NA	NA
WP_016725410.1\|993287_993746_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_086005114.1\|993876_994617_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_016725408.1\|994613_994916_+	AzlD family protein	NA	NA	NA	NA
WP_021155549.1\|995246_996938_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_139233389.1\|997328_997970_-	hypothetical protein	NA	NA	NA	NA
WP_152532520.1\|997990_998635_-	hypothetical protein	NA	NA	NA	NA
WP_071895813.1\|998685_999165_-	hypothetical protein	NA	NA	NA	NA
WP_071895811.1\|999395_999695_-	hypothetical protein	NA	NA	NA	NA
WP_086706430.1\|999691_1009537_-	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	5.8e-26	29.4
WP_071895809.1\|1009799_1017338_-	type III effector protein skwp2	A0A1S5SDF1	Streptococcus_phage	3.0e-06	28.8
WP_016724594.1\|1017758_1018289_-	nitrous oxide reductase accessory protein NosL	NA	NA	NA	NA
WP_016724593.1\|1018285_1019110_-	ABC transporter permease	NA	NA	NA	NA
WP_016724592.1\|1019106_1020051_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.3e-28	33.7
WP_016727950.1\|1020034_1021306_-	nitrous oxide reductase family maturation protein NosD	NA	NA	NA	NA
WP_023470146.1\|1021302_1023921_-	regulatory protein NosR	NA	NA	NA	NA
WP_028861889.1\|1023978_1025919_-	nitrous-oxide reductase	NA	NA	NA	NA
WP_020371990.1\|1026147_1026555_+	cytochrome c5 family protein	NA	NA	NA	NA
WP_016725392.1\|1026559_1027582_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_021155554.1\|1027694_1028597_+	acyltransferase	NA	NA	NA	NA
WP_016725394.1\|1029302_1031900_-	2-oxoglutarate dehydrogenase E1 component	NA	NA	NA	NA
WP_038938759.1\|1032147_1033779_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.9e-20	33.3
WP_016727946.1\|1034731_1037002_-	hypothetical protein	NA	NA	NA	NA
WP_071895717.1\|1037590_1037905_+	hypothetical protein	NA	NA	NA	NA
WP_118888231.1\|1037914_1039540_+	hypothetical protein	NA	NA	NA	NA
WP_016723835.1\|1039956_1041402_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_016723834.1\|1041703_1041913_-	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|1042846_1043833_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_086004752.1\|1045383_1046185_+\|transposase	IS5-like element IS1421 family transposase	A0A0M5M147	Mycobacterium_phage	3.6e-27	35.5
WP_071895718.1\|1046225_1046414_-	peptidoglycan-binding protein	NA	NA	NA	NA
WP_016723839.1\|1046529_1047219_-	glutathione S-transferase	NA	NA	NA	NA
WP_014631877.1\|1047257_1047620_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_011004587.1\|1047749_1048466_+	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_021156145.1\|1048504_1050127_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_016726292.1\|1050140_1051718_-	polyamine aminopropyltransferase	A0A1C9C533	Heterosigma_akashiwo_virus	5.5e-11	27.0
WP_020830396.1\|1051848_1052559_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-12	24.5
WP_019719996.1\|1052555_1053305_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.4e-12	23.6
WP_020830395.1\|1053301_1054270_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_014631870.1\|1054266_1055136_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_016726288.1\|1055184_1056444_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016721870.1\|1057155_1058142_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_155738951.1\|1058229_1058379_-	hypothetical protein	NA	NA	NA	NA
WP_016721735.1\|1058375_1059341_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1

DBSCAN-SWA_4

1550052 : 1576526

uncultured_virus(25.0%)

integrase,transposase

attL 1543219:1543233|attR 1578757:1578771

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1543219:1543233	attL	NA	NA	NA	NA
WP_023470149.1\|1550052_1551528_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_019719026.1\|1551669_1551885_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_043885730.1\|1551781_1552561_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.9e-29	33.5
WP_080624839.1\|1552908_1553799_+	VacJ family lipoprotein	NA	NA	NA	NA
WP_155773181.1\|1554044_1555136_+	type III effector protein	NA	NA	NA	NA
WP_016721870.1\|1555212_1556199_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_023470152.1\|1557613_1558270_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	4.3e-50	48.4
WP_016727464.1\|1558495_1559266_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_038938487.1\|1559413_1560928_+	deoxyribodipyrimidine photo-lyase	A0A2H4UV63	Bodo_saltans_virus	4.6e-47	27.8
WP_016727462.1\|1561175_1561430_-	hypothetical protein	NA	NA	NA	NA
WP_016727461.1\|1561536_1563159_-	chaperonin GroEL	A0A240F779	uncultured_virus	2.3e-174	60.8
WP_016727460.1\|1563241_1563559_-	co-chaperone GroES	A0A221S322	uncultured_virus	1.8e-17	47.9
WP_016727459.1\|1563735_1564371_-	hypothetical protein	NA	NA	NA	NA
WP_020830068.1\|1564542_1565202_-	carbonic anhydrase	NA	NA	NA	NA
WP_016727456.1\|1565688_1565946_+	hypothetical protein	NA	NA	NA	NA
WP_127592169.1\|1566074_1566386_+	hypothetical protein	NA	NA	NA	NA
WP_071615345.1\|1566764_1567037_-	hypothetical protein	NA	NA	NA	NA
WP_043885802.1\|1567215_1569153_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	7.7e-148	49.8
WP_038938484.1\|1569325_1569712_-	hypothetical protein	NA	NA	NA	NA
WP_020371926.1\|1569911_1570478_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_016727451.1\|1570663_1571071_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_020830062.1\|1571086_1571527_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_086706442.1\|1571826_1573536_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_058908723.1\|1573541_1576526_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.8e-80	27.5
1578757:1578771	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1745153 : 1795280

uncultured_Caudovirales_phage(22.22%)

tRNA,plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016723213.1\|1745153_1747106_-\|tRNA	class I tRNA ligase family protein	A0A1V0SK04	Klosneuvirus	5.2e-43	24.7
WP_016723214.1\|1747092_1748634_-	PLP-dependent transferase	NA	NA	NA	NA
WP_016723215.1\|1748858_1750868_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_020371709.1\|1751009_1751564_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_016723217.1\|1751775_1752492_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_139233336.1\|1753837_1754122_-	hypothetical protein	NA	NA	NA	NA
WP_016723220.1\|1754258_1754540_-	hypothetical protein	NA	NA	NA	NA
WP_086706452.1\|1754657_1755173_-	hypothetical protein	NA	NA	NA	NA
WP_016723619.1\|1755260_1756226_+\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_074960892.1\|1756990_1757629_-	hypothetical protein	NA	NA	NA	NA
WP_019719455.1\|1758120_1758759_-	hypothetical protein	NA	NA	NA	NA
WP_016725655.1\|1759130_1760795_-	membrane protein	NA	NA	NA	NA
WP_086706454.1\|1760810_1763831_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	7.8e-38	25.2
WP_021155950.1\|1763968_1764715_-	hypothetical protein	NA	NA	NA	NA
WP_021155949.1\|1765001_1765850_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_011004063.1\|1765889_1766159_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	1.8e-10	49.4
WP_086706457.1\|1766169_1767657_+	hypothetical protein	NA	NA	NA	NA
WP_086706460.1\|1767694_1771636_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_016725648.1\|1771632_1772619_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_011004059.1\|1772621_1773455_+	OmpA family protein	NA	NA	NA	NA
WP_069079379.1\|1773553_1774522_+	hypothetical protein	NA	NA	NA	NA
WP_016725645.1\|1774594_1775674_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_016725644.1\|1775807_1777151_-	glycoside hydrolase family 10 protein	NA	NA	NA	NA
WP_020371705.1\|1777903_1778287_-	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|1779503_1780490_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_157698872.1\|1780728_1781530_+\|transposase	IS5-like element IS1421 family transposase	A0A0M5M147	Mycobacterium_phage	5.3e-26	35.2
WP_023470017.1\|1781549_1782113_-	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|1782673_1783660_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_144061949.1\|1783889_1784339_-	hypothetical protein	NA	NA	NA	NA
WP_020830182.1\|1784401_1785226_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_043885652.1\|1787510_1788644_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_020830185.1\|1788661_1791418_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.1e-37	25.6
WP_020830186.1\|1791438_1794156_-	type VI secretion system ATPase TssH	A0A2I7SAX5	Vibrio_phage	4.5e-85	32.0
WP_020371627.1\|1794188_1795280_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016612

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP016613

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection