CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP017370	Lactiplantibacillus plantarum strain TMW 1.277 plasmid pL1277-6	0 crisprs	NA	0	0
NZ_CP017371	Lactiplantibacillus plantarum strain TMW 1.277 plasmid pL1277-7	0 crisprs	NA	0	0
NZ_CP017369	Lactiplantibacillus plantarum strain TMW 1.277 plasmid pL1277-10	0 crisprs	NA	0	0
NZ_CP017373	Lactiplantibacillus plantarum strain TMW 1.277 plasmid pL1277-9	0 crisprs	NA	0	0
NZ_CP017366	Lactiplantibacillus plantarum strain TMW 1.277 plasmid pL1277-3, complete sequence	0 crisprs	NA	0	0
NZ_CP017363	Lactiplantibacillus plantarum strain TMW 1.277 chromosome, complete genome	0 crisprs	WYL,csa3,DinG,cas3,RT,DEDDh	0	5
NZ_CP017365	Lactiplantibacillus plantarum strain TMW 1.277 plasmid pL1277-2, complete sequence	0 crisprs	NA	0	1
NZ_CP017364	Lactiplantibacillus plantarum strain TMW 1.277 plasmid pL1277-1, complete sequence	0 crisprs	csa3	0	0
NZ_CP017368	Lactiplantibacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence	1 crisprs	NA	1	0
NZ_CP017367	Lactiplantibacillus plantarum strain TMW 1.277 plasmid pL1277-4, complete sequence	0 crisprs	NA	0	3
NZ_CP017372	Lactiplantibacillus plantarum strain TMW 1.277 plasmid pL1277-8	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2087 : 61892

unidentified_phage(18.75%)

transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012695406.1\|2087_3017_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.8e-25	30.8
WP_157113110.1\|3129_3913_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_139592727.1\|3892_4186_+	SLATT domain-containing protein	NA	NA	NA	NA
WP_012695400.1\|4455_5073_-	recombinase family protein	E5FFF9	Burkholderia_phage	1.1e-18	36.5
WP_012695399.1\|5388_6372_-	hypothetical protein	NA	NA	NA	NA
WP_012695398.1\|7551_7986_-	hypothetical protein	NA	NA	NA	NA
WP_157113775.1\|8039_8501_-	hypothetical protein	NA	NA	NA	NA
WP_012695397.1\|8543_9245_-	toll/interleukin-1 receptor domain-containing protein	NA	NA	NA	NA
WP_012695396.1\|9483_10167_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.3e-61	51.6
WP_042751027.1\|10462_11389_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	6.3e-23	27.9
WP_012695393.1\|11853_14205_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_012695392.1\|14253_15147_-	hypothetical protein	NA	NA	NA	NA
WP_176552752.1\|15172_15991_-	class A sortase	NA	NA	NA	NA
WP_042751037.1\|16012_16462_-	hypothetical protein	NA	NA	NA	NA
WP_085764786.1\|16481_16802_-	hypothetical protein	NA	NA	NA	NA
WP_085764787.1\|16804_18922_-	hypothetical protein	NA	NA	NA	NA
WP_012695389.1\|19046_19370_-	hypothetical protein	NA	NA	NA	NA
WP_085764788.1\|19435_21229_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A1C3S747	Escherichia_phage	2.9e-93	35.9
WP_012695387.1\|21249_22032_-	hypothetical protein	NA	NA	NA	NA
WP_085764789.1\|22033_24151_-	hypothetical protein	A0A1X9I6W8	Streptococcus_phage	4.6e-29	25.8
WP_012695432.1\|24261_25497_-	hypothetical protein	NA	NA	NA	NA
WP_012695431.1\|25652_26051_-	type II toxin-antitoxin system HicB family antitoxin	A0A0K2CYJ8	Paenibacillus_phage	4.6e-23	47.0
WP_012695430.1\|26080_26263_-	type II toxin-antitoxin system HicA family toxin	D6R431	Bacillus_phage	3.2e-16	58.3
WP_012695429.1\|26312_26708_-	hypothetical protein	NA	NA	NA	NA
WP_085764790.1\|26831_27026_-	hypothetical protein	NA	NA	NA	NA
WP_012695428.1\|27018_28320_-	Y-family DNA polymerase	M1Q231	Streptococcus_phage	4.6e-80	38.1
WP_187337992.1\|28477_30184_-	toprim domain-containing protein	NA	NA	NA	NA
WP_042751048.1\|30167_30392_-	hypothetical protein	NA	NA	NA	NA
WP_012695426.1\|30446_32432_-	hypothetical protein	NA	NA	NA	NA
WP_039107365.1\|32421_32907_-	hypothetical protein	NA	NA	NA	NA
WP_039107367.1\|32926_33382_-	hypothetical protein	NA	NA	NA	NA
WP_012695425.1\|33392_33689_-	hypothetical protein	NA	NA	NA	NA
WP_012695424.1\|33913_34837_-	hypothetical protein	NA	NA	NA	NA
WP_042751051.1\|34829_35258_-	thioredoxin family protein	NA	NA	NA	NA
WP_042751053.1\|35257_35452_-	hypothetical protein	NA	NA	NA	NA
WP_042751055.1\|35448_35736_-	hypothetical protein	NA	NA	NA	NA
WP_012695422.1\|35925_36918_-	hypothetical protein	A0A2H4JAH5	uncultured_Caudovirales_phage	6.9e-36	46.9
WP_042751061.1\|40017_40878_+	ParA family protein	F0PIG8	Enterococcus_phage	2.7e-36	35.1
WP_012695419.1\|40874_41273_+	hypothetical protein	NA	NA	NA	NA
WP_012695418.1\|41472_42498_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.7e-41	35.5
WP_012695417.1\|42578_43199_-	hypothetical protein	NA	NA	NA	NA
WP_085764792.1\|43200_43782_-	hypothetical protein	NA	NA	NA	NA
WP_012695416.1\|43791_45081_-	CHAP domain-containing protein	A0A076G7X7	Bacillus_phage	1.8e-12	34.3
WP_085764793.1\|45095_47048_-	ATPase	NA	NA	NA	NA
WP_012695414.1\|47060_47711_-	hypothetical protein	NA	NA	NA	NA
WP_012695413.1\|47703_48051_-	hypothetical protein	NA	NA	NA	NA
WP_085764794.1\|48176_50654_-	hypothetical protein	NA	NA	NA	NA
WP_085764795.1\|50723_52211_-	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_085764796.1\|52282_53437_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_012695409.1\|55482_57639_-	peptide cleavage/export ABC transporter	F2Y302	Organic_Lake_phycodnavirus	5.6e-22	33.5
WP_012695408.1\|57705_58338_-	helix-turn-helix transcriptional regulator	A0A0S2MVM8	Bacillus_phage	3.6e-06	46.7
WP_012695407.1\|59891_60035_-	hypothetical protein	NA	NA	NA	NA
WP_157113112.1\|60234_60393_+	hypothetical protein	NA	NA	NA	NA
WP_012695406.1\|60962_61892_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.8e-25	30.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP017368

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017368_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017368_1

5734-5835

Orphan

Consensus_repeat	Method
GTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017368_1

>merge|NZ_CP017368|1|5734-5835|CRISPRCasFinder
GTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTTGCGGGGTGTCATCAACGGACTTTCGCGAAGGTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTT

>NZ_CP017368|1|1|5734-5835|CRISPRCasFinder
GTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTT	GCGGGGTGTCATCAACGGACTTTCGCGAAG
GTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017368.1\|WP_085764848.1\|8450_9035_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP017368.1\|WP_085764849.1\|9077_9719_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017368.1\|WP_085764846.1\|3608_4289_-\|zeta-toxin-family-protein	unknown	unknown	gnl\|CDD\|226648
NZ_CP017368.1\|WP_085764852.1\|11452_12865_-\|LtrC	unknown	unknown	unknown
NZ_CP017368.1\|WP_085764851.1\|11185_11431_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017368.1\|WP_010620892.1\|4285_4471_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017368.1\|WP_085764843.1\|381_675_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017368.1\|WP_003636296.1\|7524_8316_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|224113
NZ_CP017368.1\|WP_085764850.1\|10805_11021_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017368.1\|WP_010014831.1\|4517_4799_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|274102
NZ_CP017368.1\|WP_014940856.1\|3340_3619_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017368.1\|WP_085764854.1\|13202_15341_-\|type-IA-DNA-topoisomerase	unknown	unknown	gnl\|CDD\|236078
NZ_CP017368.1\|WP_085764844.1\|781_2839_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473
NZ_CP017368.1\|WP_085764853.1\|12867_13083_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017368.1\|WP_187337993.1\|3090_3318_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017368.1\|WP_187337996.1\|15357_16041_-\|conjugal-transfer-protein	unknown	unknown	unknown
NZ_CP017368.1\|WP_010011603.1\|7213_7453_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP017368.1\|WP_085764848.1\|8450_9035_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	1.55619e-44
NZ_CP017368.1\|WP_085764854.1\|13202_15341_-\|type-IA-DNA-topoisomerase	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NZ_CP017368.1\|WP_085764844.1\|781_2839_-\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	1.25231e-101
NZ_CP017368.1\|WP_010014831.1\|4517_4799_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	6.2967e-11
NZ_CP017368.1\|WP_085764846.1\|3608_4289_-\|zeta-toxin-family-protein	gnl\|CDD\|226648	COG4185, COG4185, Uncharacterized protein conserved in bacteria [Function unknown].	9.99558e-39
NZ_CP017368.1\|WP_003636296.1\|7524_8316_-\|AAA-family-ATPase	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	1.90607e-27

>NZ_CP017368.1|WP_010014831.1|4517_4799_-|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MAVKEKKRVQVQIDKELADNTEAVLSQLGLNPTTAINMFYKRIVADAALPFKPALSEAERANLSLLKATKETPVTEFKDAKEVADWLNDPDED
>NZ_CP017368.1|WP_010620892.1|4285_4471_-|hypothetical-protein
MKDTITINDFFEIAKETDLKDLLDKSLHEPDPEKRKVYDALYTYFLDKRQDEVIKRKDFVR
>NZ_CP017368.1|WP_085764846.1|3608_4289_-|zeta-toxin-family-protein
MIDKPQYIIVAGINGAGKSTLYDTFPILFDKTKRINADELLRQMGGDWHKDSDNLKAMKEEIKQLHYALDHQQSIHVETTLAGRGKAQLNLIDKAHKNGFEVTLLYVALRDENLAIQRVNERVQKGGHGVPVATIKKRYQQSKHNLPLVAFKSDKVMIYDNSEKFTSVYAREKGQVFKNDLRHFPWINQNITYPEKVQKQLQNFANQNPEVKPKNDPENKNDRPSY
>NZ_CP017368.1|WP_014940856.1|3340_3619_+|hypothetical-protein
MSNQYEKLVEQQARLKQKIEREDFKLRQSKYYENRQSRKARSRRLIQKGALLEKYFQANNLSVEQTEELLKTFADYVNAHKPNKLKNDQPNN
>NZ_CP017368.1|WP_187337993.1|3090_3318_+|hypothetical-protein
MIGGIVMSQSNLEKQEAKLKALNQKIKDEKNNIEQRLGKQIISQANLDYANLSDDQIKLLAKQFSEFLKVKSVDH
>NZ_CP017368.1|WP_085764844.1|781_2839_-|MobA/MobL-family-protein
MAIFHMSFSNISAGKGRSAIASAAYRSGEKLFDDKEGRHYFYARSVMPESFILTPKNSPEWASDREQLWNEVEKKDRKSNSRYAKEFNVALPVELSESEQKELLTKYVQENFVDEGMVADVAIHRDHPDNPHAHVMLTNRPFNPDGTWGQKTKTEYILDSHGNKTKTPAGNVRNRKIWLVDWDKKEKITEWRHNWAVSVNQVLEAKNLPDRISEKSYEEQGIDEVATQHEGINSQKEKRQEFNQNVKQQRQAKAEAKNVNEKIHNERRMQTLQRHYSFDEKRLVAQLSNRLKTFVSLENLDEKQRMLFNWKNSAMIKQAVGEDVTKQLVTITQQEKSLSEANQLLDKVVNRTVSKLYPDVDFEQITMAEKRELVKETDSEQRVFTGDELKDRLAMIRTNIINQQVLTFTKRPFASWLMLEKQEQRAKETISDILANKGYRLADIKRTKGTLLSDFDEKQQAVLKKNIKELSAVNEIKQVVDTQYNNVLSKTFPDMSLDQVKMTEKERLYTAVVYYNPELKSLEKRDLDQLRNNPPVQFTTQEHAQGLAYLSGQVKSDEIQNANLLRVLKNRGTQQLFIGEAGQDKKISAKQLEQAKQAVKQHNQKNDDFRKENMPDYRAVNYNENTPANYMNKLLSDTLMSLLYENGQDHELNRQKKAQKELEYELDKKKRQHQKHSRHSGTIHR
>NZ_CP017368.1|WP_085764843.1|381_675_-|hypothetical-protein
MKNSNEWHTLAEASRILGKNDRYVSNWIKRHDDFPKPMLMDISGKKIIHDKGIQWISEHTKKEGVLKSKVSAIEDKFLKLTVLGKHPNIPFYMCMSG
>NZ_CP017368.1|WP_010011603.1|7213_7453_-|hypothetical-protein
MAFDPENKNIKKALQKNETEQPTDTKDKLVIPVFKDEEERTKNYTFSLQPSARKRLDGLAKEHNFKSASKFLNELIKNM
>NZ_CP017368.1|WP_003636296.1|7524_8316_-|AAA-family-ATPase
MEIITFSAIKGGVGKTTLAFNYGEWLAKNGKHVLFIDLDHQSNLTQTYNIYDNQDTVGNIFLDRGKVKIHEISAYISIIAGDMHLDDIERTIENKTNKNMFLYMWLSDNYERLNLGKFEYIILDCHPDFSTATKNAVIISNAILSPITPSEHGYNAKFNLEERINELRKEAIDYSTRKSYVTTKLFFIANMIKHNTRSSRELLKALKGDPSVLATVPEKELFNRSTLDKKSLSKMAEDHKTYIDQHEFFDSMDKTFNEITEKL
>NZ_CP017368.1|WP_085764848.1|8450_9035_-|recombinase-family-protein
MAKIGYARVSSKEQHLDRQLAALRGVDKLFTDKLSGANTNRPELQKMLAYIREGDIVLVTELDRLGRNNQDLTKIMNTIQNKGATLDVLNLPSMTGIADPNLRRLMTNLIIELYKYQAESERKRIIERQQQGIALAKQQGKYHGRKPQYAKDDPRLQHAFKLYQAGMSDIDVSRNTGIKRTTFIRYRKKLNIKR
>NZ_CP017368.1|WP_085764849.1|9077_9719_-|hypothetical-protein
MTTRPQFNRNMSSRTFADFYWYKEELQSICHQYGLPAYGTKAELTKYIVAFLNGKAAAEIKPVRQLKRKTASKLTAESITLDTKLLDSGFSLNQAARTFFANYFGVEYFNFRKVMGIKMREVEKDGDVSATVADLVKVLKDPRLISFDNEEEKTYQWNSFVKAFRRDSISKKYHEPMKVAAIIWQILKKSDHPKVYTRKLVIENAELIKEFRK
>NZ_CP017368.1|WP_085764850.1|10805_11021_-|hypothetical-protein
MKIEYIRKALVFLGKLKTLARNSTGNRMTRALIDGTTSIKTIALALEVIFIIQANKLVRNISGSNRITEKG
>NZ_CP017368.1|WP_085764851.1|11185_11431_-|hypothetical-protein
MNSKIKKSNLIGMFFGLLLVAVIVGILLGILLMSLVNFPSSMNIVQALALVVLVIAPLCFLFALITCSKIFINRIFGKKSN
>NZ_CP017368.1|WP_085764852.1|11452_12865_-|LtrC
MPTKEEAEEWKKQLVDNAEQQILNLTDSEKFKSYLDTVAKFHRYSQRNIDLIYSQNPSASQVAGFKKWQNDFKRSVNKGEKGIRIAAPIIKKLTPEDQKRLDTTKEKAIVGYRYIPVFDISQTSGEPVLSAKDFVKENLADHQNVTSLYNAFKDYLNQQTDLKISEVPLATLNGAKGYFQPSTNEIVIGGDEPDNALKLKTLYHEYAHSQLHGLKSAFKDRPRAYQETQAEAVAYVAMQNIGVDTSNYSLGYVATWAKDKAVIHSALSEIQQVSNKVIELSDGLTKQLGLQQEKANKITEKIEDIAKEKLVVKADNPVEAVKKLYNNNLQNAIQESYTLSDISEKEADYFRKTATWEDVADIEKSNNAIKDLGHGYYADEYIERNDNNPHSANQSILKNNDPEQPTLSQQYKNLLKQVQDPAKNNQQAEKQLKQVHQEISNRTQNQLKDFAKHNPEVKQPEKEETQQIRR
>NZ_CP017368.1|WP_085764853.1|12867_13083_-|hypothetical-protein
MKNELEALASELPILTDKSSYKYLSEVAGNGKYIQVAWQKKNAEYLALYSTQSIKLPQIDNSVEFVDAEEV
>NZ_CP017368.1|WP_085764854.1|13202_15341_-|type-IA-DNA-topoisomerase
MSNTVILAEKPSQARSYVEAFQKSTKKQGYYTVSDPVLPENTLVTYGLGHLVELATPDKYDQKYQQWALSNLPIFPNKYKFEVSASKRTQFKIVKDLLTKADTIIVATDSGREGSNIAWSIMNQAQIDVKKKTIKRLWLNSLEKDAIITGFKNLGDWHKDYLAYKEAQTRQISDWLIGMNGSPLYTLLLRQKGVRGVYSIGRVQTPTLYMVYQRDQAIKNFKPEPYFELNAEFVANQQKFVAKLDPYQRFKDETGLMTFMQAKHVQKGSQAGLIKDVQKQAKKRASPQLFSLSSLQSAMNKRYHASASQTLAAIQSLYEAKYLSYPRTDCAYITDKEFEYLVANLTKYLGLVSKQVALTNTTPNKRYVNGKKVEEHYAIIMTKVVPTKEKLASLPKLQQQVYDLVLRTTLAMFADPYEYEETTIITQVGDANFKATGKVPTKQGWQALFDDHKADQQETATLPLVNQGDQVQANLQTPQKETTPPVPFTEGTLITAMKTAGKTLDDEEAQAILKDVQGIGTSATRANVLEVLKKRGYLVTEKNKLHVSEAGITLCKAVELEPLLTSPEMTAKWEQALQQISIEERTPDNFLEQIKKFVSKLIADVPTQLTGSAAIKQQIDHQQQAQKAAEVFLETPQATVLNKQKFYIVKPKQGESFTLPKKWSSKTLGKTAIKALVTKGETSKLKGFKSKKGKSFDAKLKLDGHKLSFDFD
>NZ_CP017368.1|WP_187337996.1|15357_16041_-|conjugal-transfer-protein
MVVVVVLARIIITLIGEADESTDVTWANIIIDAVRSAVAIPVMVFLQAFLQTRIILPLAKGMFDMNGKFSADAVYSTSQVTKSIKITGFMQILFLAFFAIVTVAFFLKMCIYFADMAFYNLSIPIVAMSIASESFDYSSTWWKKLVYYNVSMLSQVLSLTLSIWCFTHIGSKWSFVAFMGTIGFGWLVLHTPHVIQDFWASTGITKSAGRSVMRGMGNIGRNMLRGQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP014913	Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence	22508-22537	0	1.0
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP017358	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence	4830-4859	0	1.0
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP017368	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence	5770-5799	0	1.0
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP017265	Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence	26504-26533	0	1.0
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	6891-6920	0	1.0
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	20910-20939	0	1.0
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP014934	Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence	5933-5962	0	1.0
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP014937	Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence	5934-5963	0	1.0
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	MK994179	Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence	4885-4914	0	1.0
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NC_014386	Lactobacillus helveticus R0052 plasmid pIR52-1, complete sequence	1748-1777	1	0.967
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP019583	Lactobacillus helveticus strain LH5 plasmid pCBTLH5_2, complete sequence	4638-4667	1	0.967
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NC_006529	Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence	4742-4771	1	0.967
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP019033	Lactobacillus fermentum strain SNUV175 plasmid pSNU175-4, complete sequence	21083-21112	2	0.933
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NC_017468	Lactobacillus helveticus H10 plasmid pH10, complete sequence	15844-15873	2	0.933
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP033891	Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence	3330-3359	2	0.933
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP011537	Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence	7181-7210	2	0.933
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NC_017017	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence	5387-5416	3	0.9
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP014928	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence	6824-6853	3	0.9
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP014920	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence	12632-12661	3	0.9
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP047125	Lactobacillus hilgardii strain FLUB plasmid unnamed4	5237-5266	3	0.9
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NZ_CP031200	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence	39624-39653	3	0.9
NZ_CP017368_1	1.1\|5770\|30\|NZ_CP017368\|CRISPRCasFinder	5770-5799	30	NC_008498	Lactobacillus brevis ATCC 367 plasmid 1, complete sequence	8762-8791	4	0.867

1. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP014913 (Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

2. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP017358 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

3. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP017368 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

4. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP017265 (Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

5. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

6. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

7. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP014934 (Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

8. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP014937 (Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

9. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to MK994179 (Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

10. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NC_014386 (Lactobacillus helveticus R0052 plasmid pIR52-1, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcgggttgtcatcaacggactttcgcgaag	Protospacer
***** ************************

11. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP019583 (Lactobacillus helveticus strain LH5 plasmid pCBTLH5_2, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcgggttgtcatcaacggactttcgcgaag	Protospacer
***** ************************

12. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NC_006529 (Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacggactttcgcgaag	Protospacer
**********.*******************

13. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP019033 (Lactobacillus fermentum strain SNUV175 plasmid pSNU175-4, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggagtgtcgtcaacggactttcgcgaag	Protospacer
****.*****.*******************

14. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NC_017468 (Lactobacillus helveticus H10 plasmid pH10, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaag	Protospacer
**********.******.************

15. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP033891 (Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaag	Protospacer
**********.******.************

16. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP011537 (Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggagtgtcgtcaacggactttcgcgaag	Protospacer
****.*****.*******************

17. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NC_017017 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
**********.******.***********

18. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP014928 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
**********.******.***********

19. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP014920 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaat	Protospacer
**********.******.***********

20. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP047125 (Lactobacillus hilgardii strain FLUB plasmid unnamed4) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
**********.******.***********

21. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NZ_CP031200 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaat	Protospacer
**********.******.***********

22. spacer 1.1|5770|30|NZ_CP017368|CRISPRCasFinder matches to NC_008498 (Lactobacillus brevis ATCC 367 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.867

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gtggggtgtcgtcaacgaactttcgcgaac	Protospacer
*.********.******.***********

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP017367

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 19001

Staphylococcus_phage(33.33%)

transposase,integrase,bacteriocin

attL 196:211|attR 17972:17987

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085764822.1\|133_523_+	hypothetical protein	NA	NA	NA	NA
196:211	attL	NA	NA	NA	NA
WP_085764823.1\|548_932_+	YxeA family protein	NA	NA	NA	NA
WP_085764824.1\|1064_2423_-	PH domain-containing protein	NA	NA	NA	NA
WP_085764825.1\|2419_2863_-	hypothetical protein	NA	NA	NA	NA
WP_085764826.1\|2905_3214_-	hypothetical protein	NA	NA	NA	NA
WP_085764827.1\|3210_3504_-	DUF2089 family protein	NA	NA	NA	NA
WP_157113116.1\|3649_3802_+\|bacteriocin	aureocin A53 family class IId bacteriocin	NA	NA	NA	NA
WP_033609921.1\|4151_4334_-	hypothetical protein	NA	NA	NA	NA
WP_085764828.1\|5019_5508_-	hypothetical protein	NA	NA	NA	NA
WP_016527164.1\|5998_6997_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.9e-50	38.9
WP_085764829.1\|7270_8542_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_001748110.1\|8791_9136_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_003643337.1\|9129_9393_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_003646144.1\|9478_10066_+\|integrase	site-specific integrase	D2XR58	Bacillus_phage	1.3e-21	33.7
WP_085764831.1\|12483_13659_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.8e-27	29.2
WP_003646095.1\|14134_14653_+	hypothetical protein	NA	NA	NA	NA
WP_003646093.1\|14796_15174_-	YxeA family protein	NA	NA	NA	NA
WP_157113118.1\|15840_16506_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	9.8e-119	99.1
WP_002816285.1\|16559_16811_-\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4
WP_085764833.1\|17137_18334_-	ABC transporter permease	NA	NA	NA	NA
17972:17987	attR	NA	NA	NA	NA
WP_085764834.1\|18323_19001_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-33	40.7

DBSCAN-SWA_2

22837 : 23425

Bacillus_phage(100.0%)

integrase

attL 21691:21704|attR 29427:29440

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
21691:21704	attL	NA	NA	NA	NA
WP_003646103.1\|22837_23425_+\|integrase	site-specific integrase	D2XR58	Bacillus_phage	3.7e-21	32.6
WP_003646103.1\|22837_23425_+\|integrase	site-specific integrase	D2XR58	Bacillus_phage	3.7e-21	32.6
29427:29440	attR	NA	NA	NA	NA

DBSCAN-SWA_3

29621 : 30691

Lactobacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157113119.1\|29621_30691_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	4.1e-26	34.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP017363

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

318987 : 373929

Bacillus_virus(50.0%)

protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643762.1\|318987_319551_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003641929.1\|319744_320413_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_085764293.1\|320570_322076_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|322340_322709_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|322821_323331_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003643764.1\|323361_324558_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641934.1\|324667_325138_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|325156_325612_+	hypothetical protein	NA	NA	NA	NA
WP_003641936.1\|325715_326288_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_085764294.1\|326453_327374_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_047672629.1\|327510_328422_+	oxidoreductase	NA	NA	NA	NA
WP_085764295.1\|329311_329758_-	ribonuclease H	NA	NA	NA	NA
WP_003641940.1\|329995_331522_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641941.1\|331522_332494_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_024971425.1\|332571_333903_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|334368_335886_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003641944.1\|335900_337730_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|337744_338467_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_085764296.1\|339053_342737_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_085764297.1\|342738_344430_+	pre-toxin TG domain-containing protein	NA	NA	NA	NA
WP_063484811.1\|344426_345344_+	hypothetical protein	NA	NA	NA	NA
WP_003641949.1\|345387_345651_+	hypothetical protein	NA	NA	NA	NA
WP_072540096.1\|345762_346041_+	hypothetical protein	NA	NA	NA	NA
WP_053339238.1\|346179_346425_-	hypothetical protein	NA	NA	NA	NA
WP_151502030.1\|346466_346691_+	hypothetical protein	NA	NA	NA	NA
WP_053339239.1\|346819_347212_+	hypothetical protein	NA	NA	NA	NA
WP_053339240.1\|348839_349103_+	hypothetical protein	NA	NA	NA	NA
WP_003643788.1\|349219_349423_+	hypothetical protein	NA	NA	NA	NA
WP_003646452.1\|349547_349787_+	hypothetical protein	NA	NA	NA	NA
WP_003646453.1\|349804_350191_+	hypothetical protein	NA	NA	NA	NA
WP_157113079.1\|351033_351180_+	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_047672648.1\|351256_351664_+	immunity 63 family protein	NA	NA	NA	NA
WP_076655685.1\|353249_353666_+	hypothetical protein	NA	NA	NA	NA
WP_085764299.1\|353728_353992_+	hypothetical protein	NA	NA	NA	NA
WP_057136835.1\|354383_354629_+	hypothetical protein	NA	NA	NA	NA
WP_003643792.1\|355203_355623_+	hypothetical protein	NA	NA	NA	NA
WP_033608295.1\|355914_356379_+	hypothetical protein	NA	NA	NA	NA
WP_085764300.1\|356657_357275_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_085764301.1\|357278_358433_-	MFS transporter	NA	NA	NA	NA
WP_053566434.1\|358436_359228_-	HAD family hydrolase	NA	NA	NA	NA
WP_085764302.1\|359298_360171_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_085764303.1\|360330_361146_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_027821507.1\|361671_363048_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|363092_364277_+	cation:proton antiporter	NA	NA	NA	NA
WP_072533003.1\|364617_364818_+	hypothetical protein	NA	NA	NA	NA
WP_157113081.1\|365007_365181_+	hypothetical protein	NA	NA	NA	NA
WP_072533006.1\|365774_366443_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_063487606.1\|367634_367835_+	hypothetical protein	NA	NA	NA	NA
WP_003641975.1\|367962_368130_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_063487605.1\|369476_370223_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643807.1\|370354_370504_+	hypothetical protein	NA	NA	NA	NA
WP_003643808.1\|370517_371858_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_085764305.1\|371858_372602_+	response regulator transcription factor	NA	NA	NA	NA
WP_085764306.1\|372895_373669_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|373770_373929_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA

DBSCAN-SWA_2

1227783 : 1239749

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643099.1\|1227783_1228731_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_003643097.1\|1229074_1229689_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_063720948.1\|1229691_1232130_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.8
WP_003643095.1\|1232217_1232778_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_003643094.1\|1232848_1233289_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_052098033.1\|1233633_1234101_+	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	6.1e-83	99.4
WP_053566592.1\|1234075_1235050_+	hypothetical protein	A0A2P0ZL95	Lactobacillus_phage	5.0e-31	90.7
WP_161017206.1\|1235180_1235363_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003640226.1\|1237475_1239749_-	HAD-IC family P-type ATPase	M1HX51	Paramecium_bursaria_Chlorella_virus	1.3e-37	23.5

DBSCAN-SWA_3

1689791 : 1752073

Lactobacillus_phage(17.65%)

protease,integrase,tRNA,transposase

attL 1732281:1732298|attR 1758896:1758913

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085764514.1\|1689791_1691501_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.3e-93	41.5
WP_003640703.1\|1691668_1693504_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.5e-23	26.1
WP_085764515.1\|1693667_1694945_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_003640705.1\|1694941_1695184_-	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_003640706.1\|1695207_1696422_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	1.9e-27	30.5
WP_085764516.1\|1696418_1697945_-	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	7.6e-42	27.6
WP_003640708.1\|1697987_1698137_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_003640709.1\|1698168_1699362_-	serine hydrolase	NA	NA	NA	NA
WP_003640710.1\|1699777_1700920_-	molecular chaperone DnaJ	A0A2K9L588	Tupanvirus	4.3e-21	32.0
WP_003640711.1\|1701021_1702890_-	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	7.7e-137	47.2
WP_003645970.1\|1702933_1703533_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_003640713.1\|1703553_1704597_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_003640714.1\|1704987_1705698_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_003640715.1\|1705698_1706700_-	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
WP_003640716.1\|1706712_1707636_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_085764517.1\|1708120_1708642_-	shikimate kinase	NA	NA	NA	NA
WP_085764518.1\|1708644_1709742_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_003640719.1\|1709744_1711043_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_024971663.1\|1711056_1711584_-	hypothetical protein	NA	NA	NA	NA
WP_003640721.1\|1711592_1712762_-	chorismate synthase	NA	NA	NA	NA
WP_003640722.1\|1712754_1714209_-	MFS transporter	NA	NA	NA	NA
WP_003640723.1\|1714856_1715210_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_046947639.1\|1715232_1717797_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640725.1\|1717811_1718117_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003640726.1\|1718106_1718406_-	YlxR family protein	NA	NA	NA	NA
WP_003640727.1\|1718450_1719668_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640728.1\|1719688_1720165_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640729.1\|1720460_1724774_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640732.1\|1725267_1726977_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640733.1\|1727016_1728294_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640734.1\|1728331_1729117_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003640735.1\|1729132_1729912_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_003640736.1\|1730031_1730595_-	ribosome recycling factor	NA	NA	NA	NA
WP_003640737.1\|1730596_1731319_-	UMP kinase	NA	NA	NA	NA
WP_003640738.1\|1731518_1732397_-	elongation factor Ts	NA	NA	NA	NA
1732281:1732298	attL	NA	NA	NA	NA
WP_085764519.1\|1732499_1733303_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|1733527_1734250_+	HAD family hydrolase	NA	NA	NA	NA
WP_003640741.1\|1734538_1735537_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_003640742.1\|1735621_1735927_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_015825656.1\|1735910_1736669_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_025015626.1\|1736780_1737416_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640745.1\|1737473_1737710_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|1737807_1738047_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640747.1\|1738198_1738831_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_089197934.1\|1738920_1739151_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_003640748.1\|1739454_1740084_+	hypothetical protein	NA	NA	NA	NA
WP_003640749.1\|1740133_1741303_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003640750.1\|1741338_1741731_-	hypothetical protein	NA	NA	NA	NA
WP_003640751.1\|1741894_1742287_+	hypothetical protein	NA	NA	NA	NA
WP_003640752.1\|1742732_1743674_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	2.4e-78	49.0
WP_003640754.1\|1744432_1744684_+	DUF4428 domain-containing protein	NA	NA	NA	NA
WP_003640755.1\|1744905_1745289_+	SHOCT domain-containing protein	O48432	Lactobacillus_phage	4.7e-09	27.4
WP_085764520.1\|1745433_1747560_+	DUF4428 domain-containing protein	O48432	Lactobacillus_phage	2.2e-15	25.7
WP_158070696.1\|1747624_1748179_+	DUF4428 domain-containing protein	NA	NA	NA	NA
WP_079994877.1\|1748573_1748831_-\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	7.6e-11	42.7
WP_015825666.1\|1748962_1749379_-\|transposase	IS3 family transposase	A0A0C5AC89	Paenibacillus_phage	9.1e-06	35.0
WP_033607682.1\|1749438_1749906_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_077726998.1\|1750153_1750543_+\|transposase	transposase	NA	NA	NA	NA
WP_085764521.1\|1750909_1752073_+\|integrase	site-specific integrase	E9LUK6	Lactobacillus_phage	1.1e-61	38.4
1758896:1758913	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2052298 : 2112865

Lactobacillus_phage(34.88%)

protease,tail,terminase,head,transposase,integrase,capsid,portal

attL 2096437:2096458|attR 2110208:2110229

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024002521.1\|2052298_2052682_-	hypothetical protein	A0A2K9VCG4	Lactobacillus_phage	7.6e-15	62.5
WP_003641414.1\|2052668_2052965_-	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	4.9e-38	75.5
WP_187337988.1\|2052965_2054081_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	2.3e-32	77.4
WP_003642832.1\|2054259_2054694_-	hypothetical protein	NA	NA	NA	NA
WP_003642831.1\|2054696_2055146_-	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	6.1e-24	40.5
WP_085764563.1\|2055152_2060381_-	hypothetical protein	Q6SE68	Lactobacillus_prophage	1.8e-143	59.4
WP_033608823.1\|2060395_2060758_-	hypothetical protein	V5UQS8	Oenococcus_phage	3.3e-44	71.2
WP_085764564.1\|2060771_2066603_-\|tail	phage tail protein	V5URV5	Oenococcus_phage	1.0e-219	40.0
WP_031275283.1\|2066618_2066882_-	hypothetical protein	V9QKH3	Oenococcus_phage	2.3e-23	65.4
WP_033608825.1\|2066989_2067388_-	hypothetical protein	V9QJA0	Oenococcus_phage	6.6e-46	74.0
WP_099447638.1\|2067487_2067871_-\|tail	phage tail protein	V5USQ9	Oenococcus_phage	1.8e-37	58.4
WP_033608826.1\|2067972_2068338_-	hypothetical protein	V5UQS4	Oenococcus_phage	1.8e-29	54.2
WP_060417584.1\|2068337_2068889_-	HK97 gp10 family phage protein	V5URV0	Oenococcus_phage	6.7e-65	62.3
WP_003642822.1\|2068890_2069238_-	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
WP_013355731.1\|2069237_2069570_-\|head,tail	phage head-tail connector protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
WP_003642820.1\|2069581_2069758_-	hypothetical protein	NA	NA	NA	NA
WP_003642819.1\|2069770_2070793_-\|capsid	major capsid protein	V5US24	Oenococcus_phage	3.7e-117	62.5
WP_013355732.1\|2070812_2071160_-	hypothetical protein	V5UTH9	Oenococcus_phage	4.4e-30	63.8
WP_013355733.1\|2071174_2071852_-	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	6.0e-15	32.1
WP_013355734.1\|2072024_2072231_-	hypothetical protein	NA	NA	NA	NA
WP_003642815.1\|2072282_2072561_-	hypothetical protein	NA	NA	NA	NA
WP_013355736.1\|2072535_2074221_-\|capsid	minor capsid protein	V5US81	Oenococcus_phage	6.5e-119	58.0
WP_024971552.1\|2074367_2074664_-\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	1.1e-10	40.2
WP_085764565.1\|2074593_2076102_-\|portal	phage portal protein	V5US18	Oenococcus_phage	6.9e-136	51.8
WP_033098955.1\|2076113_2077352_-\|terminase	PBSX family phage terminase large subunit	M1PG09	Streptococcus_phage	1.9e-139	61.3
WP_085764566.1\|2077341_2077869_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	1.7e-57	75.1
WP_085764567.1\|2078102_2078318_-	hypothetical protein	E9LUP6	Lactobacillus_phage	1.5e-07	61.2
WP_085764568.1\|2078520_2079132_-	hypothetical protein	NA	NA	NA	NA
WP_085764569.1\|2079103_2080000_-	hypothetical protein	NA	NA	NA	NA
WP_063096770.1\|2080872_2081334_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	6.3e-40	57.0
WP_021356389.1\|2081411_2081552_-	hypothetical protein	E9LUN8	Lactobacillus_phage	3.4e-05	96.3
WP_071665406.1\|2081544_2081925_-	endodeoxyribonuclease	NA	NA	NA	NA
WP_057138635.1\|2081921_2082440_-	hypothetical protein	O03915	Lactobacillus_phage	2.9e-54	69.1
WP_022638119.1\|2082436_2082724_-	hypothetical protein	NA	NA	NA	NA
WP_060598975.1\|2082720_2083629_-	DnaD domain protein	NA	NA	NA	NA
WP_052748123.1\|2083708_2084674_-	hypothetical protein	A6M982	Geobacillus_virus	5.3e-65	54.5
WP_080392647.1\|2084685_2085216_-	host-nuclease inhibitor Gam family protein	E9LUU0	Lactobacillus_phage	2.3e-54	58.6
WP_060598973.1\|2085720_2086233_-	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	3.6e-28	42.9
WP_003642793.1\|2086300_2086606_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_003642792.1\|2086617_2086788_-	hypothetical protein	NA	NA	NA	NA
WP_011101086.1\|2086946_2087147_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101085.1\|2087293_2087530_+	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-09	30.7
WP_013355753.1\|2087567_2087882_+	hypothetical protein	NA	NA	NA	NA
WP_060598972.1\|2087938_2088166_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101778.1\|2088294_2088657_+	helix-turn-helix domain-containing protein	A0A2R2ZGJ3	Clostridioides_phage	1.7e-08	48.4
WP_003644968.1\|2088668_2089082_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3
WP_060598971.1\|2089104_2089896_+	hypothetical protein	NA	NA	NA	NA
WP_003642782.1\|2089905_2090160_+	hypothetical protein	NA	NA	NA	NA
WP_003642781.1\|2090239_2090608_+	hypothetical protein	NA	NA	NA	NA
WP_003642780.1\|2091211_2091931_+	hypothetical protein	NA	NA	NA	NA
WP_003642779.1\|2092152_2092434_+	hypothetical protein	NA	NA	NA	NA
WP_003642778.1\|2092708_2092885_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.6e-10	51.7
WP_003642777.1\|2093089_2093527_+	hypothetical protein	Q4ZCB9	Staphylococcus_virus	7.8e-16	37.0
WP_003642776.1\|2093574_2094348_+	DUF1828 domain-containing protein	NA	NA	NA	NA
WP_003642775.1\|2094450_2095572_+\|integrase	tyrosine-type recombinase/integrase	D6PSS4	Lactobacillus_phage	1.7e-46	32.4
WP_003642774.1\|2095923_2096130_-	hypothetical protein	NA	NA	NA	NA
2096437:2096458	attL	NA	NA	NA	NA
WP_063487358.1\|2096549_2096855_-	hypothetical protein	NA	NA	NA	NA
WP_178138091.1\|2096937_2097309_-	hypothetical protein	NA	NA	NA	NA
WP_063487356.1\|2097466_2097736_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_085764570.1\|2099389_2100490_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	1.2e-49	34.9
WP_085764571.1\|2100644_2102348_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	2.2e-122	40.7
WP_062690051.1\|2102344_2102818_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_085764572.1\|2103592_2103982_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	8.8e-19	44.7
WP_072535850.1\|2103974_2104313_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	7.1e-09	35.6
WP_027823040.1\|2104299_2104491_-	hypothetical protein	NA	NA	NA	NA
WP_072534928.1\|2104506_2104986_-	hypothetical protein	NA	NA	NA	NA
WP_085764573.1\|2105131_2106526_-	virulence protein	A0A1W6JQD6	Staphylococcus_phage	4.3e-68	39.4
WP_072534925.1\|2107323_2107542_-	hypothetical protein	NA	NA	NA	NA
WP_015640734.1\|2107822_2108002_-	helix-turn-helix domain-containing protein	E9LUT5	Lactobacillus_phage	4.3e-21	87.9
WP_072534924.1\|2108149_2108794_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_076633652.1\|2108872_2110030_+\|integrase	site-specific integrase	Q938N9	Temperate_phage	2.5e-53	34.3
WP_003642773.1\|2110520_2110754_+	hypothetical protein	NA	NA	NA	NA
2110208:2110229	attR	NA	NA	NA	NA
WP_003642772.1\|2110778_2111051_+	hypothetical protein	NA	NA	NA	NA
WP_085764574.1\|2111209_2112865_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	3.5e-93	41.5

DBSCAN-SWA_5

2309734 : 2318245

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642593.1\|2309734_2310313_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.9e-22	35.0
WP_003642592.1\|2310305_2311331_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	8.4e-61	41.7
WP_003642591.1\|2311327_2312782_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003642590.1\|2312766_2314986_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	7.7e-144	39.3
WP_003644726.1\|2314978_2315659_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2315658_2315913_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2315914_2316646_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003644727.1\|2316648_2317779_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2317762_2318245_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017365

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP017368

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP017367

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP017363

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection